Diaphorina citri psyllid: psy5667


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MSQKDEEEYPGVVQHGSFKYDDGTLYIGDWNERGQKHGMGHMKLPDHTRYDGTFHNGLCSGLGVMRFPDGANSTYSDIR
cccccccCECcCEEEEEEEcccccEEEEEEcccccEEEEEEEEcccccEEEEEEEcccCCcEEEEEEccccCEECcccc
*****EEEYPGVVQHGSFKYDDGTLYIGDWNERGQKHGMGHMKLPDHTRYDGTFHNGLCSGLGVMRFPDGANSTYSDI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQKDEEEYPGVVQHGSFKYDDGTLYIGDWNERGQKHGMGHMKLPDHTRYDGTFHNGLCSGLGVMRFPDGANSTYSDIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0016028 [CC]rhabdomereprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0090406 [CC]pollen tubeprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1H3I, chain A
Confidence level:very confident
Coverage over the Query: 4-78
View the alignment between query and template
View the model in PyMOL