BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy5673
         (119 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3ROS|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase
           From Lactobacillus Acidophilus
          Length = 484

 Score = 26.6 bits (57), Expect = 4.3,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 20/44 (45%)

Query: 45  IASLIARAEPELIGNRRERHAKTLEIAQEEVLTCIGICVYERLH 88
           IA+ +   E EL         K L  ++EEV  C+ IC Y   H
Sbjct: 57  IANALKEHEDELAKXXTLEXGKLLSESKEEVELCVSICNYYADH 100


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.388 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,149,031
Number of Sequences: 62578
Number of extensions: 105503
Number of successful extensions: 161
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 158
Number of HSP's gapped (non-prelim): 4
length of query: 119
length of database: 14,973,337
effective HSP length: 81
effective length of query: 38
effective length of database: 9,904,519
effective search space: 376371722
effective search space used: 376371722
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 45 (21.9 bits)