Query         psy5674
Match_columns 145
No_of_seqs    115 out of 1075
Neff          6.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:43:46 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5674.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5674hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0703|consensus              100.0 1.6E-46 3.4E-51  305.6  10.0  121   12-132     7-127 (287)
  2 PF01412 ArfGap:  Putative GTPa 100.0 3.6E-43 7.9E-48  254.1   7.7  113   19-131     2-116 (116)
  3 smart00105 ArfGap Putative GTP 100.0 1.8E-41 3.8E-46  244.1   9.2  107   28-134     1-110 (112)
  4 PLN03119 putative ADP-ribosyla 100.0 5.9E-38 1.3E-42  272.4  12.9  129    1-139     1-132 (648)
  5 PLN03131 hypothetical protein; 100.0 1.5E-37 3.4E-42  271.6  11.5  129    1-139     1-132 (705)
  6 COG5347 GTPase-activating prot 100.0 2.4E-37 5.3E-42  256.5  10.4  118   18-135     8-129 (319)
  7 PLN03114 ADP-ribosylation fact 100.0 2.1E-31 4.5E-36  221.8  11.5  123   19-141    11-139 (395)
  8 KOG0705|consensus              100.0 7.8E-31 1.7E-35  228.3   8.1  115   20-135   503-620 (749)
  9 KOG0704|consensus              100.0 2.9E-30 6.3E-35  213.9  10.0  124   20-143     9-139 (386)
 10 KOG0706|consensus              100.0 2.7E-30 5.8E-35  219.4   7.7   85   17-101    10-94  (454)
 11 KOG0521|consensus               99.9   1E-26 2.2E-31  211.4   3.2  116   20-135   416-535 (785)
 12 KOG0818|consensus               99.9 3.7E-24 8.1E-29  184.4   4.4  108   26-133     4-121 (669)
 13 KOG1117|consensus               99.8 1.9E-21 4.1E-26  175.4   5.5  110   22-131   290-403 (1186)
 14 KOG0702|consensus               99.7 1.6E-17 3.5E-22  143.1   6.6  119   11-130     6-128 (524)
 15 KOG0521|consensus               95.4  0.0032   7E-08   58.6  -0.8   73   27-101   627-700 (785)
 16 PRK12495 hypothetical protein;  93.8    0.11 2.4E-06   41.7   4.6   37   20-60     29-68  (226)
 17 TIGR02419 C4_traR_proteo phage  91.3    0.17 3.7E-06   32.8   2.2   35   26-60     27-62  (63)
 18 PRK11019 hypothetical protein;  89.8    0.18   4E-06   34.9   1.4   50   15-64     21-71  (88)
 19 PF08271 TF_Zn_Ribbon:  TFIIB z  88.4    0.36 7.7E-06   28.6   1.8   28   32-60      2-29  (43)
 20 PF01286 XPA_N:  XPA protein N-  88.3    0.17 3.6E-06   29.1   0.3   27   31-57      4-31  (34)
 21 PF00643 zf-B_box:  B-box zinc   87.9    0.42 9.2E-06   27.6   1.9   34   29-62      2-36  (42)
 22 PRK13715 conjugal transfer pro  87.5    0.39 8.5E-06   32.0   1.8   34   29-62     33-67  (73)
 23 PHA00080 DksA-like zinc finger  85.4    0.69 1.5E-05   30.7   2.1   35   27-61     28-63  (72)
 24 COG1734 DksA DnaK suppressor p  84.7     0.3 6.5E-06   35.7   0.1   32   30-61     80-112 (120)
 25 PF02318 FYVE_2:  FYVE-type zin  84.3     5.7 0.00012   28.4   6.6   56    5-60     24-89  (118)
 26 PRK00085 recO DNA repair prote  83.3    0.67 1.4E-05   36.6   1.5   32   28-59    147-179 (247)
 27 TIGR00613 reco DNA repair prot  80.9     1.6 3.5E-05   34.3   2.9   33   27-59    144-177 (241)
 28 smart00401 ZnF_GATA zinc finge  77.5       2 4.4E-05   26.5   2.0   37   29-65      2-40  (52)
 29 PF11781 RRN7:  RNA polymerase   77.5     1.8 3.9E-05   24.9   1.6   28   28-58      6-33  (36)
 30 PRK10778 dksA RNA polymerase-b  77.1     1.7 3.6E-05   32.8   1.9   45   17-62     99-144 (151)
 31 PF12760 Zn_Tnp_IS1595:  Transp  75.7     5.7 0.00012   23.7   3.6   38   18-57      7-44  (46)
 32 COG1381 RecO Recombinational D  73.8       2 4.4E-05   34.7   1.6   30   28-57    152-182 (251)
 33 PF00320 GATA:  GATA zinc finge  73.7     1.6 3.4E-05   25.0   0.7   32   33-64      1-34  (36)
 34 TIGR02890 spore_yteA sporulati  73.0     2.4 5.3E-05   32.2   1.8   45   17-62     74-119 (159)
 35 PRK11788 tetratricopeptide rep  72.9       5 0.00011   32.9   3.8   38   17-61    341-379 (389)
 36 PF01258 zf-dskA_traR:  Prokary  70.1    0.44 9.6E-06   27.1  -2.2   29   32-60      5-34  (36)
 37 cd07171 NR_DBD_ER DNA-binding   70.1     2.3 4.9E-05   28.8   1.0   31   29-62      2-32  (82)
 38 PF14803 Nudix_N_2:  Nudix N-te  69.9     2.1 4.5E-05   24.4   0.6   30   31-61      1-33  (34)
 39 cd07173 NR_DBD_AR DNA-binding   68.6     2.1 4.6E-05   28.9   0.6   32   28-62      1-32  (82)
 40 cd06966 NR_DBD_CAR DNA-binding  66.6     3.3 7.1E-05   28.7   1.2   29   31-62      1-29  (94)
 41 COG2158 Uncharacterized protei  66.1     4.6  0.0001   29.0   1.9   23   42-64     52-76  (112)
 42 cd07160 NR_DBD_LXR DNA-binding  66.1     3.7   8E-05   28.9   1.4   31   29-62     17-47  (101)
 43 cd07163 NR_DBD_TLX DNA-binding  65.2     4.2 9.1E-05   28.0   1.5   30   30-62      6-35  (92)
 44 cd06968 NR_DBD_ROR DNA-binding  63.8     3.7 8.1E-05   28.5   1.1   31   29-62      4-34  (95)
 45 KOG3507|consensus               62.7     3.8 8.2E-05   26.4   0.9   24   31-57     21-44  (62)
 46 TIGR02420 dksA RNA polymerase-  62.5     6.8 0.00015   27.6   2.3   31   27-57     77-108 (110)
 47 cd07170 NR_DBD_ERR DNA-binding  61.8     3.9 8.4E-05   28.6   0.9   30   30-62      4-33  (97)
 48 PF10764 Gin:  Inhibitor of sig  61.3     4.3 9.3E-05   24.7   0.9   26   32-58      1-26  (46)
 49 PRK00423 tfb transcription ini  60.5     6.9 0.00015   32.5   2.3   33   28-61      9-41  (310)
 50 PF07282 OrfB_Zn_ribbon:  Putat  60.4     6.2 0.00013   25.1   1.6   28   29-58     27-54  (69)
 51 cd07157 2DBD_NR_DBD1 The first  58.2     6.4 0.00014   26.8   1.5   28   32-62      2-29  (86)
 52 cd06955 NR_DBD_VDR DNA-binding  58.2     7.5 0.00016   27.7   1.8   30   30-62      6-35  (107)
 53 cd07161 NR_DBD_EcR DNA-binding  56.4     5.4 0.00012   27.5   0.9   29   31-62      2-30  (91)
 54 cd06970 NR_DBD_PNR DNA-binding  56.3     8.1 0.00018   26.7   1.7   32   28-62      4-35  (92)
 55 cd07172 NR_DBD_GR_PR DNA-bindi  55.6     5.6 0.00012   26.5   0.8   29   31-62      3-31  (78)
 56 cd06962 NR_DBD_FXR DNA-binding  55.3       7 0.00015   26.5   1.3   28   32-62      3-30  (84)
 57 cd07166 NR_DBD_REV_ERB DNA-bin  53.5     5.8 0.00013   27.2   0.6   30   30-62      3-32  (89)
 58 cd07169 NR_DBD_GCNF_like DNA-b  53.4     6.7 0.00014   26.9   0.9   32   28-62      4-35  (90)
 59 cd06965 NR_DBD_Ppar DNA-bindin  53.3     5.3 0.00012   27.0   0.4   27   33-62      2-28  (84)
 60 smart00653 eIF2B_5 domain pres  53.1      26 0.00055   25.0   3.9   42   11-58     67-109 (110)
 61 cd06957 NR_DBD_PNR_like_2 DNA-  52.6     8.3 0.00018   25.9   1.3   27   33-62      1-27  (82)
 62 cd07162 NR_DBD_PXR DNA-binding  52.5     6.3 0.00014   26.8   0.7   28   32-62      1-28  (87)
 63 cd06967 NR_DBD_TR2_like DNA-bi  52.1     9.1  0.0002   26.1   1.4   29   31-62      4-32  (87)
 64 cd06960 NR_DBD_HNF4A DNA-bindi  51.4     8.9 0.00019   25.2   1.2   27   33-62      1-27  (76)
 65 cd06956 NR_DBD_RXR DNA-binding  51.2       7 0.00015   25.9   0.7   28   32-62      2-29  (77)
 66 PF09297 zf-NADH-PPase:  NADH p  50.9      12 0.00025   20.5   1.5   30   29-60      2-31  (32)
 67 cd07168 NR_DBD_DHR4_like DNA-b  50.5     9.4  0.0002   26.2   1.3   31   29-62      5-35  (90)
 68 PF06827 zf-FPG_IleRS:  Zinc fi  50.0     8.4 0.00018   20.7   0.8   28   31-58      2-29  (30)
 69 cd06963 NR_DBD_GR_like The DNA  49.8     7.9 0.00017   25.4   0.8   27   33-62      1-27  (73)
 70 cd07156 NR_DBD_VDR_like The DN  49.6     8.9 0.00019   25.0   1.0   27   33-62      1-27  (72)
 71 cd06964 NR_DBD_RAR DNA-binding  49.5      11 0.00024   25.5   1.5   29   31-62      5-33  (85)
 72 cd06916 NR_DBD_like DNA-bindin  49.0      10 0.00022   24.7   1.2   27   33-62      1-27  (72)
 73 cd07158 NR_DBD_Ppar_like The D  48.6     6.8 0.00015   25.6   0.3   27   33-62      1-27  (73)
 74 TIGR01385 TFSII transcription   48.3      52  0.0011   27.5   5.6   31   28-58    256-294 (299)
 75 COG1997 RPL43A Ribosomal prote  48.1      14 0.00031   25.6   1.9   32   29-62     34-65  (89)
 76 COG2174 RPL34A Ribosomal prote  47.2      12 0.00027   26.1   1.5   33   26-58     30-79  (93)
 77 smart00659 RPOLCX RNA polymera  47.1     9.9 0.00021   22.8   0.8   24   32-58      4-27  (44)
 78 cd03031 GRX_GRX_like Glutaredo  47.0      24 0.00053   26.3   3.2   37   18-63     87-123 (147)
 79 cd06958 NR_DBD_COUP_TF DNA-bin  46.1     8.5 0.00018   25.2   0.5   27   33-62      1-27  (73)
 80 cd07155 NR_DBD_ER_like DNA-bin  46.1       7 0.00015   25.8   0.1   27   33-62      1-27  (75)
 81 cd07179 2DBD_NR_DBD2 The secon  46.0     8.6 0.00019   25.3   0.5   27   33-62      1-27  (74)
 82 smart00290 ZnF_UBP Ubiquitin C  45.9      16 0.00034   21.6   1.6   22   32-53      1-22  (50)
 83 cd06969 NR_DBD_NGFI-B DNA-bind  45.4      12 0.00027   24.6   1.2   28   32-62      2-29  (75)
 84 cd07165 NR_DBD_DmE78_like DNA-  45.0       8 0.00017   25.9   0.2   27   33-62      1-27  (81)
 85 PF00105 zf-C4:  Zinc finger, C  44.5     8.6 0.00019   24.7   0.3   28   31-61      1-28  (70)
 86 PF06677 Auto_anti-p27:  Sjogre  44.5      11 0.00025   22.2   0.8   24   30-56     17-40  (41)
 87 cd07154 NR_DBD_PNR_like The DN  43.3      14  0.0003   24.1   1.2   27   33-62      1-27  (73)
 88 smart00399 ZnF_C4 c4 zinc fing  42.7      12 0.00026   24.1   0.8   27   33-62      2-28  (70)
 89 PF08792 A2L_zn_ribbon:  A2L zi  42.7      16 0.00034   20.6   1.2   29   30-60      3-31  (33)
 90 PF08274 PhnA_Zn_Ribbon:  PhnA   42.6      16 0.00034   20.2   1.1   24   32-58      4-27  (30)
 91 PF03604 DNA_RNApol_7kD:  DNA d  42.4      11 0.00024   21.1   0.6   23   32-57      2-24  (32)
 92 cd00202 ZnF_GATA Zinc finger D  42.2      11 0.00024   23.5   0.5   33   32-64      1-35  (54)
 93 PF13453 zf-TFIIB:  Transcripti  42.0      22 0.00047   20.5   1.8   29   32-60      1-29  (41)
 94 cd06959 NR_DBD_EcR_like The DN  41.7      11 0.00024   24.6   0.5   27   33-62      2-28  (73)
 95 KOG3362|consensus               41.0      12 0.00025   28.4   0.6   34   28-62    116-150 (156)
 96 PRK00420 hypothetical protein;  40.9      53  0.0012   23.6   4.0   28   30-60     23-50  (112)
 97 cd06961 NR_DBD_TR DNA-binding   40.8     9.4  0.0002   25.9   0.1   27   33-62      2-28  (85)
 98 cd07164 NR_DBD_PNR_like_1 DNA-  39.7      13 0.00029   24.6   0.7   27   33-62      1-27  (78)
 99 COG0675 Transposase and inacti  39.6      17 0.00037   29.0   1.4   25   28-59    307-331 (364)
100 smart00661 RPOL9 RNA polymeras  38.0      27 0.00059   20.6   1.9   32   31-62      1-32  (52)
101 KOG4215|consensus               37.7      15 0.00032   32.0   0.8   32   28-62     17-48  (432)
102 PHA02942 putative transposase;  37.2      23 0.00049   30.5   1.9   28   29-59    324-351 (383)
103 TIGR00100 hypA hydrogenase nic  37.1      24 0.00051   25.2   1.7   30   27-60     67-96  (115)
104 smart00834 CxxC_CXXC_SSSS Puta  36.6      14 0.00031   20.8   0.4   27   32-58      7-34  (41)
105 cd07167 NR_DBD_Lrh-1_like The   35.8      13 0.00028   25.8   0.1   27   33-62      1-27  (93)
106 TIGR01384 TFS_arch transcripti  35.7      31 0.00068   23.6   2.1   31   30-60     62-100 (104)
107 PF14471 DUF4428:  Domain of un  35.1      12 0.00026   23.1  -0.1   43   32-75      1-45  (51)
108 PRK04059 rpl34e 50S ribosomal   33.4      23  0.0005   24.5   1.1   31   28-58     32-79  (88)
109 PF01927 Mut7-C:  Mut7-C RNAse   33.3      41 0.00088   24.8   2.5   32   28-59     89-133 (147)
110 TIGR00598 rad14 DNA repair pro  33.2     7.8 0.00017   30.0  -1.4   28   33-60      1-29  (172)
111 PF14376 Haem_bd:  Haem-binding  32.9      22 0.00049   26.1   1.0   15   30-44     41-55  (137)
112 PRK00432 30S ribosomal protein  32.8      31 0.00067   21.1   1.5   26   29-57     19-44  (50)
113 PTZ00074 60S ribosomal protein  31.8      22 0.00047   26.6   0.8   31   28-58     39-86  (135)
114 TIGR02605 CxxC_CxxC_SSSS putat  30.8      21 0.00045   21.4   0.5   27   32-58      7-34  (52)
115 PRK03988 translation initiatio  30.4      91   0.002   23.1   3.9   42   11-58     89-131 (138)
116 KOG4846|consensus               30.2      22 0.00048   31.5   0.7   28   31-61    133-160 (538)
117 PF04161 Arv1:  Arv1-like famil  29.8      26 0.00056   27.4   1.0   27   32-58      2-32  (208)
118 PRK06266 transcription initiat  29.6      13 0.00027   28.7  -0.8   31   31-62    118-148 (178)
119 PF13119 DUF3973:  Domain of un  29.5      20 0.00043   21.2   0.2   14   51-64      2-15  (41)
120 PF12156 ATPase-cat_bd:  Putati  29.3      23 0.00049   24.1   0.5   31   32-62      2-38  (88)
121 KOG4217|consensus               29.0      20 0.00042   32.3   0.2   30   28-60    267-296 (605)
122 TIGR00373 conserved hypothetic  28.7      14  0.0003   27.9  -0.7   30   31-61    110-139 (158)
123 PRK03681 hypA hydrogenase nick  28.6      25 0.00053   25.1   0.6   32   27-61     67-98  (114)
124 KOG1597|consensus               28.6      44 0.00094   28.2   2.1   29   32-60      2-31  (308)
125 PF06689 zf-C4_ClpX:  ClpX C4-t  28.5      40 0.00086   19.6   1.4   29   31-59      2-33  (41)
126 PF00641 zf-RanBP:  Zn-finger i  28.1      20 0.00044   19.1   0.1   16   26-41     14-29  (30)
127 COG1405 SUA7 Transcription ini  27.7      42 0.00091   27.9   1.9   28   32-60      3-30  (285)
128 PF01199 Ribosomal_L34e:  Ribos  27.3      18 0.00039   25.3  -0.3   29   29-57     40-85  (94)
129 PF13462 Thioredoxin_4:  Thiore  27.2      16 0.00034   26.1  -0.6   28   37-64      8-35  (162)
130 TIGR00382 clpX endopeptidase C  27.2      30 0.00064   30.2   1.0   30   30-59      7-38  (413)
131 PTZ00255 60S ribosomal protein  26.8      94   0.002   21.6   3.2   32   27-60     33-64  (90)
132 PRK12336 translation initiatio  26.6      99  0.0022   24.2   3.7   33   30-63     98-131 (201)
133 PF04170 NlpE:  NlpE N-terminal  26.5      28 0.00061   23.4   0.6   16   48-63      2-17  (87)
134 KOG3408|consensus               25.9      24 0.00051   26.0   0.1   44   47-90     54-106 (129)
135 PRK00564 hypA hydrogenase nick  25.8      27 0.00058   25.0   0.4   30   28-60     69-98  (117)
136 PF07762 DUF1618:  Protein of u  25.3      33 0.00071   24.3   0.8   15   43-57      1-15  (131)
137 PF04770 ZF-HD_dimer:  ZF-HD pr  24.3      42 0.00091   21.6   1.0   29   34-63     23-52  (60)
138 PTZ00218 40S ribosomal protein  24.2      31 0.00068   21.7   0.4   29   28-58     14-42  (54)
139 PF10058 DUF2296:  Predicted in  23.7      88  0.0019   19.4   2.4   40   19-58      4-52  (54)
140 smart00440 ZnF_C2C2 C2C2 Zinc   23.6      75  0.0016   18.3   2.0   27   32-58      2-36  (40)
141 PF13248 zf-ribbon_3:  zinc-rib  23.3      39 0.00085   17.6   0.6   11   28-38     14-24  (26)
142 COG1592 Rubrerythrin [Energy p  23.3 1.2E+02  0.0025   23.4   3.4   34   12-62    113-146 (166)
143 PF02148 zf-UBP:  Zn-finger in   22.6      40 0.00086   21.2   0.7   23   33-55      1-24  (63)
144 PF04810 zf-Sec23_Sec24:  Sec23  22.3      60  0.0013   18.7   1.4   27   32-58      4-32  (40)
145 PF11261 IRF-2BP1_2:  Interfero  22.3      22 0.00047   22.3  -0.6   30   30-59      3-33  (54)
146 COG2203 FhlA FOG: GAF domain [  22.1 1.2E+02  0.0026   20.3   3.1   26   77-102   142-167 (175)
147 PRK12380 hydrogenase nickel in  21.9      44 0.00096   23.7   0.9   30   27-60     67-96  (113)
148 TIGR00311 aIF-2beta translatio  21.8      73  0.0016   23.5   2.0   30   30-59     97-127 (133)
149 PF01873 eIF-5_eIF-2B:  Domain   20.8      67  0.0014   23.4   1.6   42   12-59     81-123 (125)
150 PF09723 Zn-ribbon_8:  Zinc rib  20.7      37  0.0008   19.8   0.2   27   32-58      7-34  (42)
151 smart00336 BBOX B-Box-type zin  20.5      91   0.002   17.1   1.9   32   30-61      3-35  (42)
152 PRK03824 hypA hydrogenase nick  20.3      86  0.0019   22.9   2.2   27   49-75    106-133 (135)
153 smart00782 PhnA_Zn_Ribbon PhnA  20.1      60  0.0013   19.7   1.1   29   30-58      7-44  (47)

No 1  
>KOG0703|consensus
Probab=100.00  E-value=1.6e-46  Score=305.61  Aligned_cols=121  Identities=57%  Similarity=1.092  Sum_probs=116.6

Q ss_pred             HHHHHHHHHHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhcc
Q psy5674          12 QIQDKCQNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGN   91 (145)
Q Consensus        12 ~~~e~~~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN   91 (145)
                      ...+.++..|++||+.|+|++|||||+++|.|||+|+|||||+.|+||||+||+|||+|||++||.|++|+|+.|+..||
T Consensus         7 ~~~~~~~~~l~~Ll~~~~N~~CADC~a~~P~WaSwnlGvFiC~~C~giHR~lg~hiSkVkSv~LD~W~~eqv~~m~~~GN   86 (287)
T KOG0703|consen    7 GSNERNKRRLRELLREPDNKVCADCGAKGPRWASWNLGVFICLRCAGIHRSLGVHISKVKSVTLDEWTDEQVDFMISMGN   86 (287)
T ss_pred             cccchHHHHHHHHHcCcccCcccccCCCCCCeEEeecCeEEEeecccccccccchhheeeeeeccccCHHHHHHHHHHcc
Confidence            34566788999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhhCCCCCCCCCCchHHHHHHHHHHhhcccccCC
Q psy5674          92 SRARAVYEANIPDNFRRPQTDSTLEAFIRAKYEQKKYIASE  132 (145)
Q Consensus        92 ~~~n~~~e~~~p~~~~~p~~~~~~~~fI~~KY~~k~f~~~~  132 (145)
                      .+||++||+.+|+.+.+|.++..+|+|||+||+.++|+.+.
T Consensus        87 ~~an~~~ea~~p~~~~~p~~d~~~e~FIR~KYE~kkf~~~~  127 (287)
T KOG0703|consen   87 AKANSYYEAKLPDPFRRPGPDDLVEQFIRDKYERKKFLDPE  127 (287)
T ss_pred             hhhhhhccccCCccccCCChHHHHHHHHHHHHhhhhhccch
Confidence            99999999999999999999999999999999999999975


No 2  
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=100.00  E-value=3.6e-43  Score=254.14  Aligned_cols=113  Identities=51%  Similarity=0.970  Sum_probs=91.1

Q ss_pred             HHHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHHHH
Q psy5674          19 NLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVY   98 (145)
Q Consensus        19 ~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~~~   98 (145)
                      ++|+.|++.|+|++|||||+++|+|||++||||||+.|+|+||.||+|+|+||||+||+|++++|+.|+.+||..+|++|
T Consensus         2 ~~l~~l~~~~~N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~lg~~is~VkSi~~d~w~~~ev~~~~~~GN~~~n~~~   81 (116)
T PF01412_consen    2 KILRELLKKPGNKVCADCGAPNPTWASLNYGIFLCLECAGIHRSLGVHISRVKSITMDNWSPEEVQRMREGGNKRANSIW   81 (116)
T ss_dssp             HHHHHHHCSTTCTB-TTT-SBS--EEETTTTEEE-HHHHHHHHHHTTTT--EEETTTS---HHHHHHHHHSHHHHHHHHH
T ss_pred             HHHHHHHcCcCcCcCCCCCCCCCCEEEeecChhhhHHHHHHHHHhcccchhccccccCCCCHHHHHHHHHHChHHHHHHH
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhCCCCCCCCC--CchHHHHHHHHHHhhcccccC
Q psy5674          99 EANIPDNFRRPQ--TDSTLEAFIRAKYEQKKYIAS  131 (145)
Q Consensus        99 e~~~p~~~~~p~--~~~~~~~fI~~KY~~k~f~~~  131 (145)
                      |++.+.....|.  +...+++||++||++++|+.+
T Consensus        82 e~~~~~~~~~~~~~~~~~~~~fI~~KY~~k~f~~~  116 (116)
T PF01412_consen   82 EANSPPPKKPPPSSDQEKREQFIRAKYVEKAFISK  116 (116)
T ss_dssp             TTTSTTTTTHCTTSHHHHHHHHHHHHHTTHTTS-C
T ss_pred             HcCCCCCCCCCCCCcHHHHHHHHHHHHHhhhhccC
Confidence            999443333222  234579999999999999864


No 3  
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=100.00  E-value=1.8e-41  Score=244.07  Aligned_cols=107  Identities=50%  Similarity=0.919  Sum_probs=98.2

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHHHHHhhCCCCCC
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVYEANIPDNFR  107 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~~~e~~~p~~~~  107 (145)
                      |+|++|||||+++|+|||++||||||+.|+|+||.||+|||+||||+||+|++++|++|+.+||.++|++||+++++...
T Consensus         1 ~~N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~lg~his~VkSl~md~w~~~~i~~~~~~GN~~~n~~~e~~~~~~~~   80 (112)
T smart00105        1 PGNKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISKVRSLTLDTWTEEELRLLQKGGNENANSIWESNLDDFSL   80 (112)
T ss_pred             CCCCcccCCCCCCCCcEEeccceeEhHHhHHHHHhcCCCcCeeeecccCCCCHHHHHHHHHhhhHHHHHHHHhhCCcccc
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999987654


Q ss_pred             CCC---CchHHHHHHHHHHhhcccccCCCC
Q psy5674         108 RPQ---TDSTLEAFIRAKYEQKKYIASEWV  134 (145)
Q Consensus       108 ~p~---~~~~~~~fI~~KY~~k~f~~~~~~  134 (145)
                      +|.   ....+++||+.||++++|+.....
T Consensus        81 ~~~~~~~~~~~~~fI~~KY~~k~f~~~~~~  110 (112)
T smart00105       81 KPPDSDDQQKYESFIAAKYEEKLFVPPESA  110 (112)
T ss_pred             CCCCCchHHHHHHHHHHHHHhhhccccccC
Confidence            432   235579999999999999987653


No 4  
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=100.00  E-value=5.9e-38  Score=272.42  Aligned_cols=129  Identities=34%  Similarity=0.627  Sum_probs=112.7

Q ss_pred             CCchHHHHHHHHHHHHHHHHHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCH
Q psy5674           1 MSSKAEKERQKQIQDKCQNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTP   80 (145)
Q Consensus         1 ~~~~~~~~~~k~~~e~~~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~   80 (145)
                      |.|+.++||       ++++|++|++.|+|+.|+|||+.+|+|||++||||||+.|+||||.||   +|||||+||+|++
T Consensus         1 M~SKR~qER-------nekILreLlklPgNk~CADCgs~~P~WASiNlGIFICi~CSGIHRsLG---hRVKSLSLDkWT~   70 (648)
T PLN03119          1 MGSKREEER-------NEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSGIHREFT---HRVKSVSMSKFTS   70 (648)
T ss_pred             CcchHHHHH-------HHHHHHHHhhCcCCCccccCCCCCCCceeeccceEEeccchhhhccCC---ceeeccccCCCCH
Confidence            666665554       557899999999999999999999999999999999999999999998   5999999999999


Q ss_pred             HHHHHHHhhccHHHHHHHHhhCCCCCCC-CC--CchHHHHHHHHHHhhcccccCCCCCCCCC
Q psy5674          81 EQVVSLQQMGNSRARAVYEANIPDNFRR-PQ--TDSTLEAFIRAKYEQKKYIASEWVPPVLP  139 (145)
Q Consensus        81 ~~i~~l~~~GN~~~n~~~e~~~p~~~~~-p~--~~~~~~~fI~~KY~~k~f~~~~~~~~~~~  139 (145)
                      ++|++|+.+||.++|+|||++|+....+ |.  +...+++||+.||++|+|+.....+.+++
T Consensus        71 EEVe~Mk~gGN~~AN~iyeanw~~~~~~~P~~sD~e~lr~FIR~KYVeKRF~~~~~~d~p~~  132 (648)
T PLN03119         71 KEVEVLQNGGNQRAREIYLKNWDHQRQRLPENSNAERVREFIKNVYVQKKYAGANDADKPSK  132 (648)
T ss_pred             HHHHHHHHhchHHHHHHHHhhcccccCCCCCCccHHHHHHHHHHHHhhhhccCcCCCCCCcc
Confidence            9999999999999999999999875433 33  23457899999999999999887765554


No 5  
>PLN03131 hypothetical protein; Provisional
Probab=100.00  E-value=1.5e-37  Score=271.64  Aligned_cols=129  Identities=33%  Similarity=0.622  Sum_probs=112.0

Q ss_pred             CCchHHHHHHHHHHHHHHHHHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCH
Q psy5674           1 MSSKAEKERQKQIQDKCQNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTP   80 (145)
Q Consensus         1 ~~~~~~~~~~k~~~e~~~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~   80 (145)
                      |.||.++|+.       +++|++|++.|+|+.|+|||+++|+|||++||||||+.|+||||.||   ++||||+||+|++
T Consensus         1 m~SkkqqErn-------ekiLreLlk~PgNk~CADCga~~P~WASiNlGIFICi~CSGIHRsLg---hRVKSVTLD~Wtd   70 (705)
T PLN03131          1 MGSRKEEERN-------EKIIRGLMKLPPNRRCINCNSLGPQFVCTNFWTFICMTCSGIHREFT---HRVKSVSMSKFTS   70 (705)
T ss_pred             CcchHHHHHH-------HHHHHHHhhCcCCCccccCCCCCCCeeEeccceEEchhchhhhcccC---cccccccCCCCCH
Confidence            6666655554       46899999999999999999999999999999999999999999997   5999999999999


Q ss_pred             HHHHHHHhhccHHHHHHHHhhCCCCC-CCCCC--chHHHHHHHHHHhhcccccCCCCCCCCC
Q psy5674          81 EQVVSLQQMGNSRARAVYEANIPDNF-RRPQT--DSTLEAFIRAKYEQKKYIASEWVPPVLP  139 (145)
Q Consensus        81 ~~i~~l~~~GN~~~n~~~e~~~p~~~-~~p~~--~~~~~~fI~~KY~~k~f~~~~~~~~~~~  139 (145)
                      ++|+.|+.+||.++|+|||++|+... ..|..  ...+++||+.||++|+|+.....+.++.
T Consensus        71 eEV~~Mk~gGN~~AN~iyeanwd~~r~~lP~~sd~ekrr~FIR~KYVeKRFa~~~s~d~ppr  132 (705)
T PLN03131         71 QDVEALQNGGNQRAREIYLKDWDQQRQRLPDNSKVDKIREFIKDIYVDKKYAGGKTHDKPPR  132 (705)
T ss_pred             HHHHHHHHhccHHHHHHHHhhcccccCCCCCCccHHHHHHHHHHHHhhhhhhcCCCCCCCch
Confidence            99999999999999999999997653 23332  2447899999999999999886665543


No 6  
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=100.00  E-value=2.4e-37  Score=256.51  Aligned_cols=118  Identities=48%  Similarity=0.876  Sum_probs=103.8

Q ss_pred             HHHHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHHH
Q psy5674          18 QNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAV   97 (145)
Q Consensus        18 ~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~~   97 (145)
                      +.++..|...++|+.|||||+++|+|+|++||||||++||||||+||+||++||||+||+|++++|++|..+||.+||.|
T Consensus         8 ~~~l~~l~~~~~Nk~CaDCga~~P~W~S~nlGvfiCi~CagvHRsLGvhiS~VKSitLD~wt~~~l~~m~~gGN~~a~~~   87 (319)
T COG5347           8 RKLLKLLKSDSSNKKCADCGAPNPTWASVNLGVFLCIDCAGVHRSLGVHISKVKSLTLDNWTEEELRRMEVGGNSNANRF   87 (319)
T ss_pred             HHHHHHHhhccccCccccCCCCCCceEecccCeEEEeecchhhhccccceeeeeeeecccCCHHHHHHHHHhcchhhhhH
Confidence            34666777889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhCCCCCCCC---C-CchHHHHHHHHHHhhcccccCCCCC
Q psy5674          98 YEANIPDNFRRP---Q-TDSTLEAFIRAKYEQKKYIASEWVP  135 (145)
Q Consensus        98 ~e~~~p~~~~~p---~-~~~~~~~fI~~KY~~k~f~~~~~~~  135 (145)
                      |+.++-.....|   . ++..+++||++||+.++|+.....+
T Consensus        88 ~e~~~~~~~~~~~k~~yd~~v~~~y~~~ky~~~~~~~~~~~~  129 (319)
T COG5347          88 YEKNLLDQLLLPIKAKYDSSVAKKYIRKKYELKKFIDDSSSP  129 (319)
T ss_pred             hccCCCcccccccccccCHHHHHHHHHHHHHhhhccccccCc
Confidence            998875532122   2 3455799999999999999865444


No 7  
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=99.97  E-value=2.1e-31  Score=221.83  Aligned_cols=123  Identities=39%  Similarity=0.670  Sum_probs=100.4

Q ss_pred             HHHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHHHH
Q psy5674          19 NLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVY   98 (145)
Q Consensus        19 ~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~~~   98 (145)
                      .+|++|+..|+|+.|+|||+++|+|+|++||||||+.|+|+||.||+||++|||++||+|++++|++|+.+||.++|.||
T Consensus        11 ~vfrkL~~kPgNk~CaDCga~nPtWASvn~GIFLCl~CSGVHRsLGvHISfVRSltLD~Ws~eqL~~Mk~GGN~rA~~fF   90 (395)
T PLN03114         11 SVFKKLKAKSDNKICFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSSEQLKMMIYGGNNRAQVFF   90 (395)
T ss_pred             HHHHHHHhCcCCCcCccCCCCCCCceeeccceeehhhhhHhhccCCCCCceeecccCCCCCHHHHHHHHHhcCHHHHHHH
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhCCCCCCCCC-----CchHHHHHHHHHHhhcccccCCC-CCCCCCCC
Q psy5674          99 EANIPDNFRRPQ-----TDSTLEAFIRAKYEQKKYIASEW-VPPVLPKN  141 (145)
Q Consensus        99 e~~~p~~~~~p~-----~~~~~~~fI~~KY~~k~f~~~~~-~~~~~~~~  141 (145)
                      +...-.....+.     .....-.-+.++++.+.+..... .|+.+|+.
T Consensus        91 ~qhG~~~~~~~~~KY~S~aA~~Yre~L~keVa~~~a~~~~~~p~~~~~~  139 (395)
T PLN03114         91 KQYGWSDGGKTEAKYTSRAADLYKQILAKEVAKSKAEEELDLPPSPPDS  139 (395)
T ss_pred             HHcCCCCCCCcccccCCHHHHHHHHHHHHHHHHhhhccccCCCCCCCCc
Confidence            865322111111     11222344888999998886654 44444443


No 8  
>KOG0705|consensus
Probab=99.97  E-value=7.8e-31  Score=228.33  Aligned_cols=115  Identities=43%  Similarity=0.807  Sum_probs=103.8

Q ss_pred             HHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHHHHH
Q psy5674          20 LLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVYE   99 (145)
Q Consensus        20 ~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~~~e   99 (145)
                      .|..+..-+||..|+||++++|.|||+|+|+++|++|+||||.||+|+|+|+||.||.|..|.+..|..+||+.||.+||
T Consensus       503 a~qairn~rgn~~c~dc~~~n~~wAslnlg~l~cieCsgihr~lgt~lSrvr~LeLDdWPvEl~~Vm~aiGN~~AN~vWE  582 (749)
T KOG0705|consen  503 ALQAIRNMRGNSHCVDCGTPNPKWASLNLGVLMCIECSGIHRNLGTHLSRVRSLELDDWPVELLKVMSAIGNDLANSVWE  582 (749)
T ss_pred             HHHHHhcCcCCceeeecCCCCcccccccCCeEEEEEchhhhhhhhhhhhhhhccccccCcHHHHHHHHHhhhhHHHHHhh
Confidence            34455567999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhCCCCCCCCCCchH---HHHHHHHHHhhcccccCCCCC
Q psy5674         100 ANIPDNFRRPQTDST---LEAFIRAKYEQKKYIASEWVP  135 (145)
Q Consensus       100 ~~~p~~~~~p~~~~~---~~~fI~~KY~~k~f~~~~~~~  135 (145)
                      ..+ .+..+|++++.   +|.||++||++|.|.......
T Consensus       583 ~~~-~G~~KPs~~s~REEkErwIr~KYeqklFLaPl~~t  620 (749)
T KOG0705|consen  583 GSS-QGQTKPSPDSSREEKERWIRAKYEQKLFLAPLPCT  620 (749)
T ss_pred             hhc-cCCcCCCccccHHHHHHHHHHHHHHHhhcCCCCCC
Confidence            844 56678888765   478999999999999876554


No 9  
>KOG0704|consensus
Probab=99.96  E-value=2.9e-30  Score=213.91  Aligned_cols=124  Identities=31%  Similarity=0.610  Sum_probs=92.7

Q ss_pred             HHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHHHHH
Q psy5674          20 LLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVYE   99 (145)
Q Consensus        20 ~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~~~e   99 (145)
                      .|.+|....+|+.|+||++++|+|||++||||||++|+|+||.||+|||+|||||||+|.+.||+.|+++||.++++|++
T Consensus         9 ~L~~lkp~deNk~CfeC~a~NPQWvSvsyGIfICLECSG~HRgLGVhiSFVRSVTMD~wkeiel~kMeaGGN~~~~eFL~   88 (386)
T KOG0704|consen    9 VLLELKPQDENKKCFECGAPNPQWVSVSYGIFICLECSGKHRGLGVHISFVRSVTMDKWKEIELKKMEAGGNERFREFLS   88 (386)
T ss_pred             HHHhcCccccCCceeecCCCCCCeEeecccEEEEEecCCcccccceeeEEEEeeecccccHHHHHHHHhccchhHHHHHh
Confidence            44445555699999999999999999999999999999999999999999999999999999999999999999999997


Q ss_pred             hhCCCCCCCC------CC-chHHHHHHHHHHhhcccccCCCCCCCCCCCCC
Q psy5674         100 ANIPDNFRRP------QT-DSTLEAFIRAKYEQKKYIASEWVPPVLPKNSF  143 (145)
Q Consensus       100 ~~~p~~~~~p------~~-~~~~~~fI~~KY~~k~f~~~~~~~~~~~~~~~  143 (145)
                      ..-.-...-|      +. .+..++=|.+-=+-+.|-....+..+.|+-+|
T Consensus        89 s~~~~~e~~~i~eKYns~aAa~yRdki~~laegr~w~d~~~~k~~~p~~sy  139 (386)
T KOG0704|consen   89 SQGIYKETWPIREKYNSRAAALYRDKIAALAEGREWNDPPYLKEDNPAQSY  139 (386)
T ss_pred             hCccccccccHHHhhccHHHHHHHHHHHHHhcCCcccccccccccCccccc
Confidence            5432111111      11 12234555555555555444445555554443


No 10 
>KOG0706|consensus
Probab=99.96  E-value=2.7e-30  Score=219.37  Aligned_cols=85  Identities=48%  Similarity=0.903  Sum_probs=81.9

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHH
Q psy5674          17 CQNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARA   96 (145)
Q Consensus        17 ~~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~   96 (145)
                      .+..++.|...+.|++|+|||+++|+|+|++||||||++|+++||.||+||++|||..||+|+..+|+.|+.+||.+|+.
T Consensus        10 ~~~vfkkLRs~~~NKvCFDCgAknPtWaSVTYGIFLCiDCSAvHRnLGVHiSFVRSTnLDsWs~~qLR~M~~GGN~nA~~   89 (454)
T KOG0706|consen   10 IQTVFKKLRSQSENKVCFDCGAKNPTWASVTYGIFLCIDCSAVHRNLGVHISFVRSTNLDSWSWEQLRRMQVGGNANARV   89 (454)
T ss_pred             HHHHHHHHhcCCCCceecccCCCCCCceeecceEEEEEecchhhhccccceEEEeecccccCCHHHHhHhhhcCchhHHH
Confidence            45689999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhh
Q psy5674          97 VYEAN  101 (145)
Q Consensus        97 ~~e~~  101 (145)
                      |+...
T Consensus        90 FFkqh   94 (454)
T KOG0706|consen   90 FFKQH   94 (454)
T ss_pred             HHHHc
Confidence            99865


No 11 
>KOG0521|consensus
Probab=99.93  E-value=1e-26  Score=211.41  Aligned_cols=116  Identities=39%  Similarity=0.804  Sum_probs=104.8

Q ss_pred             HHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHHHHH
Q psy5674          20 LLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVYE   99 (145)
Q Consensus        20 ~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~~~e   99 (145)
                      .+..+...|||..|+|||++.|+|+|+|+||.+|++|+|+||.||+|+|+|+||+||.|.++.+.+++.+||..+|.+||
T Consensus       416 ~~~~vq~~pgN~~c~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD~~~~~l~~l~~~lgn~~~N~i~e  495 (785)
T KOG0521|consen  416 VIEEVQSVPGNAQCCDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLDVWEPELLLLFKNLGNKYVNEIYE  495 (785)
T ss_pred             hhhhhhcCCchhhhhhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhhccCcHHHHHHHHhCcchhhhhhh
Confidence            36677788999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhCCCC-CCCCCC---chHHHHHHHHHHhhcccccCCCCC
Q psy5674         100 ANIPDN-FRRPQT---DSTLEAFIRAKYEQKKYIASEWVP  135 (145)
Q Consensus       100 ~~~p~~-~~~p~~---~~~~~~fI~~KY~~k~f~~~~~~~  135 (145)
                      +.+++. ..+|++   ...++.||++||++++|.-+....
T Consensus       496 ~~l~~~~~~~~~~~~~~~~r~~~i~~kyve~~F~~k~~~~  535 (785)
T KOG0521|consen  496 ALLPSYDSSKPTASSSRQAREAWIKAKYVERRFSVKEPQI  535 (785)
T ss_pred             cccccccccCCCCccchhhhhHhhhcccceeeEeecccch
Confidence            999864 455543   345789999999999998876655


No 12 
>KOG0818|consensus
Probab=99.89  E-value=3.7e-24  Score=184.43  Aligned_cols=108  Identities=31%  Similarity=0.649  Sum_probs=96.8

Q ss_pred             cCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHHHHHhhCCCC
Q psy5674          26 KDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVYEANIPDN  105 (145)
Q Consensus        26 ~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~~~e~~~p~~  105 (145)
                      .....++|+|||+++|.|+|++-|+|+|.+|..+||.||.|||.||+|....|.+..|++...+.|..+|.|||..|-++
T Consensus         4 ~~l~~evC~DC~~~dp~WASvnrGt~lC~eCcsvHrsLGrhIS~vrhLR~s~W~pt~l~~V~tLn~~gaNsIWEh~Lld~   83 (669)
T KOG0818|consen    4 RLLSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLRHTPWPPTLLQMVETLNNNGANSIWEHSLLDP   83 (669)
T ss_pred             cchhhhhhcccCCCCCcceeecCceEehHhhhHHHhhhcchHHHHHHhccCCCCHHHHHHHHHHHhcCcchhhhhhccCc
Confidence            34567899999999999999999999999999999999999999999999999999999999999999999999998663


Q ss_pred             ------CCCCCCchH----HHHHHHHHHhhcccccCCC
Q psy5674         106 ------FRRPQTDST----LEAFIRAKYEQKKYIASEW  133 (145)
Q Consensus       106 ------~~~p~~~~~----~~~fI~~KY~~k~f~~~~~  133 (145)
                            .++|++.+.    .++||++||+...|+.+..
T Consensus        84 st~~sg~rk~~pqD~~Hp~K~eFIkaKy~~LtFv~~~~  121 (669)
T KOG0818|consen   84 ATIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLP  121 (669)
T ss_pred             hhhhcccCCCCCcCCCCccHHHHHHHHHHheeeeccCC
Confidence                  345666543    5899999999999998543


No 13 
>KOG1117|consensus
Probab=99.84  E-value=1.9e-21  Score=175.40  Aligned_cols=110  Identities=35%  Similarity=0.712  Sum_probs=98.4

Q ss_pred             HHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccCCCccceeeecccCC--CCHHHHHHHHhhccHHHHHHHH
Q psy5674          22 MQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDT--WTPEQVVSLQQMGNSRARAVYE   99 (145)
Q Consensus        22 ~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~--w~~~~i~~l~~~GN~~~n~~~e   99 (145)
                      .++.....|+.|+|||++.|.|||+|++|.+|-.|+|-||++|..+|+|+|++||.  |+.+-|+++..+||.++|+||.
T Consensus       290 eriW~ne~nr~cadC~ssrPdwasiNL~vvIck~caGqhrslgs~dSkvrslkmd~svwsneliElfivlgn~~an~Fwa  369 (1186)
T KOG1117|consen  290 ERIWLNEENRECADCGSSRPDWASINLCVVICKPCAGQHRSLGSGDSKVRSLKMDPSVWSNELIELFIVLGNPRANRFWA  369 (1186)
T ss_pred             HHHHhccccccccccCCCCCcccccccceEEcccCCCccccCCCccccccccccCcccccchhhhhheeecCcccccccc
Confidence            35666789999999999999999999999999999999999999999999999995  9999999999999999999999


Q ss_pred             hhCCCCCCC-C-CCchHHHHHHHHHHhhcccccC
Q psy5674         100 ANIPDNFRR-P-QTDSTLEAFIRAKYEQKKYIAS  131 (145)
Q Consensus       100 ~~~p~~~~~-p-~~~~~~~~fI~~KY~~k~f~~~  131 (145)
                      +++|.+.-. | .+-+.+++||..||.+.+|...
T Consensus       370 ~nl~~~e~lh~dssp~~r~~fi~~Kykeg~fRk~  403 (1186)
T KOG1117|consen  370 GNLPPNEHLHPDSSPSTRRQFIKEKYKEGKFRKE  403 (1186)
T ss_pred             cCCCCccccCCCCCcchhhhHHHHHhhccccccc
Confidence            999876432 2 2335689999999999998654


No 14 
>KOG0702|consensus
Probab=99.70  E-value=1.6e-17  Score=143.08  Aligned_cols=119  Identities=24%  Similarity=0.504  Sum_probs=102.4

Q ss_pred             HHHHHHHHHHHHHHhcCCCCCCccCCCCCCC-CeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhh
Q psy5674          11 KQIQDKCQNLLMQMLKDDDNKYCVDCDAKGP-RWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQM   89 (145)
Q Consensus        11 k~~~e~~~~~l~~l~~~p~N~~CaDCg~~~p-~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~   89 (145)
                      |+.++.++.+||+|++.|+|++|++|....+ +|+...-|-|+|..|+|+-|.|. .-+|||++.|.+++..|+..|+.+
T Consensus         6 ke~E~~~ek~iR~l~kLP~NrrC~nCnsl~~~t~~~~~~g~fv~~~~sg~ls~l~-~ahRvksiSmttft~qevs~lQsh   84 (524)
T KOG0702|consen    6 KEDEYDYEKEIRRLLKLPENRRCINCNSLVAATYVVYTVGSFVCTMCSGLLSGLN-PAHRVKSISMTTFTDQEVSFLQSH   84 (524)
T ss_pred             ccchhHHHHHHHHHhcCCCCCceeeccccccceEEEeeccceeeeccchhhccCC-CccccceeeeeeccccchHHHhhc
Confidence            4456677999999999999999999999877 99999999999999999999985 468999999999999999999999


Q ss_pred             ccHHHHHHHHhhCCCCC-CCCC--CchHHHHHHHHHHhhccccc
Q psy5674          90 GNSRARAVYEANIPDNF-RRPQ--TDSTLEAFIRAKYEQKKYIA  130 (145)
Q Consensus        90 GN~~~n~~~e~~~p~~~-~~p~--~~~~~~~fI~~KY~~k~f~~  130 (145)
                      ||....+||.+...... .-|.  +-...++||+.||+.++|+-
T Consensus        85 gNq~~k~i~fkl~D~q~S~vPD~rn~~~~kef~q~~y~~kr~~v  128 (524)
T KOG0702|consen   85 GNQVCKEIWFKLFDFQRSNVPDSRNPQKVKEFQQEKYVKKRYYV  128 (524)
T ss_pred             chhhhhhhhhcchhhhhccCCCcccchhhHHHHhhhhccceeec
Confidence            99999999986654321 1232  23457999999999999965


No 15 
>KOG0521|consensus
Probab=95.36  E-value=0.0032  Score=58.56  Aligned_cols=73  Identities=19%  Similarity=0.224  Sum_probs=62.6

Q ss_pred             CCCCCCccCCCCC-CCCeeecccceeeecccccccccCCCccceeeecccCCCCHHHHHHHHhhccHHHHHHHHhh
Q psy5674          27 DDDNKYCVDCDAK-GPRWASWNIGIFLCIRCAGIHRNLGVHISRVKSVNLDTWTPEQVVSLQQMGNSRARAVYEAN  101 (145)
Q Consensus        27 ~p~N~~CaDCg~~-~p~w~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~GN~~~n~~~e~~  101 (145)
                      ...+..|++|++. ...|+++++.+-+|..|+++|+..+.+++...++.|++..+  |......|+..++..+...
T Consensus       627 ~~~~~~~~~~~~~~~~~~~~~n~~~~~~~~~s~lh~a~~~~~~~~~e~ll~~ga~--vn~~d~~g~~plh~~~~~g  700 (785)
T KOG0521|consen  627 ASSDGECLPRIATALAHGCCENWPVVLCIGCSLLHVAVGTGDSGAVELLLQNGAD--VNALDSKGRTPLHHATASG  700 (785)
T ss_pred             hccCccchhhhhhhhcchhhhccchhhhcccchhhhhhccchHHHHHHHHhcCCc--chhhhccCCCcchhhhhhc
Confidence            3457889999985 78899999999999999999999999999999999999887  7777777777777766543


No 16 
>PRK12495 hypothetical protein; Provisional
Probab=93.84  E-value=0.11  Score=41.69  Aligned_cols=37  Identities=22%  Similarity=0.323  Sum_probs=28.6

Q ss_pred             HHHHHhcC---CCCCCccCCCCCCCCeeecccceeeeccccccc
Q psy5674          20 LLMQMLKD---DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        20 ~l~~l~~~---p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      .+-.||.+   ..+..|.+||.+-|.+    -|+.+|..|..+-
T Consensus        29 ~ma~lL~~gatmsa~hC~~CG~PIpa~----pG~~~Cp~CQ~~~   68 (226)
T PRK12495         29 RMSELLLQGATMTNAHCDECGDPIFRH----DGQEFCPTCQQPV   68 (226)
T ss_pred             HHHHHHHhhcccchhhcccccCcccCC----CCeeECCCCCCcc
Confidence            44445543   7899999999998832    7999999998764


No 17 
>TIGR02419 C4_traR_proteo phage/conjugal plasmid C-4 type zinc finger protein, TraR family. Members of this family are putative C4-type zinc finger proteins found almost exclusively in prophage regions, actual phage, or conjugal transfer regions of the Proteobactia. This small protein (about 70 amino acids) appears homologous to but is smaller than DksA (DnaK suppressor protein), found to be critical for regulating transcription of ribosomal RNA.
Probab=91.32  E-value=0.17  Score=32.77  Aligned_cols=35  Identities=23%  Similarity=0.408  Sum_probs=24.2

Q ss_pred             cCCCCCCccCCCCCCCCe-eecccceeeeccccccc
Q psy5674          26 KDDDNKYCVDCDAKGPRW-ASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        26 ~~p~N~~CaDCg~~~p~w-~s~~~GvflC~~Cs~iH   60 (145)
                      ..++...|.|||.+=|.= .-..-|+..|+.|...+
T Consensus        27 ~~~s~g~C~~Cg~~Ip~~Rl~a~p~~~~Cv~Cq~~~   62 (63)
T TIGR02419        27 IGPSLRECEDCGEPIPEARREALPGVTRCVSCQEIL   62 (63)
T ss_pred             cCCCCCeeccCCCcChHHHHhhcCCcCCcHHHHhhc
Confidence            457788999999984421 12335788999997654


No 18 
>PRK11019 hypothetical protein; Provisional
Probab=89.79  E-value=0.18  Score=34.91  Aligned_cols=50  Identities=16%  Similarity=0.292  Sum_probs=30.6

Q ss_pred             HHHHHHHHHHhcCCCCCCccCCCCCCCC-eeecccceeeecccccccccCC
Q psy5674          15 DKCQNLLMQMLKDDDNKYCVDCDAKGPR-WASWNIGIFLCIRCAGIHRNLG   64 (145)
Q Consensus        15 e~~~~~l~~l~~~p~N~~CaDCg~~~p~-w~s~~~GvflC~~Cs~iHR~lg   64 (145)
                      ...+.++.++...+.-..|.|||.+=|. =.-.-.++..|+.|...+...+
T Consensus        21 ~aI~~a~~r~~~g~syg~C~~CG~~Ip~~Rl~A~P~a~~Cv~Cq~~~E~~~   71 (88)
T PRK11019         21 DAIARARSELPRGESLTECEECGEPIPEARRKAIPGVRLCVACQQEKDLQQ   71 (88)
T ss_pred             HHHHHHHhhcccCCcCCeeCcCCCcCcHHHHhhcCCccccHHHHHHHHHHH
Confidence            3334444444343456799999998442 1122347889999999875443


No 19 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=88.39  E-value=0.36  Score=28.56  Aligned_cols=28  Identities=21%  Similarity=0.445  Sum_probs=21.8

Q ss_pred             CccCCCCCCCCeeecccceeeeccccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      +|..||+.. .-.....|-++|..|..+-
T Consensus         2 ~Cp~Cg~~~-~~~D~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen    2 KCPNCGSKE-IVFDPERGELVCPNCGLVL   29 (43)
T ss_dssp             SBTTTSSSE-EEEETTTTEEEETTT-BBE
T ss_pred             CCcCCcCCc-eEEcCCCCeEECCCCCCEe
Confidence            699999977 4556779999999996553


No 20 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=88.35  E-value=0.17  Score=29.10  Aligned_cols=27  Identities=19%  Similarity=0.482  Sum_probs=16.9

Q ss_pred             CCccCCCCC-CCCeeecccceeeecccc
Q psy5674          31 KYCVDCDAK-GPRWASWNIGIFLCIRCA   57 (145)
Q Consensus        31 ~~CaDCg~~-~p~w~s~~~GvflC~~Cs   57 (145)
                      ..|.+||.+ .-+|..-+|+.-||..|.
T Consensus         4 ~~C~eC~~~f~dSyL~~~F~~~VCD~CR   31 (34)
T PF01286_consen    4 PKCDECGKPFMDSYLLNNFDLPVCDKCR   31 (34)
T ss_dssp             EE-TTT--EES-SSCCCCTS-S--TTT-
T ss_pred             chHhHhCCHHHHHHHHHhCCcccccccc
Confidence            469999997 677999999999999994


No 21 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=87.95  E-value=0.42  Score=27.65  Aligned_cols=34  Identities=15%  Similarity=0.243  Sum_probs=29.1

Q ss_pred             CCCCccCCCCCCCCeeecccceeeecccccc-ccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCAGI-HRN   62 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~i-HR~   62 (145)
                      .+..|..|+.....+...+=++++|..|... |+.
T Consensus         2 ~~~~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~   36 (42)
T PF00643_consen    2 QEPKCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG   36 (42)
T ss_dssp             SSSB-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT
T ss_pred             cCccCccCCccceEEEecCCCCccCccCCCCCCCC
Confidence            3678999998888899999999999999988 876


No 22 
>PRK13715 conjugal transfer protein TraR; Provisional
Probab=87.53  E-value=0.39  Score=32.01  Aligned_cols=34  Identities=21%  Similarity=0.475  Sum_probs=22.9

Q ss_pred             CCCCccCCCCCCCC-eeecccceeeeccccccccc
Q psy5674          29 DNKYCVDCDAKGPR-WASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        29 ~N~~CaDCg~~~p~-w~s~~~GvflC~~Cs~iHR~   62 (145)
                      +...|.|||.+=|. =.-.--|+..|+.|...+-.
T Consensus        33 ~~~~C~~Cg~~Ip~~Rl~a~p~~~~Cv~Cq~~~E~   67 (73)
T PRK13715         33 PVYLCEACGNPIPEARRKIFPGVTLCVECQAYQER   67 (73)
T ss_pred             CcccHhhcCCcCCHHHHhcCCCcCCCHHHHHHHHH
Confidence            34689999998442 11223588999999876543


No 23 
>PHA00080 DksA-like zinc finger domain containing protein
Probab=85.38  E-value=0.69  Score=30.72  Aligned_cols=35  Identities=20%  Similarity=0.397  Sum_probs=23.7

Q ss_pred             CCCCCCccCCCCCCCC-eeecccceeeecccccccc
Q psy5674          27 DDDNKYCVDCDAKGPR-WASWNIGIFLCIRCAGIHR   61 (145)
Q Consensus        27 ~p~N~~CaDCg~~~p~-w~s~~~GvflC~~Cs~iHR   61 (145)
                      .++...|.|||.+=|. =.-..-++..|+.|...+-
T Consensus        28 ~~~~~~C~~Cg~~Ip~~Rl~a~P~~~~Cv~Cq~~~E   63 (72)
T PHA00080         28 APSATHCEECGDPIPEARREAVPGCRTCVSCQEILE   63 (72)
T ss_pred             CCCCCEecCCCCcCcHHHHHhCCCccCcHHHHHHHH
Confidence            4667799999997331 1112347788999988653


No 24 
>COG1734 DksA DnaK suppressor protein [Signal transduction mechanisms]
Probab=84.67  E-value=0.3  Score=35.65  Aligned_cols=32  Identities=22%  Similarity=0.382  Sum_probs=21.4

Q ss_pred             CCCccCCCCCCC-Ceeecccceeeecccccccc
Q psy5674          30 NKYCVDCDAKGP-RWASWNIGIFLCIRCAGIHR   61 (145)
Q Consensus        30 N~~CaDCg~~~p-~w~s~~~GvflC~~Cs~iHR   61 (145)
                      =.+|.+||.+=| .=.-.--+..+|+.|...|-
T Consensus        80 YG~Ce~cG~~Ip~~RL~A~P~A~~Ci~cQ~~~E  112 (120)
T COG1734          80 YGICEECGEPIPEARLEARPTARLCIECQERAE  112 (120)
T ss_pred             ccchhccCCcCCHHHHhhCcchHHHHHHHHHHH
Confidence            348999999832 11222346789999988764


No 25 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=84.31  E-value=5.7  Score=28.37  Aligned_cols=56  Identities=13%  Similarity=0.323  Sum_probs=32.8

Q ss_pred             HHHHHHHHHHHHH-HHHHHHHhcCC----CCCCccCCCCC-----CCCeeecccceeeeccccccc
Q psy5674           5 AEKERQKQIQDKC-QNLLMQMLKDD----DNKYCVDCDAK-----GPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus         5 ~~~~~~k~~~e~~-~~~l~~l~~~p----~N~~CaDCg~~-----~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      .|++|-++|.+.. +...+.-....    +...|+-|+.+     ++.-.+.+-.--||..|...+
T Consensus        24 ~E~~Ri~kLk~~L~~e~~r~~~~~~~~~~~~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~~   89 (118)
T PF02318_consen   24 KEEERIRKLKQELQKEKMRREALGNSQKYGERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVYS   89 (118)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHCSCSTTHCCSB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEET
T ss_pred             HHHHHHHHHHHHHHHHHHHhhccccccccCCcchhhhCCcccccCCCCCcCCcCCccccCccCCcC
Confidence            3455555555555 22334333334    78899999986     344456666777888887764


No 26 
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=83.32  E-value=0.67  Score=36.65  Aligned_cols=32  Identities=31%  Similarity=0.490  Sum_probs=27.3

Q ss_pred             CCCCCccCCCCCCC-Ceeecccceeeecccccc
Q psy5674          28 DDNKYCVDCDAKGP-RWASWNIGIFLCIRCAGI   59 (145)
Q Consensus        28 p~N~~CaDCg~~~p-~w~s~~~GvflC~~Cs~i   59 (145)
                      |.-..|+-||.+.. .|.+...|.++|..|...
T Consensus       147 p~l~~C~~Cg~~~~~~~f~~~~gg~~c~~c~~~  179 (247)
T PRK00085        147 LDLDHCAVCGAPGDHRYFSPKEGGAVCSECGDP  179 (247)
T ss_pred             cchhhHhcCCCCCCceEEecccCCcccccccCc
Confidence            77789999998844 788999999999999733


No 27 
>TIGR00613 reco DNA repair protein RecO. All proteins in this family for which functions are known are DNA binding proteins that are involved in the initiation of recombination or recombinational repair.
Probab=80.90  E-value=1.6  Score=34.32  Aligned_cols=33  Identities=27%  Similarity=0.433  Sum_probs=27.5

Q ss_pred             CCCCCCccCCCCCCC-Ceeecccceeeecccccc
Q psy5674          27 DDDNKYCVDCDAKGP-RWASWNIGIFLCIRCAGI   59 (145)
Q Consensus        27 ~p~N~~CaDCg~~~p-~w~s~~~GvflC~~Cs~i   59 (145)
                      .|.-..|+.||..++ .+.+...|.++|..|...
T Consensus       144 ~p~l~~C~~cg~~~~~~~fs~~~gg~~C~~c~~~  177 (241)
T TIGR00613       144 ALDLDKCAVCGSKEDLIYFSMTYGGALCRQCGEK  177 (241)
T ss_pred             CcccCccCCCCCcCCCceEchhcCeEEChhhCcc
Confidence            377789999998544 688999999999999764


No 28 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=77.54  E-value=2  Score=26.53  Aligned_cols=37  Identities=24%  Similarity=0.550  Sum_probs=29.6

Q ss_pred             CCCCccCCCCC-CCCeeecccce-eeecccccccccCCC
Q psy5674          29 DNKYCVDCDAK-GPRWASWNIGI-FLCIRCAGIHRNLGV   65 (145)
Q Consensus        29 ~N~~CaDCg~~-~p~w~s~~~Gv-flC~~Cs~iHR~lg~   65 (145)
                      ....|..|+.. .|.|=.-..|- +||-.|.--.+..+.
T Consensus         2 ~~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~   40 (52)
T smart00401        2 SGRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGG   40 (52)
T ss_pred             CCCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCC
Confidence            46789999986 67788878886 999999887776553


No 29 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=77.49  E-value=1.8  Score=24.92  Aligned_cols=28  Identities=29%  Similarity=0.765  Sum_probs=23.3

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeeccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAG   58 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~   58 (145)
                      ..|..|..|++.   |...+-|-+.|..|..
T Consensus         6 ~~~~~C~~C~~~---~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    6 GPNEPCPVCGSR---WFYSDDGFYYCDRCGH   33 (36)
T ss_pred             cCCCcCCCCCCe---EeEccCCEEEhhhCce
Confidence            346679999998   8889999999999853


No 30 
>PRK10778 dksA RNA polymerase-binding transcription factor; Provisional
Probab=77.14  E-value=1.7  Score=32.85  Aligned_cols=45  Identities=24%  Similarity=0.434  Sum_probs=28.0

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCCCC-Ceeecccceeeeccccccccc
Q psy5674          17 CQNLLMQMLKDDDNKYCVDCDAKGP-RWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        17 ~~~~l~~l~~~p~N~~CaDCg~~~p-~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .+..|.+ +..+.-.+|-+||.+=| .=.-.--++..|+.|...+-.
T Consensus        99 I~~AL~R-i~~gtYG~Ce~CGe~I~~~RL~A~P~A~~CI~CQe~~E~  144 (151)
T PRK10778         99 IEKTLKK-VEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEI  144 (151)
T ss_pred             HHHHHHH-HhCCCCceeccCCCcccHHHHhcCCCccccHHHHHHHHH
Confidence            3334444 34578899999999721 111222356789999887654


No 31 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=75.66  E-value=5.7  Score=23.65  Aligned_cols=38  Identities=18%  Similarity=0.386  Sum_probs=25.8

Q ss_pred             HHHHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccc
Q psy5674          18 QNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCA   57 (145)
Q Consensus        18 ~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs   57 (145)
                      .+.|.+ ++.|+.-+|..||+....++ -+.+.+-|..|.
T Consensus         7 ~~~l~~-~RW~~g~~CP~Cg~~~~~~~-~~~~~~~C~~C~   44 (46)
T PF12760_consen    7 REYLEE-IRWPDGFVCPHCGSTKHYRL-KTRGRYRCKACR   44 (46)
T ss_pred             HHHHHH-hcCCCCCCCCCCCCeeeEEe-CCCCeEECCCCC
Confidence            334433 45566688999999855433 337899999885


No 32 
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=73.84  E-value=2  Score=34.69  Aligned_cols=30  Identities=33%  Similarity=0.697  Sum_probs=26.9

Q ss_pred             CCCCCccCCCCC-CCCeeecccceeeecccc
Q psy5674          28 DDNKYCVDCDAK-GPRWASWNIGIFLCIRCA   57 (145)
Q Consensus        28 p~N~~CaDCg~~-~p~w~s~~~GvflC~~Cs   57 (145)
                      |.=..|+.||++ ++...|.-.|-++|..|+
T Consensus       152 ~~l~~Ca~cg~~~~~~~~s~~~~~~~C~~~~  182 (251)
T COG1381         152 PNLTSCARCGTPVDPVYFSPKSGGFLCSKCA  182 (251)
T ss_pred             cchHHHhCcCCcCCCcceeeccCcccchhcc
Confidence            667889999998 557999999999999998


No 33 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=73.74  E-value=1.6  Score=24.97  Aligned_cols=32  Identities=28%  Similarity=0.690  Sum_probs=22.8

Q ss_pred             ccCCCCC-CCCeeeccccee-eecccccccccCC
Q psy5674          33 CVDCDAK-GPRWASWNIGIF-LCIRCAGIHRNLG   64 (145)
Q Consensus        33 CaDCg~~-~p~w~s~~~Gvf-lC~~Cs~iHR~lg   64 (145)
                      |..|++. .|.|=....|-. ||..|.-.++..+
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~   34 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYG   34 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHS
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhC
Confidence            8899986 789988888888 9999987766543


No 34 
>TIGR02890 spore_yteA sporulation protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to PFAM family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. The function of proteins in this family is unknown. YteA was detected in mature spores of Bacillus subtilis by Kuwana, et al., and appears to be expressed under control of sigma-K.
Probab=72.98  E-value=2.4  Score=32.23  Aligned_cols=45  Identities=11%  Similarity=0.172  Sum_probs=27.3

Q ss_pred             HHHHHHHHhcCCCCCCccCCCCC-CCCeeecccceeeeccccccccc
Q psy5674          17 CQNLLMQMLKDDDNKYCVDCDAK-GPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        17 ~~~~l~~l~~~p~N~~CaDCg~~-~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .+..|.+|- ...=..|.+||.+ .+.=.-+.-++..|+.|+..+-.
T Consensus        74 Ie~AL~Ri~-~G~YG~Ce~CGe~I~~~RL~a~P~a~~Ci~Cq~~~E~  119 (159)
T TIGR02890        74 IEHALQKIE-NGTYGICEVCGKPIPYERLEAIPTATTCVECQNRKEV  119 (159)
T ss_pred             HHHHHHHHh-CCCCCeecccCCcccHHHHhhCCCcchhHHHHHHhhh
Confidence            344455553 3455689999987 21111223456799999887643


No 35 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=72.92  E-value=5  Score=32.87  Aligned_cols=38  Identities=18%  Similarity=0.450  Sum_probs=29.1

Q ss_pred             HHHHHHHHhc-CCCCCCccCCCCCCCCeeecccceeeecccccccc
Q psy5674          17 CQNLLMQMLK-DDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHR   61 (145)
Q Consensus        17 ~~~~l~~l~~-~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR   61 (145)
                      .+..+++.+. .|.|. |..||.....|.      ++|..|.+.|-
T Consensus       341 ~~~~~~~~~~~~p~~~-c~~cg~~~~~~~------~~c~~c~~~~~  379 (389)
T PRK11788        341 LRDLVGEQLKRKPRYR-CRNCGFTARTLY------WHCPSCKAWET  379 (389)
T ss_pred             HHHHHHHHHhCCCCEE-CCCCCCCCccce------eECcCCCCccC
Confidence            4556665554 56655 999999999995      79999999884


No 36 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=70.06  E-value=0.44  Score=27.13  Aligned_cols=29  Identities=28%  Similarity=0.543  Sum_probs=16.9

Q ss_pred             CccCCCCCCC-Ceeecccceeeeccccccc
Q psy5674          32 YCVDCDAKGP-RWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        32 ~CaDCg~~~p-~w~s~~~GvflC~~Cs~iH   60 (145)
                      .|.+||.+=| .=.-+.-+..+|..|+..|
T Consensus         5 ~C~~CGe~I~~~Rl~~~p~~~~C~~C~~~~   34 (36)
T PF01258_consen    5 ICEDCGEPIPEERLVAVPGATLCVECQERR   34 (36)
T ss_dssp             B-TTTSSBEEHHHHHHCTTECS-HHHHHHH
T ss_pred             CccccCChHHHHHHHhCCCcEECHHHhCcc
Confidence            4999998622 1122334788999997654


No 37 
>cd07171 NR_DBD_ER DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen receptors (ER) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ER interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Estrogen receptor is a transcription regulator that mediates the biological effects of hormone estrogen. The binding of estrogen to the receptor triggers the dimerization and the binding of the receptor dimer to estrogen response element, which is a palindromic inverted repeat: 5'GGTCAnnnTGACC-3', of target genes. Through ER, estrogen regulates development, reproduction and homeostasis. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, ER  has  a central well-conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserv
Probab=70.06  E-value=2.3  Score=28.79  Aligned_cols=31  Identities=19%  Similarity=0.748  Sum_probs=25.7

Q ss_pred             CCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .|..|.=||.+..   ...||++.|..|++..|-
T Consensus         2 ~~~~C~VCg~~~~---g~hyGv~sC~aC~~FFRR   32 (82)
T cd07171           2 DTHFCAVCSDYAS---GYHYGVWSCEGCKAFFKR   32 (82)
T ss_pred             CCCCCeecCCcCc---ceEECceeehhhHHhHHH
Confidence            4677999998655   569999999999998865


No 38 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=69.86  E-value=2.1  Score=24.41  Aligned_cols=30  Identities=23%  Similarity=0.458  Sum_probs=15.9

Q ss_pred             CCccCCCCCCCCeeec---ccceeeecccccccc
Q psy5674          31 KYCVDCDAKGPRWASW---NIGIFLCIRCAGIHR   61 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~---~~GvflC~~Cs~iHR   61 (145)
                      +.|..||.+- .+...   +.-=++|..|..||-
T Consensus         1 kfC~~CG~~l-~~~ip~gd~r~R~vC~~Cg~IhY   33 (34)
T PF14803_consen    1 KFCPQCGGPL-ERRIPEGDDRERLVCPACGFIHY   33 (34)
T ss_dssp             -B-TTT--B--EEE--TT-SS-EEEETTTTEEE-
T ss_pred             CccccccChh-hhhcCCCCCccceECCCCCCEEe
Confidence            4689999872 23222   455679999999983


No 39 
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=68.58  E-value=2.1  Score=28.94  Aligned_cols=32  Identities=19%  Similarity=0.505  Sum_probs=26.0

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |..+.|.=||.+..   ...||+..|..|.+..|.
T Consensus         1 ~~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   32 (82)
T cd07173           1 PPQKTCLICGDEAS---GCHYGALTCGSCKVFFKR   32 (82)
T ss_pred             CCCCCCeecCCcCc---ceEECcchhhhHHHHHHH
Confidence            34567999998665   568999999999998875


No 40 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=66.56  E-value=3.3  Score=28.73  Aligned_cols=29  Identities=28%  Similarity=0.635  Sum_probs=23.6

Q ss_pred             CCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      +.|.=||.+..   ...||+..|..|.+..|-
T Consensus         1 ~~C~VCg~~a~---g~hyGv~sC~aC~~FFRR   29 (94)
T cd06966           1 KICGVCGDKAL---GYNFNAITCESCKAFFRR   29 (94)
T ss_pred             CCCeeCCCcCc---ceEECcceeeeehheehh
Confidence            35888887655   458999999999998875


No 41 
>COG2158 Uncharacterized protein containing a Zn-finger-like domain [General function prediction only]
Probab=66.06  E-value=4.6  Score=28.99  Aligned_cols=23  Identities=39%  Similarity=0.804  Sum_probs=20.9

Q ss_pred             Ceeecccc--eeeecccccccccCC
Q psy5674          42 RWASWNIG--IFLCIRCAGIHRNLG   64 (145)
Q Consensus        42 ~w~s~~~G--vflC~~Cs~iHR~lg   64 (145)
                      .|++-.-|  |.-|.+|-.+||.-+
T Consensus        52 ewi~~~~G~~VwSC~dC~~iH~ke~   76 (112)
T COG2158          52 EWISDSNGRKVWSCSDCHWIHRKEG   76 (112)
T ss_pred             ceeEcCCCCEEeeccccceecccch
Confidence            89999989  999999999999754


No 42 
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=66.05  E-value=3.7  Score=28.95  Aligned_cols=31  Identities=26%  Similarity=0.713  Sum_probs=26.0

Q ss_pred             CCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .+..|.=||.+..   ...||+..|..|.+..|.
T Consensus        17 ~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   47 (101)
T cd07160          17 GNEVCSVCGDKAS---GFHYNVLSCEGCKGFFRR   47 (101)
T ss_pred             CCCCCeecCCcCc---ceEECcceehhhhhhhhh
Confidence            4678999998665   468999999999998875


No 43 
>cd07163 NR_DBD_TLX DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. DNA-binding domain of Tailless (TLX) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TLX interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  TLX is an orphan receptor that is expressed by neural stem/progenitor cells in the adult brain of the subventricular zone (SVZ) and the dentate gyrus (DG). It plays a key role in neural development by promoting cell cycle progression and preventing apoptosis in the developing brain. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, TLX has a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=65.20  E-value=4.2  Score=28.04  Aligned_cols=30  Identities=23%  Similarity=0.671  Sum_probs=25.2

Q ss_pred             CCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          30 NKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      +..|.=||.+..   ...||+..|..|++..|-
T Consensus         6 ~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   35 (92)
T cd07163           6 DIPCKVCGDRSS---GKHYGIYACDGCSGFFKR   35 (92)
T ss_pred             CCCCcccCCcCc---ccEECceeeeeeeeEEee
Confidence            667999998655   469999999999998875


No 44 
>cd06968 NR_DBD_ROR DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. DNA-binding domain of Retinoid-related orphan receptors (RORs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ROR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  RORS are key regulators of many physiological processes during embryonic development. RORs bind as monomers to specific ROR response elements (ROREs) consisting of the consensus core motif AGGTCA preceded by a 5-bp A/T-rich sequence. There are three subtypes of retinoid-related orphan receptors (RORs), alpha, beta, and gamma, which differ only in N-terminal sequence and are distributed in distinct tissues. RORalpha plays a key role in the development of the cerebellum particularly in the regulation of the maturation and survival of Purkinje cells. RORbe
Probab=63.85  E-value=3.7  Score=28.52  Aligned_cols=31  Identities=26%  Similarity=0.608  Sum_probs=25.6

Q ss_pred             CCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .+..|.=||.+..   ...||++.|..|.+..|-
T Consensus         4 ~~~~C~VCg~~~~---g~hyGv~sC~aC~~FFRR   34 (95)
T cd06968           4 EVIPCKICGDKSS---GIHYGVITCEGCKGFFRR   34 (95)
T ss_pred             cccCCcccCCcCc---ceEECceeehhhHHhhHH
Confidence            4667999998665   458999999999998874


No 45 
>KOG3507|consensus
Probab=62.73  E-value=3.8  Score=26.42  Aligned_cols=24  Identities=21%  Similarity=0.513  Sum_probs=15.9

Q ss_pred             CCccCCCCCCCCeeecccceeeecccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCA   57 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs   57 (145)
                      -+|+|||+.+.   --.--++-|-+|.
T Consensus        21 YiCgdC~~en~---lk~~D~irCReCG   44 (62)
T KOG3507|consen   21 YICGDCGQENT---LKRGDVIRCRECG   44 (62)
T ss_pred             EEecccccccc---ccCCCcEehhhcc
Confidence            36999998764   1234567788883


No 46 
>TIGR02420 dksA RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage.
Probab=62.49  E-value=6.8  Score=27.65  Aligned_cols=31  Identities=29%  Similarity=0.583  Sum_probs=18.7

Q ss_pred             CCCCCCccCCCCCCC-Ceeecccceeeecccc
Q psy5674          27 DDDNKYCVDCDAKGP-RWASWNIGIFLCIRCA   57 (145)
Q Consensus        27 ~p~N~~CaDCg~~~p-~w~s~~~GvflC~~Cs   57 (145)
                      .+.-.+|.|||.+=| .=.-.--++..|+.|.
T Consensus        77 ~g~yG~C~~Cge~I~~~RL~a~P~a~~Cv~Cq  108 (110)
T TIGR02420        77 DGEYGYCEECGEEIGLRRLEARPTATLCIDCK  108 (110)
T ss_pred             CCCCCchhccCCcccHHHHhhCCCccccHHhH
Confidence            356689999999722 1111123456788875


No 47 
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=61.83  E-value=3.9  Score=28.61  Aligned_cols=30  Identities=17%  Similarity=0.645  Sum_probs=24.6

Q ss_pred             CCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          30 NKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      +..|.=||.+..   ...||+..|..|.+..|-
T Consensus         4 ~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   33 (97)
T cd07170           4 KRLCLVCGDIAS---GYHYGVASCEACKAFFKR   33 (97)
T ss_pred             CCCCeecCCcCc---ceEECceeehhhhHHHHH
Confidence            356999998765   458999999999998874


No 48 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=61.32  E-value=4.3  Score=24.66  Aligned_cols=26  Identities=23%  Similarity=0.621  Sum_probs=19.7

Q ss_pred             CccCCCCCCCCeeecccceeeeccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAG   58 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~   58 (145)
                      .|.=|+.+.+. .-.=+|.|+|.+|-.
T Consensus         1 ~CiiC~~~~~~-GI~I~~~fIC~~CE~   26 (46)
T PF10764_consen    1 KCIICGKEKEE-GIHIYGKFICSDCEK   26 (46)
T ss_pred             CeEeCCCcCCC-CEEEECeEehHHHHH
Confidence            47788887765 445689999999954


No 49 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=60.52  E-value=6.9  Score=32.52  Aligned_cols=33  Identities=15%  Similarity=0.509  Sum_probs=24.1

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeecccccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHR   61 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR   61 (145)
                      .....|.+||.... =.+..-|-.+|.+|.-+-.
T Consensus         9 ~~~~~Cp~Cg~~~i-v~d~~~Ge~vC~~CG~Vl~   41 (310)
T PRK00423          9 EEKLVCPECGSDKL-IYDYERGEIVCADCGLVIE   41 (310)
T ss_pred             ccCCcCcCCCCCCe-eEECCCCeEeecccCCccc
Confidence            45678999997432 2245689999999988653


No 50 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=60.43  E-value=6.2  Score=25.09  Aligned_cols=28  Identities=18%  Similarity=0.528  Sum_probs=24.0

Q ss_pred             CCCCccCCCCCCCCeeecccceeeeccccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCAG   58 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~   58 (145)
                      -.+.|..||.....  ..+-.+|.|..|.-
T Consensus        27 TSq~C~~CG~~~~~--~~~~r~~~C~~Cg~   54 (69)
T PF07282_consen   27 TSQTCPRCGHRNKK--RRSGRVFTCPNCGF   54 (69)
T ss_pred             CccCccCccccccc--ccccceEEcCCCCC
Confidence            57899999998777  77888999999955


No 51 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=58.21  E-value=6.4  Score=26.77  Aligned_cols=28  Identities=18%  Similarity=0.600  Sum_probs=23.1

Q ss_pred             CccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .|.=||.+..   ...||+..|..|.+..|-
T Consensus         2 ~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   29 (86)
T cd07157           2 TCQVCGEPAA---GFHHGAYVCEACKKFFMR   29 (86)
T ss_pred             CCcccCCcCc---ccEECcceeeEeeeEEec
Confidence            4888887654   469999999999998875


No 52 
>cd06955 NR_DBD_VDR DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. DNA-binding domain of vitamin D receptors (VDR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. VDR interacts with a VDR response element, a direct repeat of GGTTCA DNA site with 3 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation.  VDR is a member of the nuclear receptor (NR) superfamily that functions as classical endocrine receptors. VDR controls a wide range of biological activities including calcium metabolism, cell proliferation and differentiation, and immunomodulation. VDR is a high-affinity receptor for the biologically most active Vitamin D metabolite, 1alpha,25-dihydroxyvitamin D3 (1alpha,25(OH)2D3). The binding of the ligand to the receptor induces a conformational change of the ligand binding domain (LBD) with consequent dissociation of core
Probab=58.19  E-value=7.5  Score=27.68  Aligned_cols=30  Identities=20%  Similarity=0.650  Sum_probs=25.0

Q ss_pred             CCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          30 NKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      ...|.=||.+..   ...||+..|..|.+..|-
T Consensus         6 ~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   35 (107)
T cd06955           6 PRICGVCGDRAT---GFHFNAMTCEGCKGFFRR   35 (107)
T ss_pred             CCCCeecCCcCc---ccEECcceeeeecceecc
Confidence            466999998665   459999999999998875


No 53 
>cd07161 NR_DBD_EcR DNA-binding domain of Ecdysone receptor (ECR) family is composed of two C4-type zinc fingers. DNA-binding domain of Ecdysone receptor (EcR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with highly degenerate pseudo-palindromic response elements, resembling inverted repeats of 5'-AGGTCA-3' separated by 1 bp, upstream of the target gene and modulates the rate of transcriptional initiation. EcR is present only in invertebrates and regulates the expression of a large number of genes during development and reproduction. EcR functions as a heterodimer by partnering with ultraspiracle protein (USP), the ortholog of the vertebrate retinoid X receptor (RXR). The natural ligands of EcR are ecdysteroids, the endogenous steroidal hormones found in invertebrates. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcRs h
Probab=56.43  E-value=5.4  Score=27.48  Aligned_cols=29  Identities=21%  Similarity=0.726  Sum_probs=23.5

Q ss_pred             CCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      ..|.=||.+..   ...||++.|..|.+..|-
T Consensus         2 ~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   30 (91)
T cd07161           2 ELCLVCGDRAS---GYHYNALTCEGCKGFFRR   30 (91)
T ss_pred             CCCeeCCCcCc---ceEECceeehhhHHHHHH
Confidence            34888987655   458999999999998874


No 54 
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hing
Probab=56.32  E-value=8.1  Score=26.68  Aligned_cols=32  Identities=22%  Similarity=0.639  Sum_probs=25.7

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      +....|.=||.+..   ...||+..|..|.+..|.
T Consensus         4 ~p~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   35 (92)
T cd06970           4 NPGLLCRVCGDTSS---GKHYGIYACNGCSGFFKR   35 (92)
T ss_pred             CCCCCCeecCCcCc---ccEECccEEeeeeeEeee
Confidence            34557999998765   458999999999998875


No 55 
>cd07172 NR_DBD_GR_PR DNA-binding domain of glucocorticoid receptor (GR) is composed of two C4-type zinc fingers. DNA-binding domains of glucocorticoid receptor (GR) and progesterone receptor (PR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinate  a single zinc atom. The DBD from both receptors interact with the same hormone response element (HRE), which is an imperfect palindrome GGTACAnnnTGTTCT, upstream of target genes and modulates the rate of transcriptional initiation. GR is a transcriptional regulator that mediates the biological effects of glucocorticoids and PR regulates genes controlled by progesterone. GR is expressed in almost every cell in the body and regulates genes controlling a wide variety of processes including the development, metabolism, and immune response of the organism. PR functions in a variety of biological processes including development of the mammary gland, regulating cell cycle progression, p
Probab=55.62  E-value=5.6  Score=26.54  Aligned_cols=29  Identities=21%  Similarity=0.638  Sum_probs=23.7

Q ss_pred             CCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      ..|.=||.+..   ...||+..|..|.+..|.
T Consensus         3 ~~C~VCg~~a~---g~hyGv~sC~aC~~FFRR   31 (78)
T cd07172           3 KICLVCSDEAS---GCHYGVLTCGSCKVFFKR   31 (78)
T ss_pred             CCCeecCCcCc---ceEECceeehhhHHhHHH
Confidence            45888997655   469999999999998864


No 56 
>cd06962 NR_DBD_FXR DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. DNA-binding domain of Farnesoid X receptor (FXR) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. FXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  FXR is a member of the nuclear receptor family of ligand activated transcription factors. Bile acids are endogenous ligands for FXRs. Upon binding of a ligand, FXR binds to FXR response element (FXRE), which is an inverted repeat of TGACCT spaced by one nucleotide, either as a monomer or as a heterodimer with retinoid X receptor (RXR), to regulate the expression of various genes involved in bile acid, lipid, and glucose metabolism. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, FXR has a central well conserved 
Probab=55.33  E-value=7  Score=26.49  Aligned_cols=28  Identities=29%  Similarity=0.763  Sum_probs=23.1

Q ss_pred             CccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .|.=||.+..   ...||+..|..|.+..|-
T Consensus         3 ~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   30 (84)
T cd06962           3 LCVVCGDKAS---GYHYNALTCEGCKGFFRR   30 (84)
T ss_pred             CCeecCCcCc---ceEECcceeecceeeeee
Confidence            4888887655   458999999999998875


No 57 
>cd07166 NR_DBD_REV_ERB DNA-binding domain of REV-ERB receptor-like is composed of two C4-type zinc fingers. DNA-binding domain of REV-ERB receptor- like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. REV-ERB receptors are transcriptional regulators belonging to the nuclear receptor superfamily. They regulate a number of physiological functions including the circadian rhythm, lipid metabolism, and cellular differentiation. REV-ERB receptors bind as a monomer to a (A/G)GGTCA half-site with a 5' AT-rich extension or as a homodimer to a direct repeat 2 element (AGGTCA sequence with a 2-bp spacer), indicating functional diversity. When bound to the DNA, they recruit corepressors (NcoR/histone deacetylase 3) to the promoter, resulting in repression of the target genes. The porphyr
Probab=53.45  E-value=5.8  Score=27.16  Aligned_cols=30  Identities=27%  Similarity=0.697  Sum_probs=24.5

Q ss_pred             CCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          30 NKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      +..|.=||.+..   ...||++.|..|.+..|-
T Consensus         3 ~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   32 (89)
T cd07166           3 VVLCKVCGDKAS---GFHYGVHACEGCKGFFRR   32 (89)
T ss_pred             CCCCcccCccCc---ceEEChhhhhhHhhEecc
Confidence            456999998665   458999999999998875


No 58 
>cd07169 NR_DBD_GCNF_like DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. DNA-binding domain of Germ cell nuclear factor (GCNF) F1 is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. GCNF is a transcription factor expressed in post-meiotic stages of developing male germ cells. In vitro, GCNF has the ability to bind to direct repeat elements of  5'-AGGTCA.AGGTCA-3', as well as to an extended half-site sequence 5'-TCA.AGGTCA-3'. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, GCNF has  a central well conserved DNA-binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).
Probab=53.41  E-value=6.7  Score=26.94  Aligned_cols=32  Identities=22%  Similarity=0.699  Sum_probs=26.1

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      ..+..|.=||.+..   ...||+..|..|.+..|-
T Consensus         4 ~~~~~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   35 (90)
T cd07169           4 AEQRTCLICGDRAT---GLHYGIISCEGCKGFFKR   35 (90)
T ss_pred             ccCCCCeecCCcCc---ceEECcceehhhHHHHHH
Confidence            35677999998654   468999999999998865


No 59 
>cd06965 NR_DBD_Ppar DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PPAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Peroxisome proliferator-activated receptors (PPARs) are members of the nuclear receptor superfamily of ligand-activated transcription factors. PPARs play important roles in regulating cellular differentiation, development and lipid metabolism. Activated PPAR forms a heterodimer with the retinoid X receptor (RXR) that binds to the hormone response elements, which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair located upstream of the peroxisome proliferator responsive gene
Probab=53.30  E-value=5.3  Score=27.02  Aligned_cols=27  Identities=30%  Similarity=0.818  Sum_probs=22.0

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||++.|..|.+..|.
T Consensus         2 C~VCg~~~~---g~hyGv~sC~aCk~FFRR   28 (84)
T cd06965           2 CRVCGDKAS---GFHYGVHACEGCKGFFRR   28 (84)
T ss_pred             CcccCccCc---ceEEChhhhhhhhhheee
Confidence            677887654   458999999999999875


No 60 
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=53.14  E-value=26  Score=25.05  Aligned_cols=42  Identities=19%  Similarity=0.416  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHHHHHhcCCCCCCccCCCCCCCCeeecccc-eeeeccccc
Q psy5674          11 KQIQDKCQNLLMQMLKDDDNKYCVDCDAKGPRWASWNIG-IFLCIRCAG   58 (145)
Q Consensus        11 k~~~e~~~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~G-vflC~~Cs~   58 (145)
                      +++++..+..+..-      -.|..|++|++.-.--+-- ...|..|.+
T Consensus        67 ~~i~~~l~~yI~~y------VlC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       67 KKLQDLLRRYIKEY------VLCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             HHHHHHHHHHHHhc------EECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            34555555455433      4699999999877654433 345888854


No 61 
>cd06957 NR_DBD_PNR_like_2 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like is composed of two C4-type zinc fingers. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members 
Probab=52.57  E-value=8.3  Score=25.91  Aligned_cols=27  Identities=22%  Similarity=0.625  Sum_probs=20.8

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|-
T Consensus         1 C~VCg~~~~---g~hyGv~sC~aCk~FFRR   27 (82)
T cd06957           1 CKVCGDKSY---GKHYGVYCCDGCSCFFKR   27 (82)
T ss_pred             CCccCccCc---ceEECcceEeeeeeEEEE
Confidence            455776554   458999999999998764


No 62 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=52.46  E-value=6.3  Score=26.79  Aligned_cols=28  Identities=21%  Similarity=0.697  Sum_probs=22.4

Q ss_pred             CccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .|.=||.+..   ...||+..|..|++..|-
T Consensus         1 ~C~VCg~~~~---g~hygv~sC~aC~~FFRR   28 (87)
T cd07162           1 ICRVCGDRAT---GYHFNAMTCEGCKGFFRR   28 (87)
T ss_pred             CCcccCCcCc---ceEECcceehhhHHHHHh
Confidence            3777887655   358999999999998865


No 63 
>cd06967 NR_DBD_TR2_like DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. DNA-binding domain of the TR2 and TR4 (human testicular receptor 2 and 4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. TR2 and TR4 interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. TR4 and TR2 are orphan nuclear receptors; the physiological ligand is as yet unidentified. TR2 is abundantly expressed in the androgen-sensitive prostate. TR4 transcripts are expressed in many tissues, including central nervous system, adrenal gland, spleen, thyroid gland, and prostate. It has been shown that human TR2 binds to a wide spectrum of natural hormone response elements (HREs) with distinct affinities suggesting that TR2 may cross-talk with other gene expression regulation systems. The genes responding to TR2 or
Probab=52.13  E-value=9.1  Score=26.06  Aligned_cols=29  Identities=28%  Similarity=0.686  Sum_probs=23.7

Q ss_pred             CCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      ..|.=||.+...   ..||+..|..|.+..|.
T Consensus         4 ~~C~VCg~~~~g---~hyGv~sC~aC~~FFRR   32 (87)
T cd06967           4 ELCVVCGDKASG---RHYGAVSCEGCKGFFKR   32 (87)
T ss_pred             CCCeecCCcCCc---CEeCcceEeeeeeEeee
Confidence            458889986653   58999999999998865


No 64 
>cd06960 NR_DBD_HNF4A DNA-binding domain of heptocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. DNA-binding domain of hepatocyte nuclear factor 4 (HNF4) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. HNF4 interacts with a DNA site, composed of two direct repeats of AGTTCA with 1 bp spacer, which is upstream of target genes and modulates the rate of transcriptional initiation. HNF4 is a member of the nuclear receptor superfamily. HNF4 plays a key role in establishing and maintenance of hepatocyte differentiation in the liver. It is also expressed in gut, kidney, and pancreatic beta cells. HNF4 was originally classified as an orphan receptor, but later it is found that HNF4 binds with very high affinity to a variety of fatty acids. However, unlike other nuclear receptors, the ligands do not act as a molecular switch for HNF4. They seem to constantly bind to the receptor, which is
Probab=51.41  E-value=8.9  Score=25.24  Aligned_cols=27  Identities=26%  Similarity=0.760  Sum_probs=21.1

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|-
T Consensus         1 C~vCg~~~~---~~hygv~~C~aC~~FFrR   27 (76)
T cd06960           1 CAVCGDRAT---GKHYGVLSCNGCKGFFRR   27 (76)
T ss_pred             CCccCccCc---ccEECcceeeeehheeCc
Confidence            555776554   458999999999998875


No 65 
>cd06956 NR_DBD_RXR DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer.  RXRs can play different roles in these heterodimers. RXR  acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear rec
Probab=51.21  E-value=7  Score=25.94  Aligned_cols=28  Identities=21%  Similarity=0.732  Sum_probs=22.9

Q ss_pred             CccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .|.=||.+..   ...||+..|..|.+..|-
T Consensus         2 ~C~VC~~~~~---g~hygv~sC~aC~~FFRR   29 (77)
T cd06956           2 ICAICGDRAS---GKHYGVYSCEGCKGFFKR   29 (77)
T ss_pred             CCcccCCcCc---ceEECceeehhHHHHHHH
Confidence            4778887655   469999999999998865


No 66 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=50.93  E-value=12  Score=20.53  Aligned_cols=30  Identities=20%  Similarity=0.382  Sum_probs=13.7

Q ss_pred             CCCCccCCCCCCCCeeecccceeeeccccccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      .++.|.-||++...  ...=-..+|..|...|
T Consensus         2 ~~rfC~~CG~~t~~--~~~g~~r~C~~Cg~~~   31 (32)
T PF09297_consen    2 NHRFCGRCGAPTKP--APGGWARRCPSCGHEH   31 (32)
T ss_dssp             TTSB-TTT--BEEE---SSSS-EEESSSS-EE
T ss_pred             CCcccCcCCccccC--CCCcCEeECCCCcCEe
Confidence            47889999987210  1111235777776544


No 67 
>cd07168 NR_DBD_DHR4_like DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. DNA-binding domain of ecdysone-induced DHR4 orphan nuclear receptor is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Ecdysone-induced orphan receptor DHR4 is a member of the nuclear receptor family. DHR4 is expressed during the early Drosophila larval development and is induced by ecdysone. DHR4 coordinates growth and maturation in Drosophila by mediating endocrine response to the attainment of proper body size during larval development. Mutations in DHR4 result in shorter larval development which translates into smaller and lighter flies. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, DHR4
Probab=50.50  E-value=9.4  Score=26.16  Aligned_cols=31  Identities=29%  Similarity=0.722  Sum_probs=25.2

Q ss_pred             CCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      ....|.=||.+..   ...||+..|..|.+..|.
T Consensus         5 ~~~~C~VCg~~~~---g~hyGv~sC~aCk~FFRR   35 (90)
T cd07168           5 SPKLCSICEDKAT---GLHYGIITCEGCKGFFKR   35 (90)
T ss_pred             cCCCCcccCCcCc---ceEECceehhhhhHhhhh
Confidence            3456999998655   569999999999998865


No 68 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=49.97  E-value=8.4  Score=20.70  Aligned_cols=28  Identities=21%  Similarity=0.372  Sum_probs=17.4

Q ss_pred             CCccCCCCCCCCeeecccceeeeccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAG   58 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~   58 (145)
                      ..|.-|+..-+.-..-....++|..|..
T Consensus         2 ~~C~rC~~~~~~~~~~~r~~~~C~rCq~   29 (30)
T PF06827_consen    2 EKCPRCWNYIEDIGINGRSTYLCPRCQK   29 (30)
T ss_dssp             SB-TTT--BBEEEEETTEEEEE-TTTCC
T ss_pred             CcCccCCCcceEeEecCCCCeECcCCcC
Confidence            3588888886655555778899999864


No 69 
>cd06963 NR_DBD_GR_like The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. The DNA binding domain of GR_like nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family of NRs includes four types of nuclear hormone receptors: glucocorticoid receptor (GR), mineralocorticoid receptor (MR), progesterone receptor (PR), and androgen receptor (AR). The receptors bind to common DNA elements containing a partial palindrome of the core sequence 5'-TGTTCT-3' with a 3bp spacer. These four receptors regulate some of the most fundamental physiological functions such as the stress response, metabolism, electrolyte homeostasis, immune function, growth, development, and reproduction. The NRs in this family have high sequence homology and sha
Probab=49.82  E-value=7.9  Score=25.44  Aligned_cols=27  Identities=19%  Similarity=0.639  Sum_probs=20.8

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||++.|..|.+..|.
T Consensus         1 C~VCg~~a~---~~hygv~sC~aCk~FFRR   27 (73)
T cd06963           1 CLICGDEAS---GCHYGVLTCGSCKVFFKR   27 (73)
T ss_pred             CcccCccCc---ceEECceeehhhhHhHHH
Confidence            455776544   568999999999998865


No 70 
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=49.57  E-value=8.9  Score=25.05  Aligned_cols=27  Identities=22%  Similarity=0.715  Sum_probs=21.0

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|.
T Consensus         1 C~VC~~~~~---g~hygv~sC~aC~~FFRR   27 (72)
T cd07156           1 CGVCGDRAT---GYHFNAMTCEGCKGFFRR   27 (72)
T ss_pred             CCccCccCc---ccEECcceehhhhhhhch
Confidence            455776555   358999999999998875


No 71 
>cd06964 NR_DBD_RAR DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. DNA-binding domain of retinoic acid receptor (RAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RAR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. RARs mediate the biological effect of retinoids, including both natural dietary vitamin A (retinol) metabolites and active synthetic analogs. Retinoids play key roles in a wide variety of essential biological processes, such as vertebrate embryonic morphogenesis and organogenesis, differentiation and apoptosis, and homeostasis. RAR function as a heterodimer with retinoic X receptor by binding to specific RAR response elements (RAREs), which are composed of two direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pair and found in the promoter reg
Probab=49.54  E-value=11  Score=25.54  Aligned_cols=29  Identities=31%  Similarity=0.770  Sum_probs=24.0

Q ss_pred             CCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      ..|.=||.+..   ...||+..|..|.+..|-
T Consensus         5 ~~C~VCg~~~~---g~hyGv~sC~aC~~FFRR   33 (85)
T cd06964           5 KPCFVCQDKSS---GYHYGVSACEGCKGFFRR   33 (85)
T ss_pred             CCCcccCCcCc---ccEECcceeeeeeeEEee
Confidence            46888998655   468999999999998875


No 72 
>cd06916 NR_DBD_like DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. DNA-binding domain of nuclear receptors is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. It interacts with a specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. Nuclear receptors form a superfamily of ligand-activated transcription regulators, which regulate various physiological functions, from development, reproduction, to homeostasis and metabolism in animals (metazoans). The family contains not only receptors for known ligands but also orphan receptors for which ligands do not exist or have not been identified. NRs share a common structural organization with a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD).  Most nuclear receptors bind as homodimers or hetero
Probab=48.96  E-value=10  Score=24.71  Aligned_cols=27  Identities=30%  Similarity=0.875  Sum_probs=20.8

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|.
T Consensus         1 C~vC~~~~~---~~hygv~sC~aC~~FFRR   27 (72)
T cd06916           1 CAVCGDKAS---GYHYGVLTCEGCKGFFRR   27 (72)
T ss_pred             CCccCccCc---ccEECcceeeeeeeeEeE
Confidence            455776544   468999999999998865


No 73 
>cd07158 NR_DBD_Ppar_like The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family. The DNA-binding domain of peroxisome proliferator-activated receptors (PPAR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. These domains interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. This family includes three known types of nuclear receptors: peroxisome proliferator-activated receptors (PPAR), REV-ERB receptors and Drosophila ecdysone-induced protein 78 (E78). Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PPAR-like receptors have a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a non-conserved hinge and a C-terminal ligand binding domain (LBD).
Probab=48.56  E-value=6.8  Score=25.59  Aligned_cols=27  Identities=30%  Similarity=0.811  Sum_probs=21.1

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||++.|..|.+..|.
T Consensus         1 C~VCg~~~~---g~hyGv~~C~aC~~FFRR   27 (73)
T cd07158           1 CKVCGDKAS---GFHYGVHSCEGCKGFFRR   27 (73)
T ss_pred             CcccCccCc---ceEECcchhhHHHHHHhh
Confidence            455776555   358999999999998875


No 74 
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=48.26  E-value=52  Score=27.54  Aligned_cols=31  Identities=19%  Similarity=0.388  Sum_probs=22.6

Q ss_pred             CCCCCccCCCCCCCCeeec-------c-cceeeeccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASW-------N-IGIFLCIRCAG   58 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~-------~-~GvflC~~Cs~   58 (145)
                      .+...|..||.....|.-+       . --.++|..|..
T Consensus       256 t~~~~C~~C~~~~~~~~q~QtrsaDEpmT~f~~C~~Cg~  294 (299)
T TIGR01385       256 TDLFTCGKCKQKKCTYYQLQTRSADEPMTTFVTCEECGN  294 (299)
T ss_pred             cccccCCCCCCccceEEEecccCCCCCCeEEEEcCCCCC
Confidence            5578999999998888733       2 22448999864


No 75 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=48.10  E-value=14  Score=25.56  Aligned_cols=32  Identities=19%  Similarity=0.460  Sum_probs=24.7

Q ss_pred             CCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .-..|..|+.+..  --+..||..|..|...--.
T Consensus        34 ~~~~Cp~C~~~~V--kR~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          34 AKHVCPFCGRTTV--KRIATGIWKCRKCGAKFAG   65 (89)
T ss_pred             cCCcCCCCCCcce--eeeccCeEEcCCCCCeecc
Confidence            4567999999843  4678999999999765543


No 76 
>COG2174 RPL34A Ribosomal protein L34E [Translation, ribosomal structure and biogenesis]
Probab=47.25  E-value=12  Score=26.06  Aligned_cols=33  Identities=24%  Similarity=0.536  Sum_probs=22.3

Q ss_pred             cCCCCCCccCCCCCC-------C-Ce---------eecccceeeeccccc
Q psy5674          26 KDDDNKYCVDCDAKG-------P-RW---------ASWNIGIFLCIRCAG   58 (145)
Q Consensus        26 ~~p~N~~CaDCg~~~-------p-~w---------~s~~~GvflC~~Cs~   58 (145)
                      +.|+--.|++||.+-       | .+         ++=.||-.+|..|..
T Consensus        30 K~~~~p~C~~cg~pL~Gi~r~RP~e~~r~skt~krp~RpYGG~lc~~c~~   79 (93)
T COG2174          30 KKPTIPKCAICGRPLGGIPRGRPREFRRLSKTKKRPERPYGGYLCANCVR   79 (93)
T ss_pred             ccCCCCcccccCCccCCccCCCcHHHHhccccccCcCCCcCceecHHHHH
Confidence            346677899999871       1 11         133489999998854


No 77 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=47.12  E-value=9.9  Score=22.77  Aligned_cols=24  Identities=17%  Similarity=0.470  Sum_probs=17.3

Q ss_pred             CccCCCCCCCCeeecccceeeeccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAG   58 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~   58 (145)
                      +|.+||+....-   ..+.+-|..|..
T Consensus         4 ~C~~Cg~~~~~~---~~~~irC~~CG~   27 (44)
T smart00659        4 ICGECGRENEIK---SKDVVRCRECGY   27 (44)
T ss_pred             ECCCCCCEeecC---CCCceECCCCCc
Confidence            699999964422   567788998853


No 78 
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs. This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive.
Probab=46.97  E-value=24  Score=26.33  Aligned_cols=37  Identities=19%  Similarity=0.466  Sum_probs=25.7

Q ss_pred             HHHHHHHhcCCCCCCccCCCCCCCCeeecccceeeecccccccccC
Q psy5674          18 QNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRNL   63 (145)
Q Consensus        18 ~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~l   63 (145)
                      +++|..+....+...|.-||-         ++-.+|..|.|-|+.+
T Consensus        87 ~~lL~~~~~~~~~~~C~~Cgg---------~rfv~C~~C~Gs~k~~  123 (147)
T cd03031          87 RKLLKGIRARAGGGVCEGCGG---------ARFVPCSECNGSCKVF  123 (147)
T ss_pred             HHHHhhcccccCCCCCCCCCC---------cCeEECCCCCCcceEE
Confidence            445555544456677999985         3446999999999875


No 79 
>cd06958 NR_DBD_COUP_TF DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. DNA-binding domain of chicken ovalbumin upstream promoter transcription factors (COUP-TFs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. COUP-TFs are orphan members of the steroid/thyroid hormone receptor superfamily. They are expressed in many tissues and are involved in the regulation of several important biological processes, such as neurogenesis, organogenesis, cell fate determination, and metabolic homeostasis. COUP-TFs homodimerize or heterodimerize with retinoid X receptor (RXR) and a few other nuclear receptors and bind to a variety of response elements that are composed of imperfect AGGTCA direct or inverted repeats with various spacings. COUP-TFs are generally considered to be repressors of transcription for other nuclear hormone recept
Probab=46.12  E-value=8.5  Score=25.21  Aligned_cols=27  Identities=30%  Similarity=0.720  Sum_probs=20.9

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|-
T Consensus         1 C~VCg~~~~---g~hygv~sC~aC~~FFRR   27 (73)
T cd06958           1 CVVCGDKSS---GKHYGQFTCEGCKSFFKR   27 (73)
T ss_pred             CCccCccCc---ceEEChhhhhhhhhhhhh
Confidence            455776555   458999999999998865


No 80 
>cd07155 NR_DBD_ER_like DNA-binding domain of estrogen receptor (ER) and estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domains of estrogen receptor (ER) and estrogen related receptors (ERR) are composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. ER and ERR interact with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulate the rate of transcriptional initiation. ERR and ER are closely related and share sequence similarity, target genes, co-regulators and promoters. While ER is activated by endogenous estrogen, ERR lacks the ability to bind to estrogen. Estrogen receptor mediates the biological effects of hormone estrogen by the binding of the receptor dimer to estrogen response element of target genes.  However, ERRs seem to interfere with the classic ER-mediated estrogen responsive signaling by targeting the same set of genes. E
Probab=46.09  E-value=7  Score=25.77  Aligned_cols=27  Identities=19%  Similarity=0.673  Sum_probs=21.0

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|-
T Consensus         1 C~VC~~~~~---g~hygv~sC~aCk~FFRR   27 (75)
T cd07155           1 CLVCGDIAS---GYHYGVASCEACKAFFKR   27 (75)
T ss_pred             CcccCccCc---ceEEChhhhhhhHHHHHH
Confidence            556776544   468999999999998864


No 81 
>cd07179 2DBD_NR_DBD2 The second DNA-binding domain (DBD) of the 2DBD nuclear receptor is composed of two C4-type zinc fingers. The second DNA-binding domain (DBD) of the 2DBD nuclear receptor (NR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. The proteins contain two DBDs in tandem, probably resulting from an ancient recombination event.  The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=46.00  E-value=8.6  Score=25.29  Aligned_cols=27  Identities=30%  Similarity=0.824  Sum_probs=20.9

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|-
T Consensus         1 C~VCg~~~~---g~hygv~sC~aC~~FFRR   27 (74)
T cd07179           1 CRVCGGKSS---GFHFGALTCEGCKGFFRR   27 (74)
T ss_pred             CcccCccCc---ceEECceeehhHHHHHHH
Confidence            455776554   458999999999998864


No 82 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=45.87  E-value=16  Score=21.60  Aligned_cols=22  Identities=23%  Similarity=0.542  Sum_probs=15.0

Q ss_pred             CccCCCCCCCCeeecccceeee
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLC   53 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC   53 (145)
                      .|.+|+..+.-|+++.-+-..|
T Consensus         1 ~C~~C~~~~~l~~CL~C~~~~c   22 (50)
T smart00290        1 RCSVCGTIENLWLCLTCGQVGC   22 (50)
T ss_pred             CcccCCCcCCeEEecCCCCccc
Confidence            4899998776676665444444


No 83 
>cd06969 NR_DBD_NGFI-B DNA-binding domain of the orphan nuclear receptor, nerve growth factor-induced-B. DNA-binding domain (DBD) of the orphan nuclear receptor, nerve growth factor-induced-B (NGFI-B) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NGFI-B interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. NGFI-B is a member of the nuclear-steroid receptor superfamily. NGFI-B is classified as an orphan receptor because no ligand has yet been identified. NGFI-B is an early immediate gene product of embryo development that is rapidly produced in response to a variety of cellular signals including nerve growth factor. It is involved in T-cell-mediated apoptosis, as well as neuronal differentiation and function. NGFI-B regulates transcription by binding to a specific DNA target upstream of its target genes and regulating the rate of transcrip
Probab=45.44  E-value=12  Score=24.60  Aligned_cols=28  Identities=21%  Similarity=0.644  Sum_probs=22.4

Q ss_pred             CccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      .|.=||.+..   ...||+..|..|.+..|.
T Consensus         2 ~C~VCg~~~~---g~hyGv~sC~aC~~FFRR   29 (75)
T cd06969           2 LCAVCGDNAA---CQHYGVRTCEGCKGFFKR   29 (75)
T ss_pred             CCeecCCcCc---ceEECcceeeeeeeeeee
Confidence            4777887654   458999999999998875


No 84 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=45.01  E-value=8  Score=25.89  Aligned_cols=27  Identities=30%  Similarity=0.791  Sum_probs=21.2

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|-
T Consensus         1 C~VCg~~~~---g~hyG~~sC~aC~~FFRR   27 (81)
T cd07165           1 CKVCGDKAS---GYHYGVTSCEGCKGFFRR   27 (81)
T ss_pred             CCccCccCc---ceEECchhhhhHHHHHHh
Confidence            455776554   459999999999998875


No 85 
>PF00105 zf-C4:  Zinc finger, C4 type (two domains);  InterPro: IPR001628 Steroid or nuclear hormone receptors constitute an important superfamily of transcription regulators that are involved in widely diverse physiological functions, including control of embryonic development, cell differentiation and homeostasis. The receptors function as dimeric molecules in nuclei to regulate the transcription of target genes in a ligand-responsive manner. Nuclear hormone receptors consist of a highly conserved DNA-binding domain that recognises specific sequences, connected via a linker region to a C-terminal ligand-binding domain (IPR000536 from INTERPRO). In addition, certain nuclear hormone receptors have an N-terminal modulatory domain (IPR001292 from INTERPRO). The DNA-binding domain can elicit either an activating or repressing effect by binding to specific regions of the DNA known as hormone-response elements [, ]. These response elements position the receptors, and the complexes recruited by them, close to the genes of which transcription is affected. The DNA-binding domains of nuclear receptors consist of two zinc-nucleated modules and a C-terminal extension, where residues in the first zinc module determine the specificity of the DNA recognition and residues in the second zinc module are involved in dimerisation. The DNA-binding domain is furthermore involved in several other functions including nuclear localisation, and interaction with transcription factors and co-activators []. Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the two C4-type zinc finger modules involved in DNA-binding. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1DSZ_A 1LO1_A 3M9E_F 2EBL_A 1GA5_B 1A6Y_B 1HLZ_B 1HRA_A 1KB6_B 1KB4_B ....
Probab=44.48  E-value=8.6  Score=24.67  Aligned_cols=28  Identities=25%  Similarity=0.661  Sum_probs=21.1

Q ss_pred             CCccCCCCCCCCeeecccceeeecccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHR   61 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR   61 (145)
                      +.|.=||.+..   ..+||++.|..|...-|
T Consensus         1 ~~C~VCg~~~~---~~~ygv~sC~~C~~FFr   28 (70)
T PF00105_consen    1 KKCKVCGDPAS---GYHYGVLSCNACKMFFR   28 (70)
T ss_dssp             -BSTTTSSBES---EEETTEEEEHHHHHHHH
T ss_pred             CCCeECCCccC---cccccccccccceeeee
Confidence            35888887543   56999999999998543


No 86 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=44.45  E-value=11  Score=22.25  Aligned_cols=24  Identities=29%  Similarity=0.671  Sum_probs=17.1

Q ss_pred             CCCccCCCCCCCCeeecccceeeeccc
Q psy5674          30 NKYCVDCDAKGPRWASWNIGIFLCIRC   56 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~~GvflC~~C   56 (145)
                      +..|.+||.+-.+   ..-|..+|..|
T Consensus        17 ~~~Cp~C~~PL~~---~k~g~~~Cv~C   40 (41)
T PF06677_consen   17 DEHCPDCGTPLMR---DKDGKIYCVSC   40 (41)
T ss_pred             cCccCCCCCeeEE---ecCCCEECCCC
Confidence            6789999887443   34567778777


No 87 
>cd07154 NR_DBD_PNR_like The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family. The DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) nuclear receptor-like family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes nuclear receptor Tailless (TLX), photoreceptor cell-specific nuclear receptor (PNR) and related receptors. TLX is an orphan receptor that plays a key role in neural development by regulating cell cycle progression and exit of neural stem cells in the developing brain. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. Like other members of the nuclear
Probab=43.29  E-value=14  Score=24.13  Aligned_cols=27  Identities=22%  Similarity=0.772  Sum_probs=20.9

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|.
T Consensus         1 C~vCg~~~~---~~hyGv~sC~aC~~FFRR   27 (73)
T cd07154           1 CKVCGDRSS---GKHYGVYACDGCSGFFKR   27 (73)
T ss_pred             CcccCccCc---ceEECcceeeeeeeEeee
Confidence            455776544   458999999999998875


No 88 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=42.72  E-value=12  Score=24.13  Aligned_cols=27  Identities=22%  Similarity=0.746  Sum_probs=21.4

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.-||.+..   ...||+..|..|.+..|.
T Consensus         2 C~vC~~~~~---~~hygv~~C~aC~~FFRR   28 (70)
T smart00399        2 CCVCGDHAS---GFHFGVCSCRACKAFFRR   28 (70)
T ss_pred             CeEeCCcCc---ccEeCCcEechhhhhhhh
Confidence            666777655   348999999999998874


No 89 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=42.67  E-value=16  Score=20.55  Aligned_cols=29  Identities=24%  Similarity=0.393  Sum_probs=21.8

Q ss_pred             CCCccCCCCCCCCeeecccceeeeccccccc
Q psy5674          30 NKYCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      ...|-.|+....-+  .+-+..+|..|..++
T Consensus         3 ~~~C~~C~~~~i~~--~~~~~~~C~~Cg~~~   31 (33)
T PF08792_consen    3 LKKCSKCGGNGIVN--KEDDYEVCIFCGSSF   31 (33)
T ss_pred             ceEcCCCCCCeEEE--ecCCeEEcccCCcEe
Confidence            45788899877533  678888999997664


No 90 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=42.59  E-value=16  Score=20.25  Aligned_cols=24  Identities=17%  Similarity=0.512  Sum_probs=12.7

Q ss_pred             CccCCCCCCCCeeecccceeeeccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAG   58 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~   58 (145)
                      .|--|++... |  .+-.+|+|..|..
T Consensus         4 ~Cp~C~se~~-y--~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYT-Y--EDGELLVCPECGH   27 (30)
T ss_dssp             --TTT------E--E-SSSEEETTTTE
T ss_pred             CCCCCCCcce-e--ccCCEEeCCcccc
Confidence            4777887655 3  6778899999964


No 91 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=42.45  E-value=11  Score=21.08  Aligned_cols=23  Identities=22%  Similarity=0.410  Sum_probs=14.3

Q ss_pred             CccCCCCCCCCeeecccceeeecccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCA   57 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs   57 (145)
                      .|++||+...   .-.....-|..|.
T Consensus         2 ~C~~Cg~~~~---~~~~~~irC~~CG   24 (32)
T PF03604_consen    2 ICGECGAEVE---LKPGDPIRCPECG   24 (32)
T ss_dssp             BESSSSSSE----BSTSSTSSBSSSS
T ss_pred             CCCcCCCeeE---cCCCCcEECCcCC
Confidence            5899998754   1233445787774


No 92 
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=42.23  E-value=11  Score=23.46  Aligned_cols=33  Identities=27%  Similarity=0.608  Sum_probs=25.7

Q ss_pred             CccCCCCC-CCCeeecc-cceeeecccccccccCC
Q psy5674          32 YCVDCDAK-GPRWASWN-IGIFLCIRCAGIHRNLG   64 (145)
Q Consensus        32 ~CaDCg~~-~p~w~s~~-~GvflC~~Cs~iHR~lg   64 (145)
                      +|..|+.. .|.|=.-. -+..||-.|..-.+..|
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~   35 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHG   35 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcC
Confidence            59999986 57787655 77889999987766655


No 93 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=41.99  E-value=22  Score=20.50  Aligned_cols=29  Identities=24%  Similarity=0.482  Sum_probs=19.7

Q ss_pred             CccCCCCCCCCeeecccceeeeccccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      .|..|+..-.....-.+-+..|..|.|+-
T Consensus         1 ~CP~C~~~l~~~~~~~~~id~C~~C~G~W   29 (41)
T PF13453_consen    1 KCPRCGTELEPVRLGDVEIDVCPSCGGIW   29 (41)
T ss_pred             CcCCCCcccceEEECCEEEEECCCCCeEE
Confidence            47788886433333457777899998875


No 94 
>cd06959 NR_DBD_EcR_like The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of Ecdysone receptor (EcR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. EcR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: Ecdysone receptor (EcR), Liver X receptor (LXR) and Farnesoid X receptor (FXR). The DNA binding activity is regulated by their corresponding ligands. The ligands for EcR are ecdysteroids; LXR is regulated by oxidized cholesterol derivatives or oxysterols; and bile acids control FXR's activities. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, EcR-like receptors have  a central well conserved DNA binding domai
Probab=41.75  E-value=11  Score=24.65  Aligned_cols=27  Identities=33%  Similarity=0.899  Sum_probs=21.5

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|.
T Consensus         2 C~vCg~~~~---~~hygv~sC~aC~~FFRR   28 (73)
T cd06959           2 CVVCGDKAS---GFHYGVLSCEGCKGFFRR   28 (73)
T ss_pred             CceeCCcCc---ceEECceeehhhHHHHHH
Confidence            666776554   458999999999998874


No 95 
>KOG3362|consensus
Probab=40.95  E-value=12  Score=28.44  Aligned_cols=34  Identities=26%  Similarity=0.624  Sum_probs=27.1

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeec-cccccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCI-RCAGIHRN   62 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~-~Cs~iHR~   62 (145)
                      |--+.|+-|| -...|.+++-|.-.|. .|-.+|..
T Consensus       116 P~r~fCaVCG-~~S~ysC~~CG~kyCsv~C~~~Hne  150 (156)
T KOG3362|consen  116 PLRKFCAVCG-YDSKYSCVNCGTKYCSVRCLKTHNE  150 (156)
T ss_pred             CcchhhhhcC-CCchhHHHhcCCceeechhhhhccc
Confidence            5567899999 5666899999998764 68888865


No 96 
>PRK00420 hypothetical protein; Validated
Probab=40.93  E-value=53  Score=23.63  Aligned_cols=28  Identities=18%  Similarity=0.224  Sum_probs=21.7

Q ss_pred             CCCccCCCCCCCCeeecccceeeeccccccc
Q psy5674          30 NKYCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      +..|..||++-..   +.-|-..|..|...-
T Consensus        23 ~~~CP~Cg~pLf~---lk~g~~~Cp~Cg~~~   50 (112)
T PRK00420         23 SKHCPVCGLPLFE---LKDGEVVCPVHGKVY   50 (112)
T ss_pred             cCCCCCCCCccee---cCCCceECCCCCCee
Confidence            4889999987553   377889999997643


No 97 
>cd06961 NR_DBD_TR DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. DNA-binding domain of thyroid hormone receptors (TRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. TR interacts with the thyroid response element, which is a DNA site with direct repeats of the consensus sequence 5'-AGGTCA-3' separated by one to five base pairs, upstream of target genes and modulates the rate of transcriptional initiation. Thyroid hormone receptor (TR) mediates the actions of thyroid hormones, which play critical roles in growth, development, and homeostasis in mammals. They regulate overall metabolic rate, cholesterol and triglyceride levels, and heart rate, and affect mood. TRs are expressed from two separate genes (alpha and beta) in human and each gene generates two isoforms of the receptor through differential promoter usage or splicing. TRalpha functions in the he
Probab=40.79  E-value=9.4  Score=25.86  Aligned_cols=27  Identities=30%  Similarity=0.754  Sum_probs=21.6

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|-
T Consensus         2 C~VCg~~~~---g~hygv~sC~aC~~FFRR   28 (85)
T cd06961           2 CVVCGDKAT---GYHYRCITCEGCKGFFRR   28 (85)
T ss_pred             CceeCCcCc---ceEEChhhhhhhhHhhHh
Confidence            667887655   458999999999998874


No 98 
>cd07164 NR_DBD_PNR_like_1 DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) like proteins is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-t
Probab=39.70  E-value=13  Score=24.58  Aligned_cols=27  Identities=22%  Similarity=0.628  Sum_probs=20.8

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|-
T Consensus         1 C~VCg~~~~---g~hyG~~~C~~C~~FFRR   27 (78)
T cd07164           1 CRVCGDRAS---GKHYGVPSCDGCRGFFKR   27 (78)
T ss_pred             CcccCccCc---ceEECcchhhhhhhhhhh
Confidence            455776554   358999999999998865


No 99 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=39.58  E-value=17  Score=29.03  Aligned_cols=25  Identities=28%  Similarity=0.569  Sum_probs=21.0

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeecccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGI   59 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~i   59 (145)
                      +-.+.|.-||.       +.-+.|.|..|...
T Consensus       307 ~tS~~C~~cg~-------~~~r~~~C~~cg~~  331 (364)
T COG0675         307 YTSKTCPCCGH-------LSGRLFKCPRCGFV  331 (364)
T ss_pred             CCcccccccCC-------ccceeEECCCCCCe
Confidence            45689999999       66899999999774


No 100
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=37.97  E-value=27  Score=20.64  Aligned_cols=32  Identities=19%  Similarity=0.334  Sum_probs=19.1

Q ss_pred             CCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      +.|.+||..-..=-.-.-..++|..|.-.++.
T Consensus         1 ~FCp~Cg~~l~~~~~~~~~~~vC~~Cg~~~~~   32 (52)
T smart00661        1 KFCPKCGNMLIPKEGKEKRRFVCRKCGYEEPI   32 (52)
T ss_pred             CCCCCCCCccccccCCCCCEEECCcCCCeEEC
Confidence            36999998521110001127899999877664


No 101
>KOG4215|consensus
Probab=37.69  E-value=15  Score=31.98  Aligned_cols=32  Identities=25%  Similarity=0.610  Sum_probs=26.7

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      ..+..|+=||.+.+   ---||..-|..|.|.-|.
T Consensus        17 ~~~~~CaICGDkaT---GKHYGA~SCdGCKGFFRR   48 (432)
T KOG4215|consen   17 GVAEFCAICGDKAT---GKHYGAISCDGCKGFFRR   48 (432)
T ss_pred             cccchhheeCCccc---ccccceeecCcchHHHHH
Confidence            36889999999876   357999999999997653


No 102
>PHA02942 putative transposase; Provisional
Probab=37.20  E-value=23  Score=30.51  Aligned_cols=28  Identities=21%  Similarity=0.358  Sum_probs=21.4

Q ss_pred             CCCCccCCCCCCCCeeecccceeeecccccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCAGI   59 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~i   59 (145)
                      -.+.|..||...+   .++-.+|.|..|.-.
T Consensus       324 TSq~Cs~CG~~~~---~l~~r~f~C~~CG~~  351 (383)
T PHA02942        324 SSVSCPKCGHKMV---EIAHRYFHCPSCGYE  351 (383)
T ss_pred             CCccCCCCCCccC---cCCCCEEECCCCCCE
Confidence            4688999998765   345568999999663


No 103
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=37.10  E-value=24  Score=25.19  Aligned_cols=30  Identities=30%  Similarity=0.685  Sum_probs=20.8

Q ss_pred             CCCCCCccCCCCCCCCeeecccceeeeccccccc
Q psy5674          27 DDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        27 ~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      .|..-.|.+||..    ..+....+.|..|.+..
T Consensus        67 ~p~~~~C~~Cg~~----~~~~~~~~~CP~Cgs~~   96 (115)
T TIGR00100        67 EPVECECEDCSEE----VSPEIDLYRCPKCHGIM   96 (115)
T ss_pred             eCcEEEcccCCCE----EecCCcCccCcCCcCCC
Confidence            3788899999953    22222257899998854


No 104
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=36.56  E-value=14  Score=20.77  Aligned_cols=27  Identities=22%  Similarity=0.442  Sum_probs=18.4

Q ss_pred             CccCCCCCCCCeeecc-cceeeeccccc
Q psy5674          32 YCVDCDAKGPRWASWN-IGIFLCIRCAG   58 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~-~GvflC~~Cs~   58 (145)
                      .|.+||..-..+.+.. -....|-.|.+
T Consensus         7 ~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (41)
T smart00834        7 RCEDCGHTFEVLQKISDDPLATCPECGG   34 (41)
T ss_pred             EcCCCCCEEEEEEecCCCCCCCCCCCCC
Confidence            5888888655555554 45567888876


No 105
>cd07167 NR_DBD_Lrh-1_like The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. The DNA-binding domain of Lrh-1 like nuclear receptor family like is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. This nuclear receptor family includes at least three subgroups of receptors that function in embryo development and differentiation, and other processes. FTZ-F1 interacts with the cis-acting DNA motif of ftz gene, which is required at several stages of development. Particularly, FTZ-F1 regulated genes are strongly linked to steroid biosynthesis and sex-determination; LRH-1 is a regulator of bile-acid homeostasis, steroidogenesis, reverse cholesterol transport and the initial stages of embryonic development; SF-1 is an essential regu
Probab=35.78  E-value=13  Score=25.77  Aligned_cols=27  Identities=26%  Similarity=0.786  Sum_probs=20.9

Q ss_pred             ccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          33 CVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        33 CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      |.=||.+..   ...||+..|..|.+..|-
T Consensus         1 C~VCg~~a~---g~hyGv~sC~aCk~FFRR   27 (93)
T cd07167           1 CPVCGDKVS---GYHYGLLTCESCKGFFKR   27 (93)
T ss_pred             CcccCccCc---ceEECchhhhhHHHHHHH
Confidence            555776544   468999999999998864


No 106
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=35.70  E-value=31  Score=23.63  Aligned_cols=31  Identities=16%  Similarity=0.458  Sum_probs=23.4

Q ss_pred             CCCccCCCCCCCCeeecc--------cceeeeccccccc
Q psy5674          30 NKYCVDCDAKGPRWASWN--------IGIFLCIRCAGIH   60 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~--------~GvflC~~Cs~iH   60 (145)
                      +..|..||.....|..+.        --.|+|..|...-
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q~RsadE~~T~fy~C~~C~~~w  100 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQTRRADEPETRFYKCTKCGYVW  100 (104)
T ss_pred             cCCCCCCCCCeeEEEEeccCCCCCCcEEEEEeCCCCCee
Confidence            789999999988887553        2367999986443


No 107
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=35.11  E-value=12  Score=23.08  Aligned_cols=43  Identities=19%  Similarity=0.335  Sum_probs=24.4

Q ss_pred             CccCCCCCCCCe--eecccceeeecccccccccCCCccceeeeccc
Q psy5674          32 YCVDCDAKGPRW--ASWNIGIFLCIRCAGIHRNLGVHISRVKSVNL   75 (145)
Q Consensus        32 ~CaDCg~~~p~w--~s~~~GvflC~~Cs~iHR~lg~~is~Vksl~l   75 (145)
                      .|+=||..-.-.  +-+.=| +||.+|..--..+......++++|+
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl~~~~~~~~~~~~~t~   45 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKLSGFFSDVKIKKNLTL   45 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHhcCcccchhhhhhccH
Confidence            478888873332  345667 7999998543333332333344444


No 108
>PRK04059 rpl34e 50S ribosomal protein L34e; Validated
Probab=33.42  E-value=23  Score=24.50  Aligned_cols=31  Identities=23%  Similarity=0.539  Sum_probs=20.0

Q ss_pred             CCCCCccCCCCCC-------C----------Ceeecccceeeeccccc
Q psy5674          28 DDNKYCVDCDAKG-------P----------RWASWNIGIFLCIRCAG   58 (145)
Q Consensus        28 p~N~~CaDCg~~~-------p----------~w~s~~~GvflC~~Cs~   58 (145)
                      +.--.|+|||.+-       |          .-++=.||-.+|..|..
T Consensus        32 ~~~pkC~~c~~~L~Gi~~~Rp~~~~rlsK~~K~vsRaYGG~lc~~cvr   79 (88)
T PRK04059         32 PSKAKCAICGKPLNGVPRGRPVEIRKLGKTEKRPERPYGGYLCPKCLK   79 (88)
T ss_pred             CCCCcCCCCCCccCCccCcchHHHHhcccccCCcccCcCceecHHHHH
Confidence            3344699999861       1          12344588888888853


No 109
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=33.28  E-value=41  Score=24.77  Aligned_cols=32  Identities=19%  Similarity=0.428  Sum_probs=19.3

Q ss_pred             CCCCCccCCCCC------------CCCeeecccc-eeeecccccc
Q psy5674          28 DDNKYCVDCDAK------------GPRWASWNIG-IFLCIRCAGI   59 (145)
Q Consensus        28 p~N~~CaDCg~~------------~p~w~s~~~G-vflC~~Cs~i   59 (145)
                      |-...|..|+.+            -|..+--.+. ...|..|..+
T Consensus        89 ~~~sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~ki  133 (147)
T PF01927_consen   89 PIFSRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKI  133 (147)
T ss_pred             CCCCccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCE
Confidence            446899999985            1333333344 3478777554


No 110
>TIGR00598 rad14 DNA repair protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=33.21  E-value=7.8  Score=30.05  Aligned_cols=28  Identities=14%  Similarity=0.316  Sum_probs=21.6

Q ss_pred             ccCCCCCCCC-eeecccceeeeccccccc
Q psy5674          33 CVDCDAKGPR-WASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        33 CaDCg~~~p~-w~s~~~GvflC~~Cs~iH   60 (145)
                      |.+||..... |.--+|++-||..|..-+
T Consensus         1 C~eCg~~~~D~~l~~~F~~~vC~~C~~~~   29 (172)
T TIGR00598         1 CEECGKIFMDSYLFDHFDCAVCDNCRDKD   29 (172)
T ss_pred             CccccchhhhHHHHHHCCChhhhhhhccc
Confidence            8899986333 445679999999998765


No 111
>PF14376 Haem_bd:  Haem-binding domain
Probab=32.93  E-value=22  Score=26.06  Aligned_cols=15  Identities=27%  Similarity=0.848  Sum_probs=11.7

Q ss_pred             CCCccCCCCCCCCee
Q psy5674          30 NKYCVDCDAKGPRWA   44 (145)
Q Consensus        30 N~~CaDCg~~~p~w~   44 (145)
                      .+-|.||++.++.|-
T Consensus        41 ~~~CydCHSn~T~~P   55 (137)
T PF14376_consen   41 KNSCYDCHSNNTRYP   55 (137)
T ss_pred             HccccccCCCCCCCc
Confidence            356999999977664


No 112
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=32.76  E-value=31  Score=21.13  Aligned_cols=26  Identities=23%  Similarity=0.749  Sum_probs=18.7

Q ss_pred             CCCCccCCCCCCCCeeecccceeeecccc
Q psy5674          29 DNKYCVDCDAKGPRWASWNIGIFLCIRCA   57 (145)
Q Consensus        29 ~N~~CaDCg~~~p~w~s~~~GvflC~~Cs   57 (145)
                      -++.|..||+.   ......+-+.|..|.
T Consensus        19 ~~~fCP~Cg~~---~m~~~~~r~~C~~Cg   44 (50)
T PRK00432         19 KNKFCPRCGSG---FMAEHLDRWHCGKCG   44 (50)
T ss_pred             ccCcCcCCCcc---hheccCCcEECCCcC
Confidence            46689999984   333445888999885


No 113
>PTZ00074 60S ribosomal protein L34; Provisional
Probab=31.79  E-value=22  Score=26.56  Aligned_cols=31  Identities=32%  Similarity=0.581  Sum_probs=20.8

Q ss_pred             CCCCCccCCCCCC-------C----------Ceeecccceeeeccccc
Q psy5674          28 DDNKYCVDCDAKG-------P----------RWASWNIGIFLCIRCAG   58 (145)
Q Consensus        28 p~N~~CaDCg~~~-------p----------~w~s~~~GvflC~~Cs~   58 (145)
                      +.--.|+|||.+-       |          .-++=.||-.+|..|..
T Consensus        39 ~~~pkC~~cg~~L~GI~~~Rp~e~~rlsK~~KtvsRaYGG~lC~~CVr   86 (135)
T PTZ00074         39 SSGPKCGDCGKVLAGIKALRPTEYKQLSRRERTVSRAYGGVLCHKCVR   86 (135)
T ss_pred             CCCCCCCCCCCccCCccCCchHHHHHccccCCCccCCCccchhHHHHH
Confidence            3445699999871       1          12345699999998854


No 114
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=30.76  E-value=21  Score=21.36  Aligned_cols=27  Identities=19%  Similarity=0.445  Sum_probs=19.3

Q ss_pred             CccCCCCCCCCeeeccc-ceeeeccccc
Q psy5674          32 YCVDCDAKGPRWASWNI-GIFLCIRCAG   58 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~-GvflC~~Cs~   58 (145)
                      .|.+||..--.|.+..- ....|-.|.+
T Consensus         7 ~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         7 RCTACGHRFEVLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EeCCCCCEeEEEEecCCCCCCCCCCCCC
Confidence            58899986666765543 4557998876


No 115
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=30.40  E-value=91  Score=23.13  Aligned_cols=42  Identities=17%  Similarity=0.446  Sum_probs=26.2

Q ss_pred             HHHHHHHHHHHHHHhcCCCCCCccCCCCCCCCeeecc-cceeeeccccc
Q psy5674          11 KQIQDKCQNLLMQMLKDDDNKYCVDCDAKGPRWASWN-IGIFLCIRCAG   58 (145)
Q Consensus        11 k~~~e~~~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~-~GvflC~~Cs~   58 (145)
                      +++++..+..+..      =-.|..|++|++.-.--+ .-...|..|.+
T Consensus        89 ~~i~~~L~~yI~~------yVlC~~C~spdT~l~k~~r~~~l~C~ACGa  131 (138)
T PRK03988         89 RVINEKIDRYVKE------YVICPECGSPDTKLIKEGRIWVLKCEACGA  131 (138)
T ss_pred             HHHHHHHHHHHHh------cEECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            3444444444443      346999999998776433 33557888854


No 116
>KOG4846|consensus
Probab=30.23  E-value=22  Score=31.52  Aligned_cols=28  Identities=29%  Similarity=0.749  Sum_probs=22.5

Q ss_pred             CCccCCCCCCCCeeecccceeeecccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHR   61 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR   61 (145)
                      --|--||.....+   -|||+-|..|.|.-|
T Consensus       133 ~lCkVCgDkASGf---HYGV~aCEGCKGFFR  160 (538)
T KOG4846|consen  133 SLCKVCGDKASGF---HYGVTACEGCKGFFR  160 (538)
T ss_pred             Eeehhhccccccc---eeceeecccchHHHH
Confidence            4588888877644   799999999999654


No 117
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=29.82  E-value=26  Score=27.44  Aligned_cols=27  Identities=22%  Similarity=0.631  Sum_probs=20.4

Q ss_pred             CccCCCCCC----CCeeecccceeeeccccc
Q psy5674          32 YCVDCDAKG----PRWASWNIGIFLCIRCAG   58 (145)
Q Consensus        32 ~CaDCg~~~----p~w~s~~~GvflC~~Cs~   58 (145)
                      +|.+||.+-    ..|-+-+.-...|.+|..
T Consensus         2 iCIeCg~~v~~Ly~~Ys~~~irLt~C~~C~~   32 (208)
T PF04161_consen    2 ICIECGHPVKSLYRQYSPGNIRLTKCPNCGK   32 (208)
T ss_pred             EeccCCCcchhhhhccCCCcEEEeeccccCC
Confidence            699999984    355555677788888876


No 118
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=29.59  E-value=13  Score=28.71  Aligned_cols=31  Identities=16%  Similarity=0.411  Sum_probs=20.1

Q ss_pred             CCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      -.|..|+..-+.---+++ -|.|..|.+.-..
T Consensus       118 Y~Cp~C~~rytf~eA~~~-~F~Cp~Cg~~L~~  148 (178)
T PRK06266        118 FFCPNCHIRFTFDEAMEY-GFRCPQCGEMLEE  148 (178)
T ss_pred             EECCCCCcEEeHHHHhhc-CCcCCCCCCCCee
Confidence            359999976332222344 5999999886544


No 119
>PF13119 DUF3973:  Domain of unknown function (DUF3973)
Probab=29.51  E-value=20  Score=21.25  Aligned_cols=14  Identities=43%  Similarity=1.158  Sum_probs=11.3

Q ss_pred             eeecccccccccCC
Q psy5674          51 FLCIRCAGIHRNLG   64 (145)
Q Consensus        51 flC~~Cs~iHR~lg   64 (145)
                      |-|+.|+.+|-.-+
T Consensus         2 yYCi~Cs~~h~e~~   15 (41)
T PF13119_consen    2 YYCINCSEIHHEKG   15 (41)
T ss_pred             EEEEEhHHhHHhhc
Confidence            56999999997644


No 120
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=29.34  E-value=23  Score=24.11  Aligned_cols=31  Identities=23%  Similarity=0.442  Sum_probs=22.7

Q ss_pred             CccCCCCCCC---Ceeecccc---eeeeccccccccc
Q psy5674          32 YCVDCDAKGP---RWASWNIG---IFLCIRCAGIHRN   62 (145)
Q Consensus        32 ~CaDCg~~~p---~w~s~~~G---vflC~~Cs~iHR~   62 (145)
                      .|..||.+-|   .+...--|   .|-|..|.++...
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~~~FCC~GC~~V~~~   38 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEERPFCCPGCQAVYQL   38 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCccccccHHHHHHHHH
Confidence            5999999865   33333334   8999999998865


No 121
>KOG4217|consensus
Probab=28.98  E-value=20  Score=32.31  Aligned_cols=30  Identities=20%  Similarity=0.568  Sum_probs=25.6

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeeccccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      ++.+.||-||....   +.-|||--|..|.|.-
T Consensus       267 ~~e~~CAVCgDnAa---CqHYGvRTCEGCKGFF  296 (605)
T KOG4217|consen  267 SAEGLCAVCGDNAA---CQHYGVRTCEGCKGFF  296 (605)
T ss_pred             CccceeeecCChHH---hhhcCccccccchHHH
Confidence            56789999998654   8899999999999954


No 122
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=28.74  E-value=14  Score=27.87  Aligned_cols=30  Identities=17%  Similarity=0.310  Sum_probs=19.5

Q ss_pred             CCccCCCCCCCCeeecccceeeecccccccc
Q psy5674          31 KYCVDCDAKGPRWASWNIGIFLCIRCAGIHR   61 (145)
Q Consensus        31 ~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR   61 (145)
                      =.|..|+..-+.=-.+++ -|.|..|.+.-.
T Consensus       110 Y~Cp~c~~r~tf~eA~~~-~F~Cp~Cg~~L~  139 (158)
T TIGR00373       110 FICPNMCVRFTFNEAMEL-NFTCPRCGAMLD  139 (158)
T ss_pred             EECCCCCcEeeHHHHHHc-CCcCCCCCCEee
Confidence            359999976332223344 499999988643


No 123
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=28.65  E-value=25  Score=25.09  Aligned_cols=32  Identities=16%  Similarity=0.365  Sum_probs=22.6

Q ss_pred             CCCCCCccCCCCCCCCeeecccceeeecccccccc
Q psy5674          27 DDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHR   61 (145)
Q Consensus        27 ~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR   61 (145)
                      .|..-.|.+||...+   ...+..+.|..|.+..-
T Consensus        67 ~p~~~~C~~Cg~~~~---~~~~~~~~CP~Cgs~~~   98 (114)
T PRK03681         67 QEAECWCETCQQYVT---LLTQRVRRCPQCHGDML   98 (114)
T ss_pred             eCcEEEcccCCCeee---cCCccCCcCcCcCCCCc
Confidence            378889999996322   33445578999987653


No 124
>KOG1597|consensus
Probab=28.55  E-value=44  Score=28.20  Aligned_cols=29  Identities=21%  Similarity=0.446  Sum_probs=22.8

Q ss_pred             CccCCCCCCC-Ceeecccceeeeccccccc
Q psy5674          32 YCVDCDAKGP-RWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        32 ~CaDCg~~~p-~w~s~~~GvflC~~Cs~iH   60 (145)
                      .|.||....+ .-.+..-|..+|..|.-+-
T Consensus         2 ~c~~C~~~~~~~V~d~~~gdtvC~~CGlVl   31 (308)
T KOG1597|consen    2 TCPDCKRHPENLVEDHSAGDTVCSECGLVL   31 (308)
T ss_pred             CCCCCCCCCCCeeeeccCCceecccCCeee
Confidence            6999998766 4446678999999998753


No 125
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=28.52  E-value=40  Score=19.64  Aligned_cols=29  Identities=28%  Similarity=0.527  Sum_probs=16.4

Q ss_pred             CCccCCCCCCC---Ceeecccceeeecccccc
Q psy5674          31 KYCVDCDAKGP---RWASWNIGIFLCIRCAGI   59 (145)
Q Consensus        31 ~~CaDCg~~~p---~w~s~~~GvflC~~Cs~i   59 (145)
                      ++|.=||.+..   .-++-+-++++|..|...
T Consensus         2 ~~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~~   33 (41)
T PF06689_consen    2 KRCSFCGRPESEVGRLISGPNGAYICDECVEQ   33 (41)
T ss_dssp             -B-TTT--BTTTSSSEEEES-SEEEEHHHHHH
T ss_pred             CCccCCCCCHHHHhceecCCCCcEECHHHHHH
Confidence            46888998743   334445589999999753


No 126
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=28.07  E-value=20  Score=19.15  Aligned_cols=16  Identities=31%  Similarity=0.692  Sum_probs=9.2

Q ss_pred             cCCCCCCccCCCCCCC
Q psy5674          26 KDDDNKYCVDCDAKGP   41 (145)
Q Consensus        26 ~~p~N~~CaDCg~~~p   41 (145)
                      +.+.+..|.-|+++.|
T Consensus        14 N~~~~~~C~~C~~~rp   29 (30)
T PF00641_consen   14 NPASRSKCVACGAPRP   29 (30)
T ss_dssp             EESSSSB-TTT--BTT
T ss_pred             chHHhhhhhCcCCCCc
Confidence            3466778888888766


No 127
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=27.66  E-value=42  Score=27.87  Aligned_cols=28  Identities=18%  Similarity=0.527  Sum_probs=18.2

Q ss_pred             CccCCCCCCCCeeecccceeeeccccccc
Q psy5674          32 YCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      .|.+||..+-.+ +...|-.+|..|.-+-
T Consensus         3 ~CpeCg~~~~~~-d~~~ge~VC~~CG~Vi   30 (285)
T COG1405           3 SCPECGSTNIIT-DYERGEIVCADCGLVL   30 (285)
T ss_pred             CCCCCCCcccee-eccCCeEEeccCCEEe
Confidence            588888773322 3347888888887643


No 128
>PF01199 Ribosomal_L34e:  Ribosomal protein L34e;  InterPro: IPR008195 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaebacterial ribosomal proteins belong to the L34e family. These include, vertebrate L34, mosquito L31 [], plant L34 [], yeast putative ribosomal protein YIL052c and archaebacterial L34e.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZR_i 3IZS_i 4A19_L 4A1D_L 4A18_L 4A1B_L.
Probab=27.33  E-value=18  Score=25.31  Aligned_cols=29  Identities=34%  Similarity=0.714  Sum_probs=15.6

Q ss_pred             CCCCccCCCCC--C-----C----------Ceeecccceeeecccc
Q psy5674          29 DNKYCVDCDAK--G-----P----------RWASWNIGIFLCIRCA   57 (145)
Q Consensus        29 ~N~~CaDCg~~--~-----p----------~w~s~~~GvflC~~Cs   57 (145)
                      .--.|+|||.+  +     |          .=++=.||-.+|..|-
T Consensus        40 ~~pkC~~cg~~L~Gi~~~rp~~~~rl~k~~k~vsRaYGG~lc~~cv   85 (94)
T PF01199_consen   40 KKPKCGDCGKPLNGIPALRPVELRRLSKRQKTVSRAYGGSLCHKCV   85 (94)
T ss_dssp             T--BSTSSS-BSSSS-SS-SSTTGTS-CHCH--CCTSSSS-HHHHH
T ss_pred             CCCCcCccCCcccccccccHHHHhhcccCCCCCCCCCCccchHHHH
Confidence            33469999985  1     1          1234458888888884


No 129
>PF13462 Thioredoxin_4:  Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A ....
Probab=27.23  E-value=16  Score=26.10  Aligned_cols=28  Identities=21%  Similarity=0.300  Sum_probs=22.3

Q ss_pred             CCCCCCeeecccceeeecccccccccCC
Q psy5674          37 DAKGPRWASWNIGIFLCIRCAGIHRNLG   64 (145)
Q Consensus        37 g~~~p~w~s~~~GvflC~~Cs~iHR~lg   64 (145)
                      |.++.....+-|.-|.|.-|+..|..++
T Consensus         8 G~~~a~~~v~~f~d~~Cp~C~~~~~~~~   35 (162)
T PF13462_consen    8 GNPDAPITVTEFFDFQCPHCAKFHEELE   35 (162)
T ss_dssp             S-TTTSEEEEEEE-TTSHHHHHHHHHHH
T ss_pred             cCCCCCeEEEEEECCCCHhHHHHHHHHh
Confidence            5667778888999999999999998764


No 130
>TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX). A member of the ATP-dependent proteases, ClpX has ATP-dependent chaperone activity and is required for specific ATP-dependent proteolytic activities expressed by ClpPX. The gene is also found to be involved in stress tolerance in Bacillus subtilis and is essential for the efficient acquisition of genes specifying type IA and IB restriction.
Probab=27.19  E-value=30  Score=30.22  Aligned_cols=30  Identities=20%  Similarity=0.607  Sum_probs=20.6

Q ss_pred             CCCccCCCCCCCCeeec--ccceeeecccccc
Q psy5674          30 NKYCVDCDAKGPRWASW--NIGIFLCIRCAGI   59 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~--~~GvflC~~Cs~i   59 (145)
                      +..|.-||.+...--.+  .-|+++|..|..+
T Consensus         7 ~~~c~fc~~~~~~~~~~~~~~~~~ic~~c~~~   38 (413)
T TIGR00382         7 TLYCSFCGKSQDEVRKLIAGPGVYICDECIEL   38 (413)
T ss_pred             CeecCCCCCChhhcccccCCCCCcCCCchHHH
Confidence            44899999874432222  3458999999763


No 131
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=26.85  E-value=94  Score=21.57  Aligned_cols=32  Identities=19%  Similarity=0.542  Sum_probs=24.1

Q ss_pred             CCCCCCccCCCCCCCCeeecccceeeeccccccc
Q psy5674          27 DDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        27 ~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      +..--.|.-||.......  ..||..|..|...-
T Consensus        33 q~a~y~CpfCgk~~vkR~--a~GIW~C~~C~~~~   64 (90)
T PTZ00255         33 QHAKYFCPFCGKHAVKRQ--AVGIWRCKGCKKTV   64 (90)
T ss_pred             HhCCccCCCCCCCceeee--eeEEEEcCCCCCEE
Confidence            356778999998776654  45999999996543


No 132
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=26.55  E-value=99  Score=24.18  Aligned_cols=33  Identities=21%  Similarity=0.543  Sum_probs=21.8

Q ss_pred             CCCccCCCCCCCCeeecc-cceeeecccccccccC
Q psy5674          30 NKYCVDCDAKGPRWASWN-IGIFLCIRCAGIHRNL   63 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~-~GvflC~~Cs~iHR~l   63 (145)
                      =-.|..|+++++.-.--+ .-.+.|..|.. ||..
T Consensus        98 yV~C~~C~~pdT~l~k~~~~~~l~C~aCGa-~~~v  131 (201)
T PRK12336         98 YVICSECGLPDTRLVKEDRVLMLRCDACGA-HRPV  131 (201)
T ss_pred             eEECCCCCCCCcEEEEcCCeEEEEcccCCC-Cccc
Confidence            346999999998776433 22347888844 4443


No 133
>PF04170 NlpE:  NlpE N-terminal domain;  InterPro: IPR007298 This family represents a bacterial outer membrane lipoprotein that is necessary for signalling by the Cpx pathway []. This pathway responds to cell envelope disturbances and increases the expression of periplasmic protein folding and degradation factors. While the molecular function of the NlpE protein is unknown, it may be involved in detecting bacterial adhesion to abiotic surfaces. NlpE from Escherichia coli and Salmonella typhi is also known to confer copper tolerance in copper-sensitive strains of E. coli, and may be involved in copper efflux and delivery of copper to copper-dependent enzymes [].; PDB: 3LHN_A 2Z4I_B 2Z4H_A.
Probab=26.51  E-value=28  Score=23.43  Aligned_cols=16  Identities=38%  Similarity=0.847  Sum_probs=13.4

Q ss_pred             cceeeecccccccccC
Q psy5674          48 IGIFLCIRCAGIHRNL   63 (145)
Q Consensus        48 ~GvflC~~Cs~iHR~l   63 (145)
                      .|++-|-+|.||.-.|
T Consensus         2 ~G~LPCADC~GI~t~L   17 (87)
T PF04170_consen    2 EGTLPCADCPGIKTTL   17 (87)
T ss_dssp             EEEEEETTSSEEEEEE
T ss_pred             ccEeECCCCCCeEEEE
Confidence            4899999999987654


No 134
>KOG3408|consensus
Probab=25.89  E-value=24  Score=26.02  Aligned_cols=44  Identities=34%  Similarity=0.536  Sum_probs=34.8

Q ss_pred             ccceeeeccccc---------ccccCCCccceeeecccCCCCHHHHHHHHhhc
Q psy5674          47 NIGIFLCIRCAG---------IHRNLGVHISRVKSVNLDTWTPEQVVSLQQMG   90 (145)
Q Consensus        47 ~~GvflC~~Cs~---------iHR~lg~~is~Vksl~ld~w~~~~i~~l~~~G   90 (145)
                      -+|-|-|+.|+.         .|..--.|-.|||.|.-...|.++-+..--.|
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~ktK~HKrRvK~l~~~PySQeeAe~A~G~g  106 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKTKVHKRRVKELREVPYSQEEAEAAAGMG  106 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhccHHHHHHHhcccCCccHHHHHHhccCC
Confidence            478999999986         66665667789999998888888888775555


No 135
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=25.79  E-value=27  Score=24.99  Aligned_cols=30  Identities=17%  Similarity=0.323  Sum_probs=20.2

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeeccccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      |.--.|.+||...+   ...+..+.|..|.+..
T Consensus        69 p~~~~C~~Cg~~~~---~~~~~~~~CP~Cgs~~   98 (117)
T PRK00564         69 KVELECKDCSHVFK---PNALDYGVCEKCHSKN   98 (117)
T ss_pred             CCEEEhhhCCCccc---cCCccCCcCcCCCCCc
Confidence            66778999995422   2234555699998754


No 136
>PF07762 DUF1618:  Protein of unknown function (DUF1618);  InterPro: IPR011676 The proteins of this entry are mainly hypothetical proteins expressed by Oryza sativa.
Probab=25.33  E-value=33  Score=24.31  Aligned_cols=15  Identities=27%  Similarity=0.607  Sum_probs=13.2

Q ss_pred             eeecccceeeecccc
Q psy5674          43 WASWNIGIFLCIRCA   57 (145)
Q Consensus        43 w~s~~~GvflC~~Cs   57 (145)
                      ||++..|+++|.--.
T Consensus         1 WVDl~~GIL~CD~~~   15 (131)
T PF07762_consen    1 WVDLWRGILFCDVFD   15 (131)
T ss_pred             CCcCCCCEEEEECCC
Confidence            889999999998775


No 137
>PF04770 ZF-HD_dimer:  ZF-HD protein dimerisation region;  InterPro: IPR006456 The homeodomain (HD) is a 60-amino acid DNA-binding domain found in many transcription factors. HD-containing proteins are found in diverse organisms such as humans, Drosophila, nematode worms, and plants, where they play important roles in development. Zinc-finger-homeodomain (ZF- HD) subfamily proteins have only been identified in plants, and likely play plant specific roles. ZF-HD proteins are expressed predominantly or exclusively in floral tissue, indicating a likely regulatory role during floral development []. The ZF-HD class of homeodomain proteins may also be involved in the photosynthesis-related mesophyll-specific gene expression of phosphoenolpyruvate carboxylase in C4 species [] and in pathogen signaling and plant defense mechanisms [].  These proteins share three domains of high sequence similarity: the homeodomain (II) located at the carboxy-terminus, and two other segments (Ia and Ib) located in the amino-terminal part. These N-terminal domains contain five conserved cysteine residues and at least three conserved histidine residues whose spacing ressembles zinc-binding domains involved in dimerization of transcription factors. Although the two domains contain at least eight potential zinc-binding amino-acids, the unique spacing of the conserved cysteine and histidine residues within domain Ib suggests that both domains form one rather than two zinc finger structures. The two conserved motifs Ia and Ib constitute a dimerization domain which is sufficient for the formation of homo- and heterodimers [].  This entry represents the N-terminal Cysteine/Histidine-rich dimerization domain. The companion ZF-HD homeobox domain is described in IPR006455 from INTERPRO. 
Probab=24.27  E-value=42  Score=21.62  Aligned_cols=29  Identities=28%  Similarity=0.477  Sum_probs=21.2

Q ss_pred             cCCCCCCCC-eeecccceeeecccccccccC
Q psy5674          34 VDCDAKGPR-WASWNIGIFLCIRCAGIHRNL   63 (145)
Q Consensus        34 aDCg~~~p~-w~s~~~GvflC~~Cs~iHR~l   63 (145)
                      .-|+.-.|. +..-+...+.|..| |-||++
T Consensus        23 DGCgEFm~~~g~eg~~~al~CaAC-gCHRnF   52 (60)
T PF04770_consen   23 DGCGEFMPSPGEEGTPEALKCAAC-GCHRNF   52 (60)
T ss_pred             ccccccccCCCCCCCcccceeccc-Ccchhc
Confidence            457776666 55556788899888 788876


No 138
>PTZ00218 40S ribosomal protein S29; Provisional
Probab=24.24  E-value=31  Score=21.75  Aligned_cols=29  Identities=17%  Similarity=0.494  Sum_probs=22.3

Q ss_pred             CCCCCccCCCCCCCCeeecccceeeeccccc
Q psy5674          28 DDNKYCVDCDAKGPRWASWNIGIFLCIRCAG   58 (145)
Q Consensus        28 p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~   58 (145)
                      +|.+.|.-||.+..  +--.||.-+|-.|-.
T Consensus        14 kGsr~C~vCg~~~g--liRkygL~~CRqCFR   42 (54)
T PTZ00218         14 KGSRQCRVCSNRHG--LIRKYGLNVCRQCFR   42 (54)
T ss_pred             CCCCeeecCCCcch--hhhhcCcchhhHHHH
Confidence            67899999998642  234789999998854


No 139
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=23.75  E-value=88  Score=19.42  Aligned_cols=40  Identities=20%  Similarity=0.377  Sum_probs=23.0

Q ss_pred             HHHHHHhcC-C---CC---CCccCCCCCCCCe--eecccceeeeccccc
Q psy5674          19 NLLMQMLKD-D---DN---KYCVDCDAKGPRW--ASWNIGIFLCIRCAG   58 (145)
Q Consensus        19 ~~l~~l~~~-p---~N---~~CaDCg~~~p~w--~s~~~GvflC~~Cs~   58 (145)
                      ++++-|+.. |   .|   -+|..|.+.+-..  .....-.|+|..|..
T Consensus         4 ki~d~L~G~d~~~~~~r~aLIC~~C~~hNGla~~~~~~~i~y~C~~Cg~   52 (54)
T PF10058_consen    4 KILDVLLGDDPTSPSNRYALICSKCFSHNGLAPKEEFEEIQYRCPYCGA   52 (54)
T ss_pred             HHHHHHhCCCCccccCceeEECcccchhhcccccccCCceEEEcCCCCC
Confidence            455555543 3   33   4688888764333  233445778888753


No 140
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=23.60  E-value=75  Score=18.32  Aligned_cols=27  Identities=15%  Similarity=0.619  Sum_probs=18.5

Q ss_pred             CccCCCCCCCCeeecc--------cceeeeccccc
Q psy5674          32 YCVDCDAKGPRWASWN--------IGIFLCIRCAG   58 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~--------~GvflC~~Cs~   58 (145)
                      .|..||.....|..+.        --.++|.+|..
T Consensus         2 ~Cp~C~~~~a~~~q~Q~RsaDE~mT~fy~C~~C~~   36 (40)
T smart00440        2 PCPKCGNREATFFQLQTRSADEPMTVFYVCTKCGH   36 (40)
T ss_pred             cCCCCCCCeEEEEEEcccCCCCCCeEEEEeCCCCC
Confidence            5888998877776432        23568988863


No 141
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=23.35  E-value=39  Score=17.57  Aligned_cols=11  Identities=45%  Similarity=1.147  Sum_probs=6.0

Q ss_pred             CCCCCccCCCC
Q psy5674          28 DDNKYCVDCDA   38 (145)
Q Consensus        28 p~N~~CaDCg~   38 (145)
                      ++.+.|..||+
T Consensus        14 ~~~~fC~~CG~   24 (26)
T PF13248_consen   14 PDAKFCPNCGA   24 (26)
T ss_pred             cccccChhhCC
Confidence            44555666654


No 142
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=23.26  E-value=1.2e+02  Score=23.41  Aligned_cols=34  Identities=12%  Similarity=0.401  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHhcCCCCCCccCCCCCCCCeeecccceeeeccccccccc
Q psy5674          12 QIQDKCQNLLMQMLKDDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIHRN   62 (145)
Q Consensus        12 ~~~e~~~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iHR~   62 (145)
                      ..+..|...++.++..+.+..                 +.+|..|.-+|..
T Consensus       113 ~~Ek~H~~~~~~~Le~~~~~~-----------------~~vC~vCGy~~~g  146 (166)
T COG1592         113 KAEKRHAEMFRGLLERLEEGK-----------------VWVCPVCGYTHEG  146 (166)
T ss_pred             HHHHHHHHHHHHHHHhhhcCC-----------------EEEcCCCCCcccC
Confidence            356677888888888876554                 6677777666654


No 143
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=22.58  E-value=40  Score=21.16  Aligned_cols=23  Identities=26%  Similarity=0.621  Sum_probs=15.5

Q ss_pred             ccCCCCC-CCCeeecccceeeecc
Q psy5674          33 CVDCDAK-GPRWASWNIGIFLCIR   55 (145)
Q Consensus        33 CaDCg~~-~p~w~s~~~GvflC~~   55 (145)
                      |..|+.. ...|+.+.-|-+.|..
T Consensus         1 C~~C~~~~~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    1 CSVCGSTNSNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             -SSSHTCSSSEEEETTTS-EEETT
T ss_pred             CCCCCCcCCceEEeCCCCcccccC
Confidence            6678866 6678877777777775


No 144
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=22.35  E-value=60  Score=18.66  Aligned_cols=27  Identities=22%  Similarity=0.591  Sum_probs=17.6

Q ss_pred             CccCCCCCCCCeeecccc--eeeeccccc
Q psy5674          32 YCVDCDAKGPRWASWNIG--IFLCIRCAG   58 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~G--vflC~~Cs~   58 (145)
                      +|..|++---.|+.++.+  .++|.-|..
T Consensus         4 rC~~C~aylNp~~~~~~~~~~w~C~~C~~   32 (40)
T PF04810_consen    4 RCRRCRAYLNPFCQFDDGGKTWICNFCGT   32 (40)
T ss_dssp             B-TTT--BS-TTSEEETTTTEEEETTT--
T ss_pred             ccCCCCCEECCcceEcCCCCEEECcCCCC
Confidence            688999976668888876  899998864


No 145
>PF11261 IRF-2BP1_2:  Interferon regulatory factor 2-binding protein zinc finger;  InterPro: IPR022750  IRF-2BP1 and IRF-2BP2 are nuclear transcriptional repressor proteins and can inhibit both enhancer-activated and basal transcription. They both contain N-terminal zinc finger and C-terminal RING finger domains [].  This entry represents the N-terminal zinc finger domain of IRF-2BP1 and IRF-2BP2.
Probab=22.34  E-value=22  Score=22.30  Aligned_cols=30  Identities=23%  Similarity=0.537  Sum_probs=24.8

Q ss_pred             CCCccCCCCCCCCeeec-ccceeeecccccc
Q psy5674          30 NKYCVDCDAKGPRWASW-NIGIFLCIRCAGI   59 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~-~~GvflC~~Cs~i   59 (145)
                      -..|.=|.-|.+.|+-+ +|+--||-.|...
T Consensus         3 Rq~CyLCdlPr~PWami~df~EpVCRgCvNy   33 (54)
T PF11261_consen    3 RQQCYLCDLPRMPWAMIWDFSEPVCRGCVNY   33 (54)
T ss_pred             ceeEEeccCCCCchHHHhhccchhhhhhcCc
Confidence            35699999999999965 7999999999654


No 146
>COG2203 FhlA FOG: GAF domain [Signal transduction mechanisms]
Probab=22.12  E-value=1.2e+02  Score=20.29  Aligned_cols=26  Identities=23%  Similarity=0.473  Sum_probs=21.7

Q ss_pred             CCCHHHHHHHHhhccHHHHHHHHhhC
Q psy5674          77 TWTPEQVVSLQQMGNSRARAVYEANI  102 (145)
Q Consensus        77 ~w~~~~i~~l~~~GN~~~n~~~e~~~  102 (145)
                      .|+++++.++..+....+-++-.+.+
T Consensus       142 ~~~~~e~~ll~~la~~~a~ai~~~~~  167 (175)
T COG2203         142 QWSEEELELLEELAEQVAIAIERARL  167 (175)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            69999999999998888887766543


No 147
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=21.88  E-value=44  Score=23.72  Aligned_cols=30  Identities=20%  Similarity=0.419  Sum_probs=20.2

Q ss_pred             CCCCCCccCCCCCCCCeeecccceeeeccccccc
Q psy5674          27 DDDNKYCVDCDAKGPRWASWNIGIFLCIRCAGIH   60 (145)
Q Consensus        27 ~p~N~~CaDCg~~~p~w~s~~~GvflC~~Cs~iH   60 (145)
                      .|..-.|-+||...    .+....+.|..|.+..
T Consensus        67 vp~~~~C~~Cg~~~----~~~~~~~~CP~Cgs~~   96 (113)
T PRK12380         67 KPAQAWCWDCSQVV----EIHQHDAQCPHCHGER   96 (113)
T ss_pred             eCcEEEcccCCCEE----ecCCcCccCcCCCCCC
Confidence            37888999999532    2223445699998753


No 148
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=21.78  E-value=73  Score=23.49  Aligned_cols=30  Identities=17%  Similarity=0.390  Sum_probs=20.7

Q ss_pred             CCCccCCCCCCCCeeecccc-eeeecccccc
Q psy5674          30 NKYCVDCDAKGPRWASWNIG-IFLCIRCAGI   59 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~~G-vflC~~Cs~i   59 (145)
                      =-.|..|++|++.-.--+-. .+.|..|...
T Consensus        97 yVlC~~C~sPdT~l~k~~r~~~l~C~ACGa~  127 (133)
T TIGR00311        97 YVICRECNRPDTRIIKEGRVSLLKCEACGAK  127 (133)
T ss_pred             eEECCCCCCCCcEEEEeCCeEEEecccCCCC
Confidence            34699999999876643322 3588888543


No 149
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=20.77  E-value=67  Score=23.40  Aligned_cols=42  Identities=19%  Similarity=0.429  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHHHHhcCCCCCCccCCCCCCCCeeecc-cceeeecccccc
Q psy5674          12 QIQDKCQNLLMQMLKDDDNKYCVDCDAKGPRWASWN-IGIFLCIRCAGI   59 (145)
Q Consensus        12 ~~~e~~~~~l~~l~~~p~N~~CaDCg~~~p~w~s~~-~GvflC~~Cs~i   59 (145)
                      ++++..+..+..-      -.|..|+++++...--+ .-.+.|..|...
T Consensus        81 ~i~~~L~~fI~~y------VlC~~C~spdT~l~k~~r~~~l~C~aCGa~  123 (125)
T PF01873_consen   81 QIQDLLDKFIKEY------VLCPECGSPDTELIKEGRLIFLKCKACGAS  123 (125)
T ss_dssp             HHHHHHHHHHCHH------SSCTSTSSSSEEEEEETTCCEEEETTTSCE
T ss_pred             HHHHHHHHHHHHE------EEcCCCCCCccEEEEcCCEEEEEecccCCc
Confidence            3444444444332      35999999998776543 444578888654


No 150
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=20.73  E-value=37  Score=19.76  Aligned_cols=27  Identities=19%  Similarity=0.366  Sum_probs=16.3

Q ss_pred             CccCCCCCCCCeeeccc-ceeeeccccc
Q psy5674          32 YCVDCDAKGPRWASWNI-GIFLCIRCAG   58 (145)
Q Consensus        32 ~CaDCg~~~p~w~s~~~-GvflC~~Cs~   58 (145)
                      .|.+||..--.+.+++- ....|-.|.+
T Consensus         7 ~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen    7 RCEECGHEFEVLQSISEDDPVPCPECGS   34 (42)
T ss_pred             EeCCCCCEEEEEEEcCCCCCCcCCCCCC
Confidence            47777766544554443 5557777755


No 151
>smart00336 BBOX B-Box-type zinc finger.
Probab=20.47  E-value=91  Score=17.12  Aligned_cols=32  Identities=22%  Similarity=0.441  Sum_probs=22.3

Q ss_pred             CCCccCCCCCCCCeeecccceeeecccccc-cc
Q psy5674          30 NKYCVDCDAKGPRWASWNIGIFLCIRCAGI-HR   61 (145)
Q Consensus        30 N~~CaDCg~~~p~w~s~~~GvflC~~Cs~i-HR   61 (145)
                      ...|..++.....+.+.+=..++|..|... |+
T Consensus         3 ~~~C~~h~~~~~~~~C~~c~~~iC~~C~~~~H~   35 (42)
T smart00336        3 PPKCDSHGDEPAEFFCEECGALLCRTCDEAEHR   35 (42)
T ss_pred             CCcCCCCCCCceEEECCCCCcccccccChhhcC
Confidence            345777775455566777778999999855 54


No 152
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=20.29  E-value=86  Score=22.93  Aligned_cols=27  Identities=7%  Similarity=0.286  Sum_probs=14.6

Q ss_pred             ceeeeccccccccc-CCCccceeeeccc
Q psy5674          49 GIFLCIRCAGIHRN-LGVHISRVKSVNL   75 (145)
Q Consensus        49 GvflC~~Cs~iHR~-lg~~is~Vksl~l   75 (145)
                      ..+.|..|.+..-. .+-.--+|+++.+
T Consensus       106 ~~~~CP~Cgs~~~~i~~G~el~i~~ie~  133 (135)
T PRK03824        106 AFLKCPKCGSRDFEIVKGRGVYIEEIKI  133 (135)
T ss_pred             cCcCCcCCCCCCcEEecCceEEEEEEEE
Confidence            44679999875422 2212235666554


No 153
>smart00782 PhnA_Zn_Ribbon PhnA Zinc-Ribbon. This protein family includes an uncharacterised member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterised phosphonoacetate hydrolase designated PhnA.
Probab=20.09  E-value=60  Score=19.71  Aligned_cols=29  Identities=24%  Similarity=0.635  Sum_probs=19.6

Q ss_pred             CCCccCCCCCCC--Cee-------ecccceeeeccccc
Q psy5674          30 NKYCVDCDAKGP--RWA-------SWNIGIFLCIRCAG   58 (145)
Q Consensus        30 N~~CaDCg~~~p--~w~-------s~~~GvflC~~Cs~   58 (145)
                      +..|-=||+..+  .|.       +..-.|++|..|..
T Consensus         7 ~~kCELC~a~~~L~vy~Vpp~~~~~~d~~iliC~tC~~   44 (47)
T smart00782        7 ESKCELCGSDSPLVVYAVPPSSDVTADNSVMLCDTCHS   44 (47)
T ss_pred             CCcccCcCCCCCceEEecCCCCCCCccceeeechHHHH
Confidence            444999998642  222       34668999999864


Done!