Diaphorina citri psyllid: psy5679


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MFSFRRSAAAHVTFHNSGGKLSARAALPPRAHLPNLIQAVQMAYLIIEKIDDFKQTIRGRNPVLAYFFKPSCGFCKQLEPKISTVSETTSGVEFVKINVENGGGEIAREFEVQAVPTVIGFRNGDPVDTVVGNADQDVIQTLVSKLSQK
ccccccccccEEEEccccccccccccccccccccccHHHcccEEEEEEcccHHHHHHcccccEEEEECccccccHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHcccccccEEEEEEccCEEcEEEccccHHHHHHHHHHHHcc
********************************LPNLIQAVQMAYLIIEKIDDFKQTIRGRNPVLAYFFKPSCGFCKQLEPKISTVSETTSGVEFVKINVENGGGEIAREFEVQAVPTVIGFRNGDPVDTVVGNADQDVIQTLVSKLS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSFRRSAAAHVTFHNSGGKLSARAALPPRAHLPNLIQAVQMAYLIIEKIDDFKQTIRGRNPVLAYFFKPSCGFCKQLEPKISTVSETTSGVEFVKINVENGGGEIAREFEVQAVPTVIGFRNGDPVDTVVGNADQDVIQTLVSKLSQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thioredoxin Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.confidentO83889
Thioredoxin Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.confidentQ9PJK3
Thioredoxin Component of the thioredoxin-thioredoxin reductase system. Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions.confidentQ4UNK3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0070013 [CC]intracellular organelle lumenprobableGO:0005575, GO:0043233, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0043229, GO:0005623, GO:0044424, GO:0043226, GO:0044422
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009570 [CC]chloroplast stromaprobableGO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0015035 [MF]protein disulfide oxidoreductase activityprobableGO:0003824, GO:0016491, GO:0003674, GO:0016667, GO:0015036
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016671 [MF]oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptorprobableGO:0003824, GO:0003674, GO:0016667, GO:0016491
GO:0034614 [BP]cellular response to reactive oxygen speciesprobableGO:1901700, GO:1901701, GO:0051716, GO:0070887, GO:0050896, GO:0009987, GO:0000302, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0042221, GO:0034599, GO:0006979, GO:0044699
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0045454 [BP]cell redox homeostasisprobableGO:0019725, GO:0009987, GO:0050794, GO:0042592, GO:0044763, GO:0008150, GO:0065007, GO:0065008, GO:0050789, GO:0044699
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043085 [BP]positive regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 43-149
View the alignment between query and template
View the model in PyMOL