Query         psy5732
Match_columns 454
No_of_seqs    55 out of 57
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 16:36:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5732.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5732hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03185 CaKB:  Calcium-activat  97.0 0.00019 4.1E-09   68.3   0.0   80  316-404    97-187 (201)
  2 PF03185 CaKB:  Calcium-activat  87.8    0.16 3.5E-06   48.8   0.0   85   15-110    10-99  (201)
  3 smart00564 PQQ beta-propeller   39.4      23  0.0005   23.2   1.8   28  220-247     3-32  (33)
  4 PF07255 Benyvirus_14KDa:  Beny  36.0      21 0.00046   32.3   1.5   28   72-104    21-50  (123)
  5 PF15102 TMEM154:  TMEM154 prot  33.6      27 0.00058   32.9   1.8   28  381-408    54-84  (146)
  6 PRK10040 hypothetical protein;  27.6      41 0.00089   26.9   1.7   26  171-197    20-45  (52)
  7 PHA02954 EEV membrane glycopro  25.7      16 0.00035   37.5  -1.1   29  376-404   273-301 (317)
  8 PF04677 CwfJ_C_1:  Protein sim  21.3      82  0.0018   28.0   2.6   30  206-235    14-43  (121)
  9 PF00918 Gastrin:  Gastrin/chol  21.1      58  0.0012   29.1   1.6   16   24-39      3-18  (116)
 10 PF15050 SCIMP:  SCIMP protein   19.3      13 0.00028   34.4  -2.9   39  376-414     2-40  (133)

No 1  
>PF03185 CaKB:  Calcium-activated potassium channel, beta subunit;  InterPro: IPR003930 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Ca2+-activated K+ channels are a diverse group of channels that are activated by an increase in intracellular Ca2+ concentration. They are found in the majority of nerve cells, where they modulate cell excitability and action potential. Three types of Ca2+-activated K+ channel have been characterised, termed small-conductance (SK), intermediate conductance (IK) and large conductance (BK) respectively []. BK channels (also referred to as maxi-K channels) are widely expressed in the body, being found in glandular tissue, smooth and skeletal muscle, as well as in neural tissues. They have been demonstrated to regulate arteriolar and airway diameter, and also neurotransmitter release. Each channel complex is thought to be composed of 2 types of subunit: the pore- forming (alpha) subunits and smaller accessory (beta) subunits.  The beta subunit (which is thought to possess 2 TM domains) increases the Ca2+ sensitivity of the BK channel []. It does this by enhancing the time spent by the channel in burst-like open states. However, it has little effect on the durations of closed intervals between bursts, or on the numbers of open and closed states entered during gating []. ; GO: 0015269 calcium-activated potassium channel activity, 0006813 potassium ion transport, 0016020 membrane; PDB: 1JO6_A.
Probab=96.96  E-value=0.00019  Score=68.32  Aligned_cols=80  Identities=29%  Similarity=0.546  Sum_probs=0.0

Q ss_pred             eeEeeccEEEEeccCCcCCCh---------hhHHHHHHHhcCC-CCCCCCCccceeeeeCCCC-ceEEEeechhhhHHhh
Q psy5732         316 LLLANESRLLINLEGCVNTLR---------DECKEFLREFGKD-GTDHNARARFPCFYSEKIP-GTVIARFNLSETYREF  384 (454)
Q Consensus       316 Lti~nearLlINleGCGYpp~---------veCk~F~~~YG~d-G~d~na~arFPCYYSr~~p-~~VVaryd~~~t~~~l  384 (454)
                      +..+||..+..|-| |-|.|.         .+=.+|.+.||.. |      ..|||||+..++ +-||-+-..  +...+
T Consensus        97 ~L~~~E~~l~~n~k-CsY~P~C~~d~~~~~~~V~~~~~~~~~~~g------q~f~Cfy~P~~~~~~Vil~r~y--~~~~~  167 (201)
T PF03185_consen   97 LLHHDEETLDSNPK-CSYIPKCHRDRQDNRAEVEDFQENFGQQNG------QTFPCFYDPDNQPEDVILRRKY--DPSVL  167 (201)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             EEEEchHhhccCCc-ceecCcccccHHHHHHHHHHHHHHhhhccC------cceeeeecCCCCcceEEEEEec--CHhHH
Confidence            44556666667777 999872         2234688888887 5      899999999974 566644333  23468


Q ss_pred             hheeecchhhHHHHHhheee
Q psy5732         385 MIGFFVPCILLIVSCLTLIL  404 (454)
Q Consensus       385 i~a~~VP~vlFviS~i~L~~  404 (454)
                      +++|.-|.++|+.+++...+
T Consensus       168 fhslfWP~l~lvgG~liv~m  187 (201)
T PF03185_consen  168 FHSLFWPSLMLVGGVLIVAM  187 (201)
T ss_dssp             --------------------
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            99999999999876554433


No 2  
>PF03185 CaKB:  Calcium-activated potassium channel, beta subunit;  InterPro: IPR003930 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Ca2+-activated K+ channels are a diverse group of channels that are activated by an increase in intracellular Ca2+ concentration. They are found in the majority of nerve cells, where they modulate cell excitability and action potential. Three types of Ca2+-activated K+ channel have been characterised, termed small-conductance (SK), intermediate conductance (IK) and large conductance (BK) respectively []. BK channels (also referred to as maxi-K channels) are widely expressed in the body, being found in glandular tissue, smooth and skeletal muscle, as well as in neural tissues. They have been demonstrated to regulate arteriolar and airway diameter, and also neurotransmitter release. Each channel complex is thought to be composed of 2 types of subunit: the pore- forming (alpha) subunits and smaller accessory (beta) subunits.  The beta subunit (which is thought to possess 2 TM domains) increases the Ca2+ sensitivity of the BK channel []. It does this by enhancing the time spent by the channel in burst-like open states. However, it has little effect on the durations of closed intervals between bursts, or on the numbers of open and closed states entered during gating []. ; GO: 0015269 calcium-activated potassium channel activity, 0006813 potassium ion transport, 0016020 membrane; PDB: 1JO6_A.
Probab=87.79  E-value=0.16  Score=48.78  Aligned_cols=85  Identities=22%  Similarity=0.532  Sum_probs=0.5

Q ss_pred             CCCCcceeeeEeeehhhHHHHhhheeee-eeeEeechhhhhhcCcccCCceeEeecccccccCcccc----ccCCcccCC
Q psy5732          15 PPQDQKICGTICICQMTAVLSTVALVYL-TVAIYMPYMRAVQSGIDTSPVMCTTTRAVIIETCTWGS----CGEWCLSKT   89 (454)
Q Consensus        15 P~Qd~rICg~IC~cQlt~v~S~va~vyL-tvaiy~Ps~~a~~~~~~e~PvmC~T~~~~~~~nC~W~S----C~EwClsk~   89 (454)
                      .-+|+.|+=.     ++++.++|..+|+ ...+.-|++....    .++.-||+..+.-.+.  |-+    ||--|-...
T Consensus        10 ~gedrai~lg-----~~m~~~svlm~~vlGitiv~P~l~s~~----~~et~Ctvl~s~i~~~--~v~Cs~~cg~~c~~~s   78 (201)
T PF03185_consen   10 AGEDRAILLG-----FAMMICSVLMLFVLGITIVKPYLKSLW----FEETNCTVLSSHIVGE--WVDCSFSCGSDCRGVS   78 (201)
T ss_dssp             -S------------------------------------------------------------------------------
T ss_pred             ccchHHHHHH-----HHHHHHHHHHHHHHHHhccchhhhhcc----cccceEEEEEEEeecc--cccccccCCCCCCCcC
Confidence            4567777644     3444444444444 3333338775433    5788999999964433  664    455554456


Q ss_pred             CccccEEEEEEeecCceeeEe
Q psy5732          90 SGACAQIYVSLRHNGSNLLFV  110 (454)
Q Consensus        90 sg~C~qI~v~~r~NGs~l~l~  110 (454)
                      .|.|-||+|++-..|..-+|+
T Consensus        79 ~yPCLqV~Vn~t~sg~~a~L~   99 (201)
T PF03185_consen   79 KYPCLQVFVNYTHSGQTALLH   99 (201)
T ss_dssp             ---------------------
T ss_pred             CCCceEEEEEecCCCceEEEE
Confidence            789999999998877766665


No 3  
>smart00564 PQQ beta-propeller repeat. Beta-propeller repeat occurring in enzymes with pyrrolo-quinoline quinone (PQQ) as cofactor, in Ire1p-like Ser/Thr kinases, and in prokaryotic dehydrogenases.
Probab=39.43  E-value=23  Score=23.17  Aligned_cols=28  Identities=32%  Similarity=0.512  Sum_probs=19.4

Q ss_pred             EeeCCeeeeecchhhh--hccccccccccc
Q psy5732         220 VLSGDRVYLSQCQKAV--LLNNTEQEIWTE  247 (454)
Q Consensus       220 l~~gD~v~~~~C~~av--~~~~~~~eiW~e  247 (454)
                      +..++.||.+.-++.+  .+.++++++|+-
T Consensus         3 ~~~~~~v~~~~~~g~l~a~d~~~G~~~W~~   32 (33)
T smart00564        3 VLSDGTVYVGSTDGTLYALDAKTGEILWTY   32 (33)
T ss_pred             EEECCEEEEEcCCCEEEEEEcccCcEEEEc
Confidence            3455577877766643  777788888864


No 4  
>PF07255 Benyvirus_14KDa:  Benyvirus 14KDa protein;  InterPro: IPR009884 This family consists of several Benyvirus specific 14 kDa proteins of around 125 residues in length. Members of this family contain 9 conserved cysteine residues. The function of this family is unknown.
Probab=35.99  E-value=21  Score=32.32  Aligned_cols=28  Identities=36%  Similarity=0.606  Sum_probs=20.5

Q ss_pred             ccccCcccc--ccCCcccCCCccccEEEEEEeecC
Q psy5732          72 IIETCTWGS--CGEWCLSKTSGACAQIYVSLRHNG  104 (454)
Q Consensus        72 ~~~nC~W~S--C~EwClsk~sg~C~qI~v~~r~NG  104 (454)
                      ..+.|+--|  |+||||-.     .+.||+||+-|
T Consensus        21 sv~~~~~FSiK~~~W~LFT-----~~V~V~YR~~~   50 (123)
T PF07255_consen   21 SVEGCERFSIKFSEWKLFT-----TAVYVEYRQLG   50 (123)
T ss_pred             ccCCeEEEEEecCCEEEEe-----eEEEEEEeccC
Confidence            345666544  99999644     58999999874


No 5  
>PF15102 TMEM154:  TMEM154 protein family
Probab=33.57  E-value=27  Score=32.85  Aligned_cols=28  Identities=25%  Similarity=0.597  Sum_probs=19.1

Q ss_pred             HHhhhheeecchhhH---HHHHhheeeEEEE
Q psy5732         381 YREFMIGFFVPCILL---IVSCLTLILCQRT  408 (454)
Q Consensus       381 ~~~li~a~~VP~vlF---viS~i~L~~~~~~  408 (454)
                      -.+|++..+||.+|+   +++++.|++.+|.
T Consensus        54 q~efiLmIlIP~VLLvlLLl~vV~lv~~~kR   84 (146)
T PF15102_consen   54 QLEFILMILIPLVLLVLLLLSVVCLVIYYKR   84 (146)
T ss_pred             CcceEEEEeHHHHHHHHHHHHHHHheeEEee
Confidence            345588899996666   4566677666654


No 6  
>PRK10040 hypothetical protein; Provisional
Probab=27.62  E-value=41  Score=26.95  Aligned_cols=26  Identities=31%  Similarity=0.611  Sum_probs=21.2

Q ss_pred             ccCCCCCceeeeeccceeeecCceeee
Q psy5732         171 KCSGRRGKINCIAMHGLQNCVRGTCER  197 (454)
Q Consensus       171 kcs~~rgki~c~~lnG~f~C~~~~C~k  197 (454)
                      -|||++|-|.--+ .|.|.|+.|.=.+
T Consensus        20 PCSG~KGGis~C~-g~~FvCnDGSiS~   45 (52)
T PRK10040         20 PCSGKKGGISHCT-GGKFVCNDGSISA   45 (52)
T ss_pred             CCCCCCCCccccc-CCEEEeCCCchhh
Confidence            4999999998555 9999999886443


No 7  
>PHA02954 EEV membrane glycoprotein; Provisional
Probab=25.69  E-value=16  Score=37.51  Aligned_cols=29  Identities=17%  Similarity=0.498  Sum_probs=25.6

Q ss_pred             chhhhHHhhhheeecchhhHHHHHhheee
Q psy5732         376 NLSETYREFMIGFFVPCILLIVSCLTLIL  404 (454)
Q Consensus       376 d~~~t~~~li~a~~VP~vlFviS~i~L~~  404 (454)
                      +++.+|..+|+|+.|-.|+|+||+|+|..
T Consensus       273 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  301 (317)
T PHA02954        273 SLEATYHIIIVALTIMGVIFLISVIVLVC  301 (317)
T ss_pred             hhhceeeEeeeehhhhHHHHhheeeEEEE
Confidence            46788889999999999999999998854


No 8  
>PF04677 CwfJ_C_1:  Protein similar to CwfJ C-terminus 1;  InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues. Cwf19 is part of the Cdc5p complex involved in mRNA splicing []. This domain is found in association with IPR006767 from INTERPRO, which is generally C-terminal and adjacent to this domain. 
Probab=21.27  E-value=82  Score=27.97  Aligned_cols=30  Identities=30%  Similarity=0.538  Sum_probs=25.4

Q ss_pred             cccCCCCCccceEEEeeCCeeeeecchhhh
Q psy5732         206 RRCVDIPTRNKNVIVLSGDRVYLSQCQKAV  235 (454)
Q Consensus       206 R~C~dI~t~~~Nv~l~~gD~v~~~~C~~av  235 (454)
                      ..|-+-|...|..||.-|+++||+--.+.+
T Consensus        14 ~fCl~n~~~~khliisiG~~~YLalpkg~L   43 (121)
T PF04677_consen   14 WFCLSNPNVEKHLIISIGDEVYLALPKGPL   43 (121)
T ss_pred             CCccCCCCccceEEEEEcCcEEEEeCCCCc
Confidence            368888888999999999999998777654


No 9  
>PF00918 Gastrin:  Gastrin/cholecystokinin family;  InterPro: IPR001651 Gastrin and cholecystokinin (CCK) are structurally and functionally related peptide hormones that function as hormonal regulators of various digestive processes and feeding behaviors. They are known to induce gastric secretion, stimulate pancreatic secretion, increase blood circulation and water secretion in the stomach and intestine, and stimulate smooth muscle contraction. Originally found in the gut, these hormones have since been shown to be present in various parts of the nervous system. Like many other active peptides they are synthesized as larger protein precursors that are enzymatically converted to their mature forms. They are found in several molecular forms due to tissue-specific post-translational processing. The biological activity of gastrin and CCK is associated with the last five C-terminal residues. One or two positions downstream, there is a conserved sulphated tyrosine residue. The amphibian caerulein skin peptide, the cockroach leukosulphakinin I and II (LSK) peptides, Drosophila melanogaster (Fruit fly) putative CCK-homologs Drosulphakinins I and II, cionin, a Gallus gallus (Chicken) gastrin/cholecystokinin-like peptide and cionin, a neuropeptide from the protochordate Ciona intestinalis belong to the same family.; GO: 0005179 hormone activity, 0005576 extracellular region
Probab=21.08  E-value=58  Score=29.09  Aligned_cols=16  Identities=56%  Similarity=0.978  Sum_probs=13.4

Q ss_pred             eEeeehhhHHHHhhhe
Q psy5732          24 TICICQMTAVLSTVAL   39 (454)
Q Consensus        24 ~IC~cQlt~v~S~va~   39 (454)
                      .||+|-|++|||+.++
T Consensus         3 gicvcvLlavLs~~~l   18 (116)
T PF00918_consen    3 GICVCVLLAVLSTSCL   18 (116)
T ss_pred             cEEeeHHHHHHHHhhc
Confidence            5899999999998654


No 10 
>PF15050 SCIMP:  SCIMP protein
Probab=19.27  E-value=13  Score=34.43  Aligned_cols=39  Identities=5%  Similarity=0.177  Sum_probs=33.6

Q ss_pred             chhhhHHhhhheeecchhhHHHHHhheeeEEEEeEEcCC
Q psy5732         376 NLSETYREFMIGFFVPCILLIVSCLTLILCQRTVEVGDD  414 (454)
Q Consensus       376 d~~~t~~~li~a~~VP~vlFviS~i~L~~~~~~V~VGdD  414 (454)
                      |||....-||+|++|=+|..++++|+.|+|.+..+-|-.
T Consensus         2 ~WWr~nFWiiLAVaII~vS~~lglIlyCvcR~~lRqGkk   40 (133)
T PF15050_consen    2 SWWRDNFWIILAVAIILVSVVLGLILYCVCRWQLRQGKK   40 (133)
T ss_pred             chHHhchHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
Confidence            789888999999999999999999999999876666653


Done!