BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy5746
         (292 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1LWH|A Chain A, Crystal Structure Of T. Maritima
           4-Alpha-Glucanotransferase
 pdb|1LWH|B Chain B, Crystal Structure Of T. Maritima
           4-Alpha-Glucanotransferase
 pdb|1LWJ|A Chain A, Crystal Structure Of T. Maritima 4-Alpha-
           GlucanotransferaseACARBOSE COMPLEX
 pdb|1LWJ|B Chain B, Crystal Structure Of T. Maritima 4-Alpha-
           GlucanotransferaseACARBOSE COMPLEX
          Length = 441

 Score = 30.0 bits (66), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%), Gaps = 5/33 (15%)

Query: 145 RLYDN-----LFELLSYEKIIFNELQMKPYRTD 172
           RLYD+     +F  LS E+++F  ++MKPY+T+
Sbjct: 407 RLYDDQHSLKVFHNLSGEEVVFEGVKMKPYKTE 439


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.134    0.401 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,722,659
Number of Sequences: 62578
Number of extensions: 276382
Number of successful extensions: 598
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 596
Number of HSP's gapped (non-prelim): 4
length of query: 292
length of database: 14,973,337
effective HSP length: 98
effective length of query: 194
effective length of database: 8,840,693
effective search space: 1715094442
effective search space used: 1715094442
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)