Query         psy5791
Match_columns 81
No_of_seqs    40 out of 42
Neff          3.2 
Searched_HMMs 46136
Date          Fri Aug 16 18:04:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5791.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5791hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4512|consensus               99.4 5.2E-14 1.1E-18  117.5   2.7   54   26-80    349-402 (625)
  2 KOG4512|consensus               98.9 1.2E-10 2.6E-15   97.6  -0.1   33    2-34      4-36  (625)
  3 PF10156 Med17:  Subunit 17 of   93.0   0.029 6.2E-07   45.2   0.0   34    3-37     32-65  (467)
  4 PF08141 SspH:  Small acid-solu  31.3      31 0.00068   21.4   1.3   17   15-31     15-31  (58)
  5 PF15507 DUF4649:  Domain of un  29.1      42 0.00092   21.9   1.7   19   12-30     37-56  (72)
  6 PF08153 NGP1NT:  NGP1NT (NUC09  29.0      40 0.00086   24.1   1.7   49   28-76     73-124 (130)
  7 PRK01625 sspH acid-soluble spo  28.3      42 0.00091   21.1   1.5   18   14-31     14-31  (59)
  8 PF01021 TYA:  TYA transposon p  27.0      42 0.00091   23.2   1.5   26   39-64     50-78  (98)
  9 PRK03174 sspH acid-soluble spo  26.8      46 0.00099   20.9   1.5   17   15-31     15-31  (59)
 10 KOG1859|consensus               26.7      59  0.0013   30.3   2.7   45   17-67    313-359 (1096)
 11 TIGR02861 SASP_H small acid-so  24.3      55  0.0012   20.3   1.5   17   15-31     15-31  (58)
 12 KOG0846|consensus               24.0      71  0.0015   25.7   2.4   72    4-77    149-238 (274)
 13 PF14851 FAM176:  FAM176 family  23.5      11 0.00024   27.4  -2.0   25   12-36    129-153 (153)
 14 COG1117 PstB ABC-type phosphat  23.2      73  0.0016   25.3   2.3   35   16-51     67-101 (253)
 15 PF07550 DUF1533:  Protein of u  22.2      47   0.001   20.0   0.9   13   13-25      6-18  (65)
 16 PF06799 DUF1230:  Protein of u  21.6      40 0.00088   24.4   0.6   20   19-39    106-125 (144)

No 1  
>KOG4512|consensus
Probab=99.43  E-value=5.2e-14  Score=117.48  Aligned_cols=54  Identities=24%  Similarity=0.236  Sum_probs=48.4

Q ss_pred             eecCcchhhhhhcCCCCCCCCCCCCCCCCCccccccCCCccChHHHHHhhhhccC
Q psy5791          26 YQLSDNTFMVHHKNTHHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTKSEIL   80 (81)
Q Consensus        26 y~~p~~lrE~H~qn~s~~~PhPasaP~G~kK~R~lAGP~a~dr~ei~~m~kte~L   80 (81)
                      |..-+-+||||++++|+++|||+|||||+||++ ++||+|+|+++|++|+.++|+
T Consensus       349 h~lHll~refh~~ss~~m~phpaSapfg~K~~~-l~gpma~d~n~l~~~~~s~g~  402 (625)
T KOG4512|consen  349 HMLHLLRREFHDFSSSIMKPHPASAPFGAKSCK-LEGPMAEDQNRLKKTLFSFGK  402 (625)
T ss_pred             HHHHHHHHHHHhhccccCCCCCccccccchhhh-ccCcchhhHHHHHHHHHHHHH
Confidence            344456899999999999999999999977777 999999999999999999875


No 2  
>KOG4512|consensus
Probab=98.95  E-value=1.2e-10  Score=97.62  Aligned_cols=33  Identities=30%  Similarity=0.534  Sum_probs=31.3

Q ss_pred             ceeeeeecchhceeeeeecCceeeeecCcchhh
Q psy5791           2 SVNISVEAPVENIIQEISYDGQEIYQLSDNTFM   34 (81)
Q Consensus         2 ~v~isiE~~~e~~vqEi~~dG~E~y~~p~~lrE   34 (81)
                      |||||||+.||+||.||++||+|+|+||+++-|
T Consensus         4 av~isiesace~qv~evg~DGtE~y~Pp~~~Se   36 (625)
T KOG4512|consen    4 AVRISIESACEKQVHEVGEDGTEVYEPPEPESE   36 (625)
T ss_pred             ceeeehhhHHHHHHHHHccCCceeecCCCccch
Confidence            699999999999999999999999999998765


No 3  
>PF10156 Med17:  Subunit 17 of Mediator complex;  InterPro: IPR019313 The Mediator complex is a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. The Mediator complex, having a compact conformation in its free form, is recruited to promoters by direct interactions with regulatory proteins and serves for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. On recruitment the Mediator complex unfolds to an extended conformation and partially surrounds RNA polymerase II, specifically interacting with the unphosphorylated form of the C-terminal domain (CTD) of RNA polymerase II. The Mediator complex dissociates from the RNA polymerase II holoenzyme and stays at the promoter when transcriptional elongation begins.  The Mediator complex is composed of at least 31 subunits: MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11.  The subunits form at least three structurally distinct submodules. The head and the middle modules interact directly with RNA polymerase II, whereas the elongated tail module interacts with gene-specific regulatory proteins. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation.   The head module contains: MED6, MED8, MED11, SRB4/MED17, SRB5/MED18, ROX3/MED19, SRB2/MED20 and SRB6/MED22.  The middle module contains: MED1, MED4, NUT1/MED5, MED7, CSE2/MED9, NUT2/MED10, SRB7/MED21 and SOH1/MED31. CSE2/MED9 interacts directly with MED4.  The tail module contains: MED2, PGD1/MED3, RGR1/MED14, GAL11/MED15 and SIN4/MED16.  The CDK8 module contains: MED12, MED13, CCNC and CDK8.   Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP.  This entry represents subunit Med17 of the Mediator complex. The Med17 subunit is located within the head domain and is essential for cell viability to the extent that a mutant strain of Saccharomyces cerevisiae (Baker's yeast) lacking it shows all RNA polymerase II-dependent transcription ceasing at non-permissive temperatures.; GO: 0001104 RNA polymerase II transcription cofactor activity, 0006357 regulation of transcription from RNA polymerase II promoter, 0016592 mediator complex; PDB: 3RJ1_B.
Probab=92.96  E-value=0.029  Score=45.24  Aligned_cols=34  Identities=21%  Similarity=0.017  Sum_probs=0.0

Q ss_pred             eeeeeecchhceeeeeecCceeeeecCcchhhhhh
Q psy5791           3 VNISVEAPVENIIQEISYDGQEIYQLSDNTFMVHH   37 (81)
Q Consensus         3 v~isiE~~~e~~vqEi~~dG~E~y~~p~~lrE~H~   37 (81)
                      .+++||++++.++||+++ |.+.|+.+++|++-=.
T Consensus        32 ~~~~l~~~i~ri~~Erg~-~~f~~lte~sL~~ei~   65 (467)
T PF10156_consen   32 DPLSLEELIERINQERGP-GSFRDLTEESLQEEIA   65 (467)
T ss_dssp             -----------------------------------
T ss_pred             CCCcHHHHHHHHHhCcCC-CCcccCCHHHHHHHHH
Confidence            368999999999999999 9999999999987543


No 4  
>PF08141 SspH:  Small acid-soluble spore protein H family;  InterPro: IPR012610 This family consists of the small acid-soluble spore proteins (SASP) of the H type (sspH). SspH are unique to spores of Bacillus subtilis and are expressed only in the forespore compartment during sporulation of this organism. The sspH genes are monocistronic and are recognised by the forespore-specific sigma factor for RNA polymerase - sigma-G. The specific role of this protein is unclear but is thought to play a role in sporulation under conditions different from that of the common laboratory tests of spore properties [].; GO: 0030436 asexual sporulation, 0042601 endospore-forming forespore
Probab=31.25  E-value=31  Score=21.39  Aligned_cols=17  Identities=18%  Similarity=0.491  Sum_probs=14.0

Q ss_pred             eeeeecCceeeeecCcc
Q psy5791          15 IQEISYDGQEIYQLSDN   31 (81)
Q Consensus        15 vqEi~~dG~E~y~~p~~   31 (81)
                      .-+|.|+|+.+|+.-.+
T Consensus        15 ~i~V~y~G~pV~Ie~vd   31 (58)
T PF08141_consen   15 MIEVTYNGVPVWIEHVD   31 (58)
T ss_pred             eEEEEECCEEEEEEEEc
Confidence            34799999999998664


No 5  
>PF15507 DUF4649:  Domain of unknown function (DUF4649)
Probab=29.11  E-value=42  Score=21.95  Aligned_cols=19  Identities=26%  Similarity=0.541  Sum_probs=15.8

Q ss_pred             hceeeeeecCceee-eecCc
Q psy5791          12 ENIIQEISYDGQEI-YQLSD   30 (81)
Q Consensus        12 e~~vqEi~~dG~E~-y~~p~   30 (81)
                      .-.|.+|.+||+++ |++..
T Consensus        37 ~~~V~svt~~G~~ldy~G~~   56 (72)
T PF15507_consen   37 YYPVTSVTYNGQDLDYQGTY   56 (72)
T ss_pred             ceEEEEEEECCEEeccccch
Confidence            34799999999999 88764


No 6  
>PF08153 NGP1NT:  NGP1NT (NUC091) domain;  InterPro: IPR012971 This N-terminal domain is found in a subfamily of hypothetical nucleolar GTP-binding proteins similar to human NGP1 [].
Probab=29.03  E-value=40  Score=24.12  Aligned_cols=49  Identities=16%  Similarity=0.139  Sum_probs=34.2

Q ss_pred             cCcchhhhh--hcC-CCCCCCCCCCCCCCCCccccccCCCccChHHHHHhhh
Q psy5791          28 LSDNTFMVH--HKN-THHPFPHPSSGPIGPSKRRCIAGPTGADRYELLELTK   76 (81)
Q Consensus        28 ~p~~lrE~H--~qn-~s~~~PhPasaP~G~kK~R~lAGP~a~dr~ei~~m~k   76 (81)
                      .|.||.+=.  ++. .+..---|=.-+||+|+.|.-.--.+.|..+|++...
T Consensus        73 LPmsLL~d~~~k~~~~~il~te~F~~tFGpKaqRKRpkL~~~~~eeLa~~a~  124 (130)
T PF08153_consen   73 LPMSLLQDSGTKQKRVHILETEPFEDTFGPKAQRKRPKLSVSSLEELAKKAE  124 (130)
T ss_pred             CCHHHhcccccccCCcceeecCCHHHHhCCcccccCccccccCHHHHHHHHH
Confidence            477777655  222 3343333666699999998778888999999987644


No 7  
>PRK01625 sspH acid-soluble spore protein H; Provisional
Probab=28.27  E-value=42  Score=21.05  Aligned_cols=18  Identities=17%  Similarity=0.372  Sum_probs=14.5

Q ss_pred             eeeeeecCceeeeecCcc
Q psy5791          14 IIQEISYDGQEIYQLSDN   31 (81)
Q Consensus        14 ~vqEi~~dG~E~y~~p~~   31 (81)
                      ..-+|.|+|+..|+.-.+
T Consensus        14 ~~i~V~Y~G~pV~Iq~vd   31 (59)
T PRK01625         14 SRIDVTYEGVPVWIESCD   31 (59)
T ss_pred             cceEEEECCEEEEEEEEc
Confidence            345899999999998654


No 8  
>PF01021 TYA:  TYA transposon protein;  InterPro: IPR015820 Ty are yeast transposons. A 5.7kb transcript codes for p3 a fusion protein of TYA and TYB. The TYA protein is analogous to the gag protein of retroviruses. This signature defines TYA, found at the N terminus of the gag and gag-pol polyproteins of approximately 440 amino acids and 1755 amino acids in length respectively. Yeast retrotransposon Ty1 produces its proteins as precursors that are subsequently cleaved by an aspartic protease encoded by the element. Cleavage of the gag and gag-Pol polyprotein precursors is a critical step in proliferation of retroviruses and retroelements. These cleavage events are essential for transposition as they release the active reverse transcriptase and integrase and they modify the structure of the virus-like particles in a way that is analogous to the morphological changes that occur during retrovirus core maturation [, , ].; GO: 0003723 RNA binding, 0005737 cytoplasm
Probab=27.03  E-value=42  Score=23.23  Aligned_cols=26  Identities=42%  Similarity=0.898  Sum_probs=17.1

Q ss_pred             CCCCCCCCCCCCCC---CCCccccccCCC
Q psy5791          39 NTHHPFPHPSSGPI---GPSKRRCIAGPT   64 (81)
Q Consensus        39 n~s~~~PhPasaP~---G~kK~R~lAGP~   64 (81)
                      |-||++|+|++.|.   |+--..+++.|+
T Consensus        50 N~hhasPq~A~vp~pqng~y~Q~~MMt~~   78 (98)
T PF01021_consen   50 NHHHASPQPASVPPPQNGPYSQQCMMTPN   78 (98)
T ss_pred             CCCcCCCCcccCCCCCCCccccccccccc
Confidence            45788999999875   444444455554


No 9  
>PRK03174 sspH acid-soluble spore protein H; Provisional
Probab=26.81  E-value=46  Score=20.87  Aligned_cols=17  Identities=24%  Similarity=0.585  Sum_probs=14.0

Q ss_pred             eeeeecCceeeeecCcc
Q psy5791          15 IQEISYDGQEIYQLSDN   31 (81)
Q Consensus        15 vqEi~~dG~E~y~~p~~   31 (81)
                      .-+|.|+|...|+.-.+
T Consensus        15 ~i~VtY~G~pV~Ie~vd   31 (59)
T PRK03174         15 MANVTYNGVPIYIQHVD   31 (59)
T ss_pred             ceEEEECCEEEEEEEEc
Confidence            45789999999998654


No 10 
>KOG1859|consensus
Probab=26.70  E-value=59  Score=30.33  Aligned_cols=45  Identities=16%  Similarity=0.186  Sum_probs=36.6

Q ss_pred             eeecCceeeeecCcchhhhhhcC--CCCCCCCCCCCCCCCCccccccCCCccC
Q psy5791          17 EISYDGQEIYQLSDNTFMVHHKN--THHPFPHPSSGPIGPSKRRCIAGPTGAD   67 (81)
Q Consensus        17 Ei~~dG~E~y~~p~~lrE~H~qn--~s~~~PhPasaP~G~kK~R~lAGP~a~d   67 (81)
                      +.-|||.     -+++|||-+-.  -++++++|++=+|+..-+- .+||+.-+
T Consensus       313 ~f~LDgk-----~l~~~efwk~~s~~~hr~~~p~s~~~~S~a~~-~~~~dgS~  359 (1096)
T KOG1859|consen  313 KFKLDGK-----ALGGREFWKRQSGVSHRSSRPASYGFYSPARS-ENTSDGSQ  359 (1096)
T ss_pred             ceEecce-----eccchhhhhhhhheecCCCCCCCCCCCCchhc-cCCCccch
Confidence            4568887     67889987666  8899999999999998877 88887654


No 11 
>TIGR02861 SASP_H small acid-soluble spore protein, H-type. This model is derived from pfam08141 but has been expanded to include in the seed corresponding proteins from three species of Clostridium. Members of this family should occur only in endospore-forming bacteria, typically with two members per genome, but may be absent from the genomes of some endospore-forming bacteria. SspH (previously designated YfjU) was shown to be expressed specifically in spores of Bacillus subtilis.
Probab=24.33  E-value=55  Score=20.32  Aligned_cols=17  Identities=18%  Similarity=0.477  Sum_probs=13.9

Q ss_pred             eeeeecCceeeeecCcc
Q psy5791          15 IQEISYDGQEIYQLSDN   31 (81)
Q Consensus        15 vqEi~~dG~E~y~~p~~   31 (81)
                      .-+|.|+|+..|+.-.+
T Consensus        15 ~i~V~Y~G~pV~Ie~vd   31 (58)
T TIGR02861        15 MINVTYKGVPVYIEHVD   31 (58)
T ss_pred             ceEEEECCEEEEEEEEc
Confidence            35799999999998654


No 12 
>KOG0846|consensus
Probab=24.04  E-value=71  Score=25.65  Aligned_cols=72  Identities=18%  Similarity=0.196  Sum_probs=44.7

Q ss_pred             eeeeec--chhceeeeeecCc---eeeeecCcchhhh------hhcCCCCCCCCCCC-----CCC--CCCccccccCCCc
Q psy5791           4 NISVEA--PVENIIQEISYDG---QEIYQLSDNTFMV------HHKNTHHPFPHPSS-----GPI--GPSKRRCIAGPTG   65 (81)
Q Consensus         4 ~isiE~--~~e~~vqEi~~dG---~E~y~~p~~lrE~------H~qn~s~~~PhPas-----aP~--G~kK~R~lAGP~a   65 (81)
                      .|+||.  .-+.-|+-|-=.|   +-.|-.|++||.+      +..  ..+.|.-+-     ..+  -++++=.|+.|.+
T Consensus       149 ~i~iEvs~aS~~AiaaIEkaGG~vtt~yy~p~~Lra~lnP~~wf~~--g~~vP~~~rPp~~~idyYtd~k~rGyl~~~~~  226 (274)
T KOG0846|consen  149 KINIEVSRASVQAIAAIEKAGGSVTTAYYDPLSLRAHLNPKKWFEP--GSPVPKRARPPQKDIDYYTDPKNRGYLAAPEA  226 (274)
T ss_pred             eEEEEehhhhHHHHHHHHhcCCeEEEEEEcchhhhhhcCchhhccc--CCcCccccCCChhhhhhhhchhhcccccCccc
Confidence            344443  3455566666677   6789999999854      433  334443222     233  3444445899999


Q ss_pred             cChHHHHHhhhh
Q psy5791          66 ADRYELLELTKS   77 (81)
Q Consensus        66 ~dr~ei~~m~kt   77 (81)
                      .-+..+.+.|+.
T Consensus       227 ~~~e~~~~Aq~~  238 (274)
T KOG0846|consen  227 KTSERAASAQKY  238 (274)
T ss_pred             cccchhHHHhhc
Confidence            998888888764


No 13 
>PF14851 FAM176:  FAM176 family
Probab=23.55  E-value=11  Score=27.38  Aligned_cols=25  Identities=32%  Similarity=0.171  Sum_probs=18.5

Q ss_pred             hceeeeeecCceeeeecCcchhhhh
Q psy5791          12 ENIIQEISYDGQEIYQLSDNTFMVH   36 (81)
Q Consensus        12 e~~vqEi~~dG~E~y~~p~~lrE~H   36 (81)
                      |..||||..|||.---++-+|-.+|
T Consensus       129 e~iirEIW~n~~~d~~~~~~~~~~~  153 (153)
T PF14851_consen  129 ERIIREIWMNGQPDILGTRTLGRVY  153 (153)
T ss_pred             HHHHHHHHHhcCCCCCCCCCCCCCC
Confidence            6789999999997666666655544


No 14 
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=23.18  E-value=73  Score=25.32  Aligned_cols=35  Identities=23%  Similarity=0.431  Sum_probs=24.4

Q ss_pred             eeeecCceeeeecCcchhhhhhcCCCCCCCCCCCCC
Q psy5791          16 QEISYDGQEIYQLSDNTFMVHHKNTHHPFPHPSSGP   51 (81)
Q Consensus        16 qEi~~dG~E~y~~p~~lrE~H~qn~s~~~PhPasaP   51 (81)
                      =||.|||+.+|-+..+.-++-+. -+++|.+|..=|
T Consensus        67 G~v~~~g~ni~~~~~d~~~lRr~-vGMVFQkPnPFp  101 (253)
T COG1117          67 GEVLLDGKNIYDPKVDVVELRRR-VGMVFQKPNPFP  101 (253)
T ss_pred             EEEEECCeeccCCCCCHHHHHHH-heeeccCCCCCC
Confidence            38999999999997777666444 455666655433


No 15 
>PF07550 DUF1533:  Protein of unknown function (DUF1533);  InterPro: IPR011432 This domain is found duplicated in proteins of unknown function. The proteins typically also contain leucine-rich repeats.
Probab=22.18  E-value=47  Score=20.01  Aligned_cols=13  Identities=23%  Similarity=0.537  Sum_probs=11.5

Q ss_pred             ceeeeeecCceee
Q psy5791          13 NIIQEISYDGQEI   25 (81)
Q Consensus        13 ~~vqEi~~dG~E~   25 (81)
                      +.|.+|.+||++.
T Consensus         6 ~~I~~V~VNg~~y   18 (65)
T PF07550_consen    6 KAITSVTVNGKEY   18 (65)
T ss_pred             hhCCEEEECCEEe
Confidence            5789999999987


No 16 
>PF06799 DUF1230:  Protein of unknown function (DUF1230);  InterPro: IPR009631 This family represents Ycf36, which is found in plants, encoded in the genomes of algal chloroplasts and in cyanobacteria. As the family is exclusively found in phototrophic organisms it may play a role in photosynthesis.
Probab=21.61  E-value=40  Score=24.45  Aligned_cols=20  Identities=20%  Similarity=0.303  Sum_probs=16.0

Q ss_pred             ecCceeeeecCcchhhhhhcC
Q psy5791          19 SYDGQEIYQLSDNTFMVHHKN   39 (81)
Q Consensus        19 ~~dG~E~y~~p~~lrE~H~qn   39 (81)
                      -|||| +|+.|+..+...+-.
T Consensus       106 WYDGQ-~W~Kp~e~l~rDrLi  125 (144)
T PF06799_consen  106 WYDGQ-VWVKPPEVLARDRLI  125 (144)
T ss_pred             ccCCc-cccCCHHHHHHHHHH
Confidence            38998 799999988876655


Done!