Query         psy5811
Match_columns 329
No_of_seqs    264 out of 1298
Neff          7.0 
Searched_HMMs 46136
Date          Fri Aug 16 18:36:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5811.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5811hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3643|consensus              100.0 1.3E-38 2.7E-43  305.8   8.6  186   65-252   120-324 (459)
  2 KOG3644|consensus              100.0 2.3E-36   5E-41  299.3   7.3  187   64-252   129-333 (457)
  3 TIGR00860 LIC Cation transport 100.0 5.8E-33 1.3E-37  277.8  12.0  178   67-253   118-298 (459)
  4 KOG3642|consensus              100.0 5.3E-33 1.2E-37  268.5   5.1  185   65-252   128-332 (466)
  5 KOG3646|consensus              100.0 1.5E-31 3.2E-36  258.1   4.4  169   81-257   126-298 (486)
  6 KOG3645|consensus              100.0 2.3E-30 4.9E-35  258.5  11.8  171   81-259   129-305 (449)
  7 PF02931 Neur_chan_LBD:  Neurot  99.7 2.5E-17 5.3E-22  148.5  14.1  108   81-188   101-217 (217)
  8 PF02932 Neur_chan_memb:  Neuro  98.6 9.9E-11 2.1E-15  101.9 -13.2   42  195-236     1-42  (237)
  9 TIGR00927 2A1904 K+-dependent   93.1   0.014   3E-07   62.9  -2.1   23  190-212   933-955 (1096)
 10 TIGR00927 2A1904 K+-dependent   92.1   0.022 4.8E-07   61.4  -2.1    9  223-231  1067-1075(1096)
 11 PF03066 Nucleoplasmin:  Nucleo  91.8   0.062 1.3E-06   46.2   0.7    9   19-27    101-109 (149)
 12 PF10446 DUF2457:  Protein of u  86.5    0.22 4.8E-06   49.5   0.2   38   92-129   121-160 (458)
 13 PF10446 DUF2457:  Protein of u  85.0    0.18   4E-06   50.1  -1.2    7   24-30     25-31  (458)
 14 KOG0772|consensus               78.0    0.52 1.1E-05   47.8  -0.9   74   61-135   146-230 (641)
 15 KOG4156|consensus               76.3    0.88 1.9E-05   47.3   0.2    6  294-299   890-895 (1329)
 16 KOG4156|consensus               72.8    0.72 1.6E-05   47.9  -1.4    7  153-159   774-780 (1329)
 17 KOG1834|consensus               71.0    0.57 1.2E-05   48.8  -2.6    9   27-35    881-889 (952)
 18 PF14494 DUF4436:  Domain of un  67.3     6.3 0.00014   37.0   3.6   92  107-213    96-188 (256)
 19 PF03896 TRAP_alpha:  Transloco  64.2    0.95 2.1E-05   43.0  -2.5   11   65-75     74-84  (285)
 20 KOG0338|consensus               63.2     2.7 5.8E-05   43.1   0.3   20  300-319   408-427 (691)
 21 PF02459 Adeno_terminal:  Adeno  58.2     1.3 2.8E-05   45.2  -2.8   39  278-316   500-538 (548)
 22 PF15470 DUF4637:  Domain of un  50.3     3.6 7.7E-05   35.0  -1.0    7   92-98     66-72  (173)
 23 PF02459 Adeno_terminal:  Adeno  49.5     1.7 3.8E-05   44.3  -3.5   10   65-74    347-356 (548)
 24 KOG2457|consensus               48.5     4.4 9.6E-05   40.0  -0.8    6  295-300   413-418 (555)
 25 PF03896 TRAP_alpha:  Transloco  46.9     2.3 5.1E-05   40.4  -2.9    6   88-93    107-112 (285)
 26 KOG0127|consensus               46.2     6.1 0.00013   40.6  -0.3   10  109-118   296-305 (678)
 27 PHA03171 UL37 tegument protein  44.1     5.3 0.00012   39.5  -1.0    8  117-124   217-224 (499)
 28 COG1614 CdhC CO dehydrogenase/  42.0      13 0.00028   36.2   1.2    7   13-19    327-333 (470)
 29 KOG0699|consensus               40.8       5 0.00011   39.4  -1.7    6  193-198   410-415 (542)
 30 PF04712 Radial_spoke:  Radial   38.1     7.6 0.00017   39.8  -1.0   12   88-99    343-354 (491)
 31 PTZ00248 eukaryotic translatio  32.9     7.3 0.00016   37.7  -2.0    6   12-17    260-265 (319)
 32 PF04147 Nop14:  Nop14-like fam  32.6     6.8 0.00015   42.8  -2.6   13   98-110   416-428 (840)
 33 PF04712 Radial_spoke:  Radial   32.1      12 0.00026   38.3  -0.7   20  118-138   436-455 (491)
 34 PF08553 VID27:  VID27 cytoplas  32.0      17 0.00037   39.4   0.4   12  240-251   639-650 (794)
 35 PF04147 Nop14:  Nop14-like fam  31.9     7.3 0.00016   42.6  -2.5    9  305-313   675-683 (840)
 36 PF02724 CDC45:  CDC45-like pro  30.8     9.1  0.0002   40.4  -1.9   29  179-211   303-331 (622)
 37 PF01056 Myc_N:  Myc amino-term  30.6      17 0.00036   35.4   0.0   11   62-72    242-252 (329)
 38 PHA03171 UL37 tegument protein  29.5      17 0.00038   36.0  -0.1   10   24-33     58-67  (499)
 39 KOG2395|consensus               28.8      27 0.00059   36.0   1.2   12  240-251   492-503 (644)
 40 PF15017 AF1Q:  Drug resistance  25.7     9.9 0.00021   29.7  -2.0   10   61-70     70-79  (87)
 41 COG5167 VID27 Protein involved  25.2      31 0.00067   35.6   0.8   14   83-96    428-441 (776)
 42 PF03115 Astro_capsid:  Astrovi  24.8      25 0.00054   38.2   0.0   14  110-123   732-745 (787)
 43 PF04874 Mak16:  Mak16 protein   23.3     9.1  0.0002   30.7  -2.7    7    8-14     36-42  (101)
 44 KOG0299|consensus               23.1      28 0.00062   35.0   0.1   10   90-99    115-124 (479)
 45 PF00183 HSP90:  Hsp90 protein;  22.9      11 0.00024   39.1  -3.0   40   84-125   124-163 (531)
 46 KOG2153|consensus               22.9      19 0.00041   37.9  -1.2   11  308-318   457-467 (704)
 47 KOG3803|consensus               22.6      35 0.00077   35.9   0.7   18  196-213   371-388 (968)
 48 KOG1144|consensus               22.1      98  0.0021   33.7   3.7   15  279-293   593-607 (1064)
 49 PF03153 TFIIA:  Transcription   21.7   1E+02  0.0022   30.2   3.6   95   27-137   273-367 (375)
 50 KOG4264|consensus               21.7     9.8 0.00021   38.9  -3.4   19  297-315   443-461 (694)
 51 PF00183 HSP90:  Hsp90 protein;  21.2      26 0.00055   36.4  -0.7    7   15-21     19-25  (531)
 52 PF14153 Spore_coat_CotO:  Spor  21.2 1.6E+02  0.0035   26.2   4.5   14   81-94    133-146 (185)
 53 PF08553 VID27:  VID27 cytoplas  21.1      26 0.00056   38.1  -0.7   11  150-160   515-525 (794)
 54 KOG4364|consensus               21.0      14 0.00031   38.9  -2.5   38   32-69    523-561 (811)
 55 KOG4101|consensus               20.9      77  0.0017   27.1   2.2   14   84-97     38-51  (175)

No 1  
>KOG3643|consensus
Probab=100.00  E-value=1.3e-38  Score=305.76  Aligned_cols=186  Identities=33%  Similarity=0.658  Sum_probs=177.1

Q ss_pred             eeeecCccccccccccCCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceEeeecC-CCc
Q psy5811          65 EFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQS-ETP  143 (329)
Q Consensus        65 E~~t~s~~s~~~~~~~~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~~~~-~~~  143 (329)
                      .|+.|+||+..|..+ ..|..++|++||+|+|+.|++.++.|+|||++||+|+|+|+|.+.||+|+.++|.+.|.. ++.
T Consensus       120 Tff~N~KkSf~H~~T-~~N~~lRl~~dGtVlys~RlT~Ta~C~MDL~~fPmD~Q~C~LeiESYGYt~~DI~y~W~~g~~a  198 (459)
T KOG3643|consen  120 TFFPNSKKSFFHDVT-THNSLLRLHPDGTVLYSIRLTVTAACPMDLKLFPMDSQNCKLEIESYGYTTDDIEYYWSKGDNA  198 (459)
T ss_pred             eecccCcccccceee-ecceEEEEcCCCeEEEEEEEEEEEecccccccCCCcccceeEEEEecccccccEEEEEcCCCcc
Confidence            899999999998886 899999999999999999999999999999999999999999999999999999999987 457


Q ss_pred             eeecccccccceeeeeeEEEEeEEeeecCCceeeEEEEEEEEeccceeeEeecchhHHHHhhhheeeeccCCCCCCeEEE
Q psy5811         144 VDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSL  223 (329)
Q Consensus       144 v~~~~~~~~~eW~l~~~~~~~~~~~~~~~g~ys~l~~~~~LkR~~~~yi~~iilP~~llvlLs~lsFwlp~~s~geRisl  223 (329)
                      +.......++++.+.+.........+ .+|.|+++.+.|.|+|+.+||++++++|+++++++||++|||..+++++|+++
T Consensus       199 v~~~e~i~LpqFti~~~~~~s~~~~~-sTG~Y~RL~l~F~l~Rnigf~ilQ~y~PS~LiVilSWVSFWin~~a~pARv~l  277 (459)
T KOG3643|consen  199 VKGDEKIELPQFTITEYHVTSRLVSF-STGNYSRLSLSFQLRRNIGFYILQTYIPSTLIVILSWVSFWINRDASPARVAL  277 (459)
T ss_pred             ccceeeeeccceEEEEEEEEEEEEEE-ccccceeEEEEEEEEeeccEEEEeeecchhhhhHHhHhHhhhccccchhheee
Confidence            77777899999999999999998888 79999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeehhhhhhcccc------------------eEEEEeecCcCCCC
Q psy5811         224 DVDKQIKQWCRIENN------------------ISYLVLYPSLAPYT  252 (329)
Q Consensus       224 giT~LLs~t~~~~~~------------------v~~l~v~~~llp~t  252 (329)
                      |||++|+||+++.+.                  +||++||+++++.+
T Consensus       278 GITTVLTMTTl~t~~n~slPrvSYVKAiDiYL~vCFvfVF~sLLEYA  324 (459)
T KOG3643|consen  278 GITTVLTMTTLMTSTNESLPRVSYVKAIDVYLGVCFVFVFLSLLEYA  324 (459)
T ss_pred             ceehHHhHHHHHhhhhccCCCccceeeehhhhhHHHHHHHHHHHHHH
Confidence            999999999998652                  69999999999998


No 2  
>KOG3644|consensus
Probab=100.00  E-value=2.3e-36  Score=299.27  Aligned_cols=187  Identities=30%  Similarity=0.620  Sum_probs=177.9

Q ss_pred             ceeeecCccccccccccCCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceEeeecCCCc
Q psy5811          64 EEFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETP  143 (329)
Q Consensus        64 ~E~~t~s~~s~~~~~~~~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~~~~~~~  143 (329)
                      .-+|.|+|.+.-|... .+|..+.|++||+|++..|+.++.+|+||+.+||+|+|+|.|.+.||+|+.++|.+.|...++
T Consensus       129 d~~F~NsK~a~~H~~~-~~N~ll~I~pnGtV~~~~Ri~l~~~C~m~L~~fP~D~Q~C~l~~eSy~Yn~~~v~~~W~~~~p  207 (457)
T KOG3644|consen  129 DTFFANSKSAEFHKST-KPNVLLMIFPNGTVWYSYRISLTLPCNMDLSKFPMDSQECKLQLESYAYNTDDVRLEWKEWNP  207 (457)
T ss_pred             ceeeecccceeeecCC-CCceEEEEecCCeEEEEEEEEEeeceeeehhhCCCccceeeEEEEEeccccceEEEEecCCCC
Confidence            4789999999988886 999999999999999999999999999999999999999999999999999999999999778


Q ss_pred             eeecccccccceeeeeeEEEEeEEeeecCCceeeEEEEEEEEeccceeeEeecchhHHHHhhhheeeeccCCCCCCeEEE
Q psy5811         144 VDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSL  223 (329)
Q Consensus       144 v~~~~~~~~~eW~l~~~~~~~~~~~~~~~g~ys~l~~~~~LkR~~~~yi~~iilP~~llvlLs~lsFwlp~~s~geRisl  223 (329)
                      +...+.+..+++.+.+.+...+...| ..|.|++++++|+++|+.+||+++.|+|+.+++++||++|||+++++++|++|
T Consensus       208 v~~~~~i~LPdf~l~~~~~~~~~~~y-~~G~~scL~v~~~f~R~~g~yllQ~YiPT~l~ViiSWvSFWLd~~A~PARv~L  286 (457)
T KOG3644|consen  208 VQVKKDIKLPDFSLPSFSTEKCTGSY-TTGVYSCLRVTFTFKRRYGYYLLQTYIPTLLIVIISWVSFWLDPKAVPARVTL  286 (457)
T ss_pred             cccccCccCCceeccceeeccccccc-cCcceEEEEEEEEEEEeehhhhhHHHhhhHhhhhhhhhheecCCCcccceEEe
Confidence            99888999999999999988888777 69999999999999999999999999999999999999999999999999999


Q ss_pred             EEeeehhhhhhcccc------------------eEEEEeecCcCCCC
Q psy5811         224 DVDKQIKQWCRIENN------------------ISYLVLYPSLAPYT  252 (329)
Q Consensus       224 giT~LLs~t~~~~~~------------------v~~l~v~~~llp~t  252 (329)
                      |+|+||+|+++.++.                  +|+.|||+++++++
T Consensus       287 gvtsLLtLttq~~~i~~~LP~VSYvKAIDVWm~~C~~FIF~sLlE~A  333 (457)
T KOG3644|consen  287 GVTSLLTLTTQSGGIRRNLPKVSYVKAIDVWMGVCMTFIFGSLLELA  333 (457)
T ss_pred             hHHHHHHHHHHhcchhhcCCchhhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            999999999998762                  58899999999999


No 3  
>TIGR00860 LIC Cation transporter family protein. selective while glycine receptors are anion selective).
Probab=100.00  E-value=5.8e-33  Score=277.82  Aligned_cols=178  Identities=29%  Similarity=0.506  Sum_probs=146.9

Q ss_pred             eecCccccccccccCCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceEeeecCCCce--
Q psy5811          67 YTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPV--  144 (329)
Q Consensus        67 ~t~s~~s~~~~~~~~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~~~~~~~v--  144 (329)
                      +.|++.+..+.. ...+..+++++||+|.|.+|+.+++.|+||+++||||+|+|+|+|+||+|+.+++.+.|...+.+  
T Consensus       118 l~N~~~~~~~~~-~~~~~~v~~~~~G~V~~~~~~~~~~~C~~d~~~FPfD~Q~C~l~fgSw~y~~~~i~l~~~~~~~v~~  196 (459)
T TIGR00860       118 FYNEKDARFHGI-TMTNVLVRIHPNGSVLYSPRITLTLACPMDLRNFPFDVQNCSLKFESWGYTTNDIKLEWKEQGAVQV  196 (459)
T ss_pred             eecCcccccccc-ccCceEEEEcCCCcEEEecCceEEecccceeccCCCCCccccEEEhhhccccceEEEEECCCCceEe
Confidence            445555433222 23445555566999999999999999999999999999999999999999999999999763333  


Q ss_pred             eecccccccceeeeeeEEEEeEEeee-cCCceeeEEEEEEEEeccceeeEeecchhHHHHhhhheeeeccCCCCCCeEEE
Q psy5811         145 DIEHGLELAQYALVNMTAIKNKLVTI-GNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSL  223 (329)
Q Consensus       145 ~~~~~~~~~eW~l~~~~~~~~~~~~~-~~g~ys~l~~~~~LkR~~~~yi~~iilP~~llvlLs~lsFwlp~~s~geRisl  223 (329)
                      +.+.+..++||++.+....... .+. +.+.|+++.++|+++|+++||++++++|++++++++|++||+|+++.|+|++|
T Consensus       197 ~~~~~~~~~eW~l~~~~~~~~~-~~~~~~~~y~~l~~~~~l~R~~~~y~~~l~iP~~li~~ls~~sF~Lp~~a~~eRi~L  275 (459)
T TIGR00860       197 DDSLFISLPEFELLGVYGTRYC-TSETNTGEYPCLTFSFVLRRRPLYYLLQLYIPSILIVILSWVSFWLPADASGARVSL  275 (459)
T ss_pred             chhhccccCceEEEeeeeeeeE-ecccCCCCcCeEEEEEEEEEcccceeeeehHHHHHHHHHhheeEecCCCCCCCcEEE
Confidence            3334558999999996655544 333 78899999999999999999999999999999999999999999966999999


Q ss_pred             EEeeehhhhhhcccceEEEEeecCcCCCCC
Q psy5811         224 DVDKQIKQWCRIENNISYLVLYPSLAPYTN  253 (329)
Q Consensus       224 giT~LLs~t~~~~~~v~~l~v~~~llp~ts  253 (329)
                      |+|+||++       ++|++++++.+|.++
T Consensus       276 ~it~lLs~-------~vf~~~v~~~lP~~S  298 (459)
T TIGR00860       276 GITTLLTM-------TTFSSGVRESLPAVS  298 (459)
T ss_pred             EEEHHHHH-------HHHHHHHHhhCCCcc
Confidence            99999999       577777777777765


No 4  
>KOG3642|consensus
Probab=99.97  E-value=5.3e-33  Score=268.46  Aligned_cols=185  Identities=30%  Similarity=0.684  Sum_probs=173.0

Q ss_pred             eeeecCccccccccccCCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceEeeecCCCce
Q psy5811          65 EFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSETPV  144 (329)
Q Consensus        65 E~~t~s~~s~~~~~~~~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~~~~~~~v  144 (329)
                      .+|.|++++..|.++ +||..++|+.||+|.|+.|++..+.|+|++.+||+|.|.|++.|+|++|+.+++.+.|.. ..+
T Consensus       128 TfF~NgkkS~~H~iT-~pN~l~Ri~~dG~vlyt~RlTi~A~C~m~l~~fPMD~haCpl~fgSy~Y~~~evvY~W~~-~~V  205 (466)
T KOG3642|consen  128 TFFRNGKKSYAHNIT-TPNKLVRIYIDGTVLYTMRLTIPAECPMHLARFPMDSHACPLKFGSYAYPGSEVVYKWKK-RSV  205 (466)
T ss_pred             cccccCcccceeecc-CCCceEEEeECCcceEEEEEeecccCcchhhcCCCCcccCcceecccCcCCCCEEEEEec-ccE
Confidence            789999999999997 999999999999999999999999999999999999999999999999999999999987 555


Q ss_pred             eecc--cccccceeeeeeEEEEeEEeeecCCceeeEEEEEEEEeccceeeEeecchhHHHHhhhheeeeccCCCCCCeEE
Q psy5811         145 DIEH--GLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVS  222 (329)
Q Consensus       145 ~~~~--~~~~~eW~l~~~~~~~~~~~~~~~g~ys~l~~~~~LkR~~~~yi~~iilP~~llvlLs~lsFwlp~~s~geRis  222 (329)
                      .+..  .+.+.++++.+.+........ ..|.|+.+.+.|+|+|+.+||++++++||+++++|||++||+..+++++|.+
T Consensus       206 eV~~~~~~~L~Qf~l~g~~~~te~i~t-~~gey~vmtv~F~L~R~~GYf~iQ~YlPC~ltViLSwVSFWinrEs~paRt~  284 (466)
T KOG3642|consen  206 EVNETDSWSLDQFDLLGVSVGTEDIKT-SSGEYSVMTVYFHLSRRQGYFIIQIYLPCILTVVLSWVSFWINREATPARTS  284 (466)
T ss_pred             EEcCCCCccccceeeecccccccceEe-cCCCEEEEEEEEeccceeeEEEEeeccceeeeeeeeeeehhcccccccccee
Confidence            5544  447999999999999888777 8999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeeehhhhhhccc------------------ceEEEEeecCcCCCC
Q psy5811         223 LDVDKQIKQWCRIEN------------------NISYLVLYPSLAPYT  252 (329)
Q Consensus       223 lgiT~LLs~t~~~~~------------------~v~~l~v~~~llp~t  252 (329)
                      ||||++|+|+++...                  -+||+|+|+.+++.+
T Consensus       285 lGITtVLTMTtLs~~aR~slPKVsy~TAmD~fIavCf~FvFsaliEfa  332 (466)
T KOG3642|consen  285 LGITTVLTMTTLSTSARKSLPKVSYATALDVFIAVCFIFVFAALVEFA  332 (466)
T ss_pred             eeeeeeeeeeeeeehhccCCCccccchhHHHHHHHHHHHHHHHHHHHH
Confidence            999999999988543                  169999999999998


No 5  
>KOG3646|consensus
Probab=99.97  E-value=1.5e-31  Score=258.12  Aligned_cols=169  Identities=18%  Similarity=0.336  Sum_probs=155.2

Q ss_pred             CCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceEeeecC-CCceeecccccccceeeee
Q psy5811          81 SPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQS-ETPVDIEHGLELAQYALVN  159 (329)
Q Consensus        81 ~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~~~~-~~~v~~~~~~~~~eW~l~~  159 (329)
                      .=.++++|++||.|.|.+|..++++|.+|++.||||.|.|.++||||+|++..+.++... ...++.+.+..|+||++.+
T Consensus       126 Ty~tN~Vv~~tG~v~~vPPGIfk~sCkiDItwFPFD~Q~C~mKFGSWTY~G~~lDL~~~~~~g~~Dls~yi~NGEW~Ll~  205 (486)
T KOG3646|consen  126 TYKTNYVVYSTGSVLWVPPGIFKSSCKIDITWFPFDDQVCYLKFGSWTYAGILLDLRIDDEDGGIDLSTYIPNGEWDLLG  205 (486)
T ss_pred             cceeeEEEccCCeeeecCCceeeeeeEEEEEEecccccEEEEEeeeEEEcceeeeeeeccccCCcchhhcccCCceeecc
Confidence            345889999999999999999999999999999999999999999999999999998766 3457888999999999999


Q ss_pred             eEEEEeEEeee-cCCceeeEEEEEEEEeccceeeEeecchhHHHHhhhheeeeccCCCCCCeEEEEEeeehhhhhhcccc
Q psy5811         160 MTAIKNKLVTI-GNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIENN  238 (329)
Q Consensus       160 ~~~~~~~~~~~-~~g~ys~l~~~~~LkR~~~~yi~~iilP~~llvlLs~lsFwlp~~s~geRislgiT~LLs~t~~~~~~  238 (329)
                      ..+.+....|. |..+|+.+.|+++++|+.+||.+++++|++++.++++++|-+|+|+ |+|+++++|++|++       
T Consensus       206 ~pakr~~~~y~cC~epY~dv~F~l~irRRTLyYgfNlIiP~lLIs~m~lLgFtlppD~-gEKitL~iTilLsv-------  277 (486)
T KOG3646|consen  206 TPAKREEKTYDCCPEPYPDVTFYLHIRRRTLYYGFNLIIPSLLISLMSLLGFTLPPDA-GEKITLQITILLSV-------  277 (486)
T ss_pred             ccccceeeecccCCCCcceeEEEEEEEehhhHHHHHHHHHHHHHHHHHHhccccCccc-cceeeeeeehHHHH-------
Confidence            99999988887 6889999999999999999999999999999999999999999999 99999999999999       


Q ss_pred             eEEEEeecCcCCCCC--CCCC
Q psy5811         239 ISYLVLYPSLAPYTN--GPPR  257 (329)
Q Consensus       239 v~~l~v~~~llp~ts--~~~~  257 (329)
                      .+|+-+++++.|.+|  .|++
T Consensus       278 c~FL~mvse~~PpTSeaVPll  298 (486)
T KOG3646|consen  278 CFFLTMVSEMTPPTSEAVPLL  298 (486)
T ss_pred             HHHHHHHHhhcCCccccccHH
Confidence            477777788888774  4554


No 6  
>KOG3645|consensus
Probab=99.97  E-value=2.3e-30  Score=258.46  Aligned_cols=171  Identities=20%  Similarity=0.397  Sum_probs=152.7

Q ss_pred             CCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceE-eeecCCCc--eeecccccccceee
Q psy5811          81 SPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVK-YKWQSETP--VDIEHGLELAQYAL  157 (329)
Q Consensus        81 ~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~-l~~~~~~~--v~~~~~~~~~eW~l  157 (329)
                      ...+++.|+++|+|.|.+++.++++|++|+++||||.|+|.++|+||.|+..++. +.... ..  .+..++..++||++
T Consensus       129 ~~~~~v~v~~~G~V~~~~p~i~~s~C~idv~~FPfD~Q~C~i~f~sw~~~~~~i~~~~~~~-~~~~~~~~~~~~n~eW~l  207 (449)
T KOG3645|consen  129 EDLTNVLVTYTGEVLWYPPAIYKSSCPIDVTYFPFDVQNCSIKFGSWTYDGSEVDGLDLNA-QTIEVDLSDFIENSEWEL  207 (449)
T ss_pred             cccceEEEEECCEEEEEcceEEEeecccccccCCCcceeEeEEEeccccCccccceeeecc-ccccCCHHHcCCCCcEEE
Confidence            3446699999999999999999999999999999999999999999999999876 55443 33  67778899999999


Q ss_pred             eeeEEEEeEEeee-cCCceeeEEEEEEEEeccceeeEeecchhHHHHhhhheeeeccCCCCCCeEEEEEeeehhhhhhcc
Q psy5811         158 VNMTAIKNKLVTI-GNDVHSIIQINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIE  236 (329)
Q Consensus       158 ~~~~~~~~~~~~~-~~g~ys~l~~~~~LkR~~~~yi~~iilP~~llvlLs~lsFwlp~~s~geRislgiT~LLs~t~~~~  236 (329)
                      .+.........+. +.+.|+.+.|.+++||+|+||++++++||+++.++++++||+|++..++|+++|+|+||+|+    
T Consensus       208 ~~~~~~~~~~~~~~~~~~~~~i~f~l~irRkplyY~v~liiP~~lis~l~il~fflp~~~~~eki~L~it~Ll~~t----  283 (449)
T KOG3645|consen  208 LSVTVVREEKKYDCCPGPYSDITFTITIRRKPLYYTVNLIIPCFLISFLSILGFFLPSDSGTEKVTLGITVLLAMT----  283 (449)
T ss_pred             EeeeeEEeecccCCCCCceeEEEEEEEEEeccceEEEehhhhHHHHHHHHhheEEccCCCCCceEEEEHHHHHHHH----
Confidence            9999998887764 56779999999999999999999999999999999999999998884599999999999994    


Q ss_pred             cceEEEEeecCcCCCCCC--CCCCc
Q psy5811         237 NNISYLVLYPSLAPYTNG--PPRGL  259 (329)
Q Consensus       237 ~~v~~l~v~~~llp~ts~--~~~g~  259 (329)
                         ++++++++.+|.++.  |++|+
T Consensus       284 ---v~ll~vs~~~P~ts~~iPLig~  305 (449)
T KOG3645|consen  284 ---VFLLLVSDKMPPTSSVIPLIGK  305 (449)
T ss_pred             ---HHHHHHHhhcCCccCcchHHHH
Confidence               778999999999864  77766


No 7  
>PF02931 Neur_chan_LBD:  Neurotransmitter-gated ion-channel ligand binding domain ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006202 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This entry presents the extracellular ligand binding domain of these ion channels. This domain forms a pentameric arrangement in the known structure. ; GO: 0005230 extracellular ligand-gated ion channel activity, 0006810 transport, 0016020 membrane; PDB: 1LXH_B 1ABT_B 1TOS_A 1LXG_B 1IDG_B 1TOR_A 1IDH_B 3IGQ_B 3TLU_B 3UU5_A ....
Probab=99.74  E-value=2.5e-17  Score=148.50  Aligned_cols=108  Identities=29%  Similarity=0.563  Sum_probs=95.0

Q ss_pred             CCCceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeeecccccccceEeeecCC-------Cceeeccccccc
Q psy5811          81 SPRASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVGSFGYTSNDVKYKWQSE-------TPVDIEHGLELA  153 (329)
Q Consensus        81 ~~~~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~~~~~-------~~v~~~~~~~~~  153 (329)
                      .+...+.|++||+|.+..++.+++.|+||+.+||||+|+|.|.|+||.|+..++.+.|...       ..+....+..++
T Consensus       101 ~~~~~~~v~~~G~V~~~~~~~~~~~C~~d~~~fPfD~q~C~i~~~s~~~~~~~v~l~~~~~~~~~~~~~~~~~~~~~~~~  180 (217)
T PF02931_consen  101 EPNSNVRVYSDGTVRYSPRFTLTFSCPMDLRDFPFDSQNCSIKFGSWSYNSEEVQLKWENKNPPIDENDEVSLSDFVSNS  180 (217)
T ss_dssp             -SSEEEEEETTSEEEEEEEEEEEEEECETTTSSSSSEEEEEEEEEESSSSTTTEEEEESCSSS-TTSSTTTSCTTCETTS
T ss_pred             cccccccccccchheeeecccccccccccccccccccceeEEEEecccccccceeeeecccCceeeeeccccHHHccccc
Confidence            3679999999999999999999999999999999999999999999999999999999772       244556678899


Q ss_pred             ceeeeeeEEEEeEEeee-cCCc-eeeEEEEEEEEecc
Q psy5811         154 QYALVNMTAIKNKLVTI-GNDV-HSIIQINFQLKRNT  188 (329)
Q Consensus       154 eW~l~~~~~~~~~~~~~-~~g~-ys~l~~~~~LkR~~  188 (329)
                      +|++.+.........+. ..+. |+.+.+.|+|+|+|
T Consensus       181 ew~~~~~~~~~~~~~~~~~~~~~ys~l~~~~~l~R~~  217 (217)
T PF02931_consen  181 EWKIVSVTSTRRETTYGCYNEPTYSMLSFTFTLKRRP  217 (217)
T ss_dssp             SEEEEEEEEEEEEEEESTSSSCSEEEEEEEEEEEEST
T ss_pred             eEEEEeeEEEEEEEccCCcCCCCEeeEEEEEEEEECc
Confidence            99999988887776654 4555 99999999999986


No 8  
>PF02932 Neur_chan_memb:  Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This domain represents four transmembrane helices of a variety of neurotransmitter-gated ion-channels.; GO: 0006811 ion transport, 0016020 membrane; PDB: 1DXZ_A 3MRA_A 1EQ8_C 1OED_C 2PR9_P 1A11_A 1CEK_A 2BG9_E 2KSR_A 2K59_B ....
Probab=98.56  E-value=9.9e-11  Score=101.94  Aligned_cols=42  Identities=33%  Similarity=0.759  Sum_probs=38.0

Q ss_pred             ecchhHHHHhhhheeeeccCCCCCCeEEEEEeeehhhhhhcc
Q psy5811         195 TYVPCSLMVCSSWVSFWIDPDAVPARVSLDVDKQIKQWCRIE  236 (329)
Q Consensus       195 iilP~~llvlLs~lsFwlp~~s~geRislgiT~LLs~t~~~~  236 (329)
                      +|+||+++++++|++||+|+++.++|++||||+||+|++++.
T Consensus         1 l~~P~~li~~~s~~~f~~~~~~~~~rv~l~it~lL~~~~~~~   42 (237)
T PF02932_consen    1 LIIPCILIVVLSWLSFWLPPESGPERVTLGITTLLAMTVFLL   42 (237)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHSTHHHHHHHHHHHHHHHHHHH
T ss_pred             CeehHHHHHHHHHhheEeCccccccccccchhHHHHHHHHHh
Confidence            479999999999999999999955999999999999976543


No 9  
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger.
Probab=93.06  E-value=0.014  Score=62.86  Aligned_cols=23  Identities=22%  Similarity=0.436  Sum_probs=10.9

Q ss_pred             eeeEeecchhHHHHhhhheeeec
Q psy5811         190 FFVLQTYVPCSLMVCSSWVSFWI  212 (329)
Q Consensus       190 ~yi~~iilP~~llvlLs~lsFwl  212 (329)
                      +|.+.+++..+.|.+++++..|+
T Consensus       933 ~y~ltFi~SIiwIsi~SyilV~~  955 (1096)
T TIGR00927       933 FFVITFLGSIMWIAMFSYLMVWW  955 (1096)
T ss_pred             eeeehHHHHHHHHHHHHHHHHHH
Confidence            44444444444444444444443


No 10 
>TIGR00927 2A1904 K+-dependent Na+/Ca+ exchanger.
Probab=92.11  E-value=0.022  Score=61.38  Aligned_cols=9  Identities=11%  Similarity=-0.027  Sum_probs=4.0

Q ss_pred             EEEeeehhh
Q psy5811         223 LDVDKQIKQ  231 (329)
Q Consensus       223 lgiT~LLs~  231 (329)
                      +|+..++.+
T Consensus      1067 lGivlLvlY 1075 (1096)
T TIGR00927      1067 LGFTMFLLY 1075 (1096)
T ss_pred             HHHHHHHHH
Confidence            344444444


No 11 
>PF03066 Nucleoplasmin:  Nucleoplasmin;  InterPro: IPR004301 The nucleophosmin/nucleoplasmin family of chaperones includes nucleophosmin, nucleoplasmin and nucleoplasmin-like proteins. They function as nuclear chaperones which are needed for the proper assembly of nucleosomes and the attainment of proper higher order chromatin structures [].; GO: 0003676 nucleic acid binding; PDB: 2P1B_E 1XB9_I 1XE0_C 1NLQ_A 2VTX_E 1K5J_D 1EJY_N 1EE5_B 3T30_J.
Probab=91.81  E-value=0.062  Score=46.21  Aligned_cols=9  Identities=33%  Similarity=0.220  Sum_probs=4.3

Q ss_pred             cccceeeee
Q psy5811          19 SSQCHRVVV   27 (329)
Q Consensus        19 ~~~~~~~~~   27 (329)
                      +|++|.+..
T Consensus       101 isG~~~~~~  109 (149)
T PF03066_consen  101 ISGQHLVAM  109 (149)
T ss_dssp             EEEEEEEE-
T ss_pred             eeCcccccc
Confidence            455665443


No 12 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=86.48  E-value=0.22  Score=49.49  Aligned_cols=38  Identities=13%  Similarity=0.098  Sum_probs=22.6

Q ss_pred             CeEEEEeccccccccc--cccCCCCcceeeEeeeeecccc
Q psy5811          92 ALTLFCFRLTLTATCK--MFLRKFPFDTQTCPLLVGSFGY  129 (329)
Q Consensus        92 G~V~~~~r~~~~~~C~--mdl~~FPFD~Q~C~L~f~S~~y  129 (329)
                      ..++|.+.......-.  +.+...+...+.-...++|...
T Consensus       121 d~~~WtP~~~t~~~~~~~~~~~r~~~~~~~S~sS~~S~~~  160 (458)
T PF10446_consen  121 DYEFWTPGATTAATSSSHLDVRRRSSHRRSSDSSIESLSS  160 (458)
T ss_pred             cceeecccccccccccccccccccccccCCCCCccccccC
Confidence            6788888765444443  5556666665555555555433


No 13 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=84.98  E-value=0.18  Score=50.07  Aligned_cols=7  Identities=14%  Similarity=0.695  Sum_probs=2.8

Q ss_pred             eeeechH
Q psy5811          24 RVVVDDK   30 (329)
Q Consensus        24 ~~~~~~~   30 (329)
                      +.++++-
T Consensus        25 KlTi~Dt   31 (458)
T PF10446_consen   25 KLTINDT   31 (458)
T ss_pred             cccHHHH
Confidence            3444433


No 14 
>KOG0772|consensus
Probab=78.02  E-value=0.52  Score=47.80  Aligned_cols=74  Identities=15%  Similarity=0.134  Sum_probs=40.6

Q ss_pred             hhhceeeecCccccccccc--cCCCceEEEeeCCeEEEEeccccccccc----cccCCCCccee--eE---eeeeecccc
Q psy5811          61 EQEEEFYTKSPKCLELMLQ--CSPRASILLINMALTLFCFRLTLTATCK----MFLRKFPFDTQ--TC---PLLVGSFGY  129 (329)
Q Consensus        61 ~~~~E~~t~s~~s~~~~~~--~~~~~~v~V~~dG~V~~~~r~~~~~~C~----mdl~~FPFD~Q--~C---~L~f~S~~y  129 (329)
                      ++|+-....-|.+++-++.  +..=.-+.+.++|-=.++..+.+++.|-    || ..++.+.|  -|   .+.-..|+-
T Consensus       146 ~~e~~~~~~IP~shEi~l~hgtk~Vsal~~Dp~GaR~~sGs~Dy~v~~wDf~gMd-as~~~fr~l~P~E~h~i~sl~ys~  224 (641)
T KOG0772|consen  146 DEEESIIKLIPGSHEIQLKHGTKIVSALAVDPSGARFVSGSLDYTVKFWDFQGMD-ASMRSFRQLQPCETHQINSLQYSV  224 (641)
T ss_pred             cchhchhhcCCccceEeccCCceEEEEeeecCCCceeeeccccceEEEEeccccc-ccchhhhccCcccccccceeeecC
Confidence            3333444556666665553  1112446688999888888888877772    33 22344433  23   244445555


Q ss_pred             cccceE
Q psy5811         130 TSNDVK  135 (329)
Q Consensus       130 ~~~ev~  135 (329)
                      +.+.+.
T Consensus       225 Tg~~iL  230 (641)
T KOG0772|consen  225 TGDQIL  230 (641)
T ss_pred             CCCeEE
Confidence            666553


No 15 
>KOG4156|consensus
Probab=76.32  E-value=0.88  Score=47.33  Aligned_cols=6  Identities=17%  Similarity=0.407  Sum_probs=2.5

Q ss_pred             ccccCC
Q psy5811         294 INEAEP  299 (329)
Q Consensus       294 ~~~~~~  299 (329)
                      +.+++|
T Consensus       890 lkprlp  895 (1329)
T KOG4156|consen  890 LKPRLP  895 (1329)
T ss_pred             cccccc
Confidence            444444


No 16 
>KOG4156|consensus
Probab=72.76  E-value=0.72  Score=47.93  Aligned_cols=7  Identities=14%  Similarity=0.662  Sum_probs=2.7

Q ss_pred             cceeeee
Q psy5811         153 AQYALVN  159 (329)
Q Consensus       153 ~eW~l~~  159 (329)
                      +.|.+.+
T Consensus       774 ssfEl~G  780 (1329)
T KOG4156|consen  774 SSFELIG  780 (1329)
T ss_pred             ccceeec
Confidence            3344433


No 17 
>KOG1834|consensus
Probab=71.02  E-value=0.57  Score=48.77  Aligned_cols=9  Identities=11%  Similarity=-0.071  Sum_probs=3.9

Q ss_pred             echHHHHhh
Q psy5811          27 VDDKRVKKI   35 (329)
Q Consensus        27 ~~~~~~~~~   35 (329)
                      |..+++-|+
T Consensus       881 VNPme~~e~  889 (952)
T KOG1834|consen  881 VNPMEDYEK  889 (952)
T ss_pred             ecchHhccc
Confidence            444444444


No 18 
>PF14494 DUF4436:  Domain of unknown function (DUF4436)
Probab=67.28  E-value=6.3  Score=36.95  Aligned_cols=92  Identities=13%  Similarity=0.241  Sum_probs=48.5

Q ss_pred             ccccCCCCcceeeEe-eeeecccccccceEeeecCCCceeecccccccceeeeeeEEEEeEEeeecCCceeeEEEEEEEE
Q psy5811         107 KMFLRKFPFDTQTCP-LLVGSFGYTSNDVKYKWQSETPVDIEHGLELAQYALVNMTAIKNKLVTIGNDVHSIIQINFQLK  185 (329)
Q Consensus       107 ~mdl~~FPFD~Q~C~-L~f~S~~y~~~ev~l~~~~~~~v~~~~~~~~~eW~l~~~~~~~~~~~~~~~g~ys~l~~~~~Lk  185 (329)
                      .=+..+||||+-.-. +.+..+.-+..+-....   ..+...+  ....|++........      +   ....+.++++
T Consensus        96 ~G~~~~yPFD~Y~~~~i~v~~~~g~~~~~~~~p---~~v~~~~--s~~gW~i~~~~~~~~------~---~~~~~~i~l~  161 (256)
T PF14494_consen   96 DGDINNYPFDRYRTDPIRVSAFVGNGDNREPVP---ARVTLTG--SLSGWDISATRVADA------D---GGDGVDITLK  161 (256)
T ss_pred             cCCccCCCCcccccceEEEEEEecCCCcccccc---eEEEEEc--ccCCeEEEeeecCCC------C---CceeEEEEEE
Confidence            456789999998877 66654322221111111   1122222  345687765432221      1   5567888889


Q ss_pred             eccceeeEeecchhHHHHhhhheeeecc
Q psy5811         186 RNTGFFVLQTYVPCSLMVCSSWVSFWID  213 (329)
Q Consensus       186 R~~~~yi~~iilP~~llvlLs~lsFwlp  213 (329)
                      |...-..+.+++=. ++.+|+.+++++-
T Consensus       162 Rs~~~~~F~~~i~~-vm~~L~~~al~~a  188 (256)
T PF14494_consen  162 RSRGVLFFALFICL-VMWALATLALFVA  188 (256)
T ss_pred             ccCcceehHHHHHH-HHHHHHHHHHHHH
Confidence            98886665444333 3344555555543


No 19 
>PF03896 TRAP_alpha:  Translocon-associated protein (TRAP), alpha subunit;  InterPro: IPR005595  The alpha-subunit of the TRAP complex (TRAP alpha) is a single-spanning membrane protein of the endoplasmic reticulum (ER) which is found in proximity of nascent polypeptide chains translocating across the membrane [].; GO: 0005783 endoplasmic reticulum
Probab=64.23  E-value=0.95  Score=43.03  Aligned_cols=11  Identities=18%  Similarity=0.048  Sum_probs=6.0

Q ss_pred             eeeecCccccc
Q psy5811          65 EFYTKSPKCLE   75 (329)
Q Consensus        65 E~~t~s~~s~~   75 (329)
                      .....+|....
T Consensus        74 ~~~~~sP~adt   84 (285)
T PF03896_consen   74 GELKPSPDADT   84 (285)
T ss_pred             ccccccCCceE
Confidence            44556665544


No 20 
>KOG0338|consensus
Probab=63.16  E-value=2.7  Score=43.09  Aligned_cols=20  Identities=25%  Similarity=0.305  Sum_probs=10.5

Q ss_pred             chhhhhHHHHHHHHHHHhcc
Q psy5811         300 KVYSTRLFLLTILLRNVFST  319 (329)
Q Consensus       300 ~~~~~~~~~~~~~~~~~~~~  319 (329)
                      +..--|-+++-.|++-.|.+
T Consensus       408 ~re~dRea~l~~l~~rtf~~  427 (691)
T KOG0338|consen  408 KREGDREAMLASLITRTFQD  427 (691)
T ss_pred             ccccccHHHHHHHHHHhccc
Confidence            33334555666666655543


No 21 
>PF02459 Adeno_terminal:  Adenoviral DNA terminal protein;  InterPro: IPR003391 The genome of adenovirus contains a protein covalently bound to the 5' end of each strand of the linear DNA molecule []. Since adenovirus DNA replication is initiated at the termini of the DNA molecule it has been proposed that the terminal protein serves as the primer for initiation of replication. However, the priming function now appears to reside in the precursor form of the terminal protein (pTP) found on the 5' ends of nascent DNA strands replicated in vitro [, ] and as a component of DNA-protein complexes isolated from virions of the protease-deficient adenovirus serotype 2 (Ad2) mutant tsl. The pTP is encoded by the leftward-transcribed strand of the viral genome and comprises part of a transcription unit that also encodes the single-strand DNA binding protein [].; GO: 0003677 DNA binding, 0006260 DNA replication
Probab=58.15  E-value=1.3  Score=45.17  Aligned_cols=39  Identities=15%  Similarity=0.035  Sum_probs=29.8

Q ss_pred             cccccccCcccceeeeccccCCchhhhhHHHHHHHHHHH
Q psy5811         278 IRHYPLANNEAESVYSINEAEPKVYSTRLFLLTILLRNV  316 (329)
Q Consensus       278 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  316 (329)
                      +++-=......+..+|++..=|+.|++++.|+++.-|.+
T Consensus       500 ~~~nd~eiDSVelSFR~k~~G~V~~s~nr~Iq~~~rrV~  538 (548)
T PF02459_consen  500 AALNDEEIDSVELSFRFKLTGPVVFSTNRQIQRNNRRVR  538 (548)
T ss_pred             hhcchhhccceEEEEEEeecceEEeccCHHHHHHHHHHH
Confidence            333334455577889999999999999999999887753


No 22 
>PF15470 DUF4637:  Domain of unknown function (DUF4637)
Probab=50.34  E-value=3.6  Score=35.04  Aligned_cols=7  Identities=14%  Similarity=0.434  Sum_probs=3.7

Q ss_pred             CeEEEEe
Q psy5811          92 ALTLFCF   98 (329)
Q Consensus        92 G~V~~~~   98 (329)
                      |.|.|++
T Consensus        66 gSVSY~P   72 (173)
T PF15470_consen   66 GSVSYCP   72 (173)
T ss_pred             Cceeccc
Confidence            5555553


No 23 
>PF02459 Adeno_terminal:  Adenoviral DNA terminal protein;  InterPro: IPR003391 The genome of adenovirus contains a protein covalently bound to the 5' end of each strand of the linear DNA molecule []. Since adenovirus DNA replication is initiated at the termini of the DNA molecule it has been proposed that the terminal protein serves as the primer for initiation of replication. However, the priming function now appears to reside in the precursor form of the terminal protein (pTP) found on the 5' ends of nascent DNA strands replicated in vitro [, ] and as a component of DNA-protein complexes isolated from virions of the protease-deficient adenovirus serotype 2 (Ad2) mutant tsl. The pTP is encoded by the leftward-transcribed strand of the viral genome and comprises part of a transcription unit that also encodes the single-strand DNA binding protein [].; GO: 0003677 DNA binding, 0006260 DNA replication
Probab=49.49  E-value=1.7  Score=44.30  Aligned_cols=10  Identities=30%  Similarity=0.069  Sum_probs=5.2

Q ss_pred             eeeecCcccc
Q psy5811          65 EFYTKSPKCL   74 (329)
Q Consensus        65 E~~t~s~~s~   74 (329)
                      +..+.+++-.
T Consensus       347 eELT~~AR~~  356 (548)
T PF02459_consen  347 EELTVSARNH  356 (548)
T ss_pred             HHhhhhhhhh
Confidence            4455555543


No 24 
>KOG2457|consensus
Probab=48.55  E-value=4.4  Score=39.99  Aligned_cols=6  Identities=17%  Similarity=-0.147  Sum_probs=2.2

Q ss_pred             cccCCc
Q psy5811         295 NEAEPK  300 (329)
Q Consensus       295 ~~~~~~  300 (329)
                      .+.+|+
T Consensus       413 e~se~~  418 (555)
T KOG2457|consen  413 ELSEFV  418 (555)
T ss_pred             CcchHH
Confidence            333333


No 25 
>PF03896 TRAP_alpha:  Translocon-associated protein (TRAP), alpha subunit;  InterPro: IPR005595  The alpha-subunit of the TRAP complex (TRAP alpha) is a single-spanning membrane protein of the endoplasmic reticulum (ER) which is found in proximity of nascent polypeptide chains translocating across the membrane [].; GO: 0005783 endoplasmic reticulum
Probab=46.90  E-value=2.3  Score=40.40  Aligned_cols=6  Identities=17%  Similarity=0.124  Sum_probs=2.7

Q ss_pred             EeeCCe
Q psy5811          88 LINMAL   93 (329)
Q Consensus        88 V~~dG~   93 (329)
                      +.++|.
T Consensus       107 ftN~g~  112 (285)
T PF03896_consen  107 FTNKGS  112 (285)
T ss_pred             EEeCCC
Confidence            344444


No 26 
>KOG0127|consensus
Probab=46.17  E-value=6.1  Score=40.60  Aligned_cols=10  Identities=60%  Similarity=1.268  Sum_probs=7.0

Q ss_pred             ccCCCCccee
Q psy5811         109 FLRKFPFDTQ  118 (329)
Q Consensus       109 dl~~FPFD~Q  118 (329)
                      -++|.|||+-
T Consensus       296 FvRNL~fD~t  305 (678)
T KOG0127|consen  296 FVRNLPFDTT  305 (678)
T ss_pred             EEecCCcccc
Confidence            3578888854


No 27 
>PHA03171 UL37 tegument protein; Provisional
Probab=44.11  E-value=5.3  Score=39.47  Aligned_cols=8  Identities=25%  Similarity=0.384  Sum_probs=4.9

Q ss_pred             eeeEeeee
Q psy5811         117 TQTCPLLV  124 (329)
Q Consensus       117 ~Q~C~L~f  124 (329)
                      .++|.|..
T Consensus       217 smnC~lnC  224 (499)
T PHA03171        217 FMNCKLNC  224 (499)
T ss_pred             eeeeEEEE
Confidence            36677655


No 28 
>COG1614 CdhC CO dehydrogenase/acetyl-CoA synthase beta subunit [Energy production and conversion]
Probab=42.05  E-value=13  Score=36.18  Aligned_cols=7  Identities=57%  Similarity=0.710  Sum_probs=2.8

Q ss_pred             ceeEEec
Q psy5811          13 GVVSISS   19 (329)
Q Consensus        13 ~~~~~~~   19 (329)
                      |.+.|++
T Consensus       327 GF~Gisi  333 (470)
T COG1614         327 GFVGISI  333 (470)
T ss_pred             ceeeeee
Confidence            3444443


No 29 
>KOG0699|consensus
Probab=40.80  E-value=5  Score=39.38  Aligned_cols=6  Identities=17%  Similarity=0.296  Sum_probs=2.4

Q ss_pred             Eeecch
Q psy5811         193 LQTYVP  198 (329)
Q Consensus       193 ~~iilP  198 (329)
                      -+.-+|
T Consensus       410 ~N~~Lp  415 (542)
T KOG0699|consen  410 KNQELP  415 (542)
T ss_pred             cccCCC
Confidence            333444


No 30 
>PF04712 Radial_spoke:  Radial spokehead-like protein
Probab=38.09  E-value=7.6  Score=39.79  Aligned_cols=12  Identities=0%  Similarity=-0.017  Sum_probs=8.9

Q ss_pred             EeeCCeEEEEec
Q psy5811          88 LINMALTLFCFR   99 (329)
Q Consensus        88 V~~dG~V~~~~r   99 (329)
                      |.++|++.|..+
T Consensus       343 Il~qGR~~~~~~  354 (491)
T PF04712_consen  343 ILPQGRCTWYNP  354 (491)
T ss_pred             cccCceEeCCCC
Confidence            568899988743


No 31 
>PTZ00248 eukaryotic translation initiation factor 2 subunit 1; Provisional
Probab=32.91  E-value=7.3  Score=37.68  Aligned_cols=6  Identities=33%  Similarity=0.756  Sum_probs=2.6

Q ss_pred             cceeEE
Q psy5811          12 GGVVSI   17 (329)
Q Consensus        12 ~~~~~~   17 (329)
                      ||-..+
T Consensus       260 gG~~~~  265 (319)
T PTZ00248        260 GGDFKV  265 (319)
T ss_pred             CCeEEE
Confidence            444444


No 32 
>PF04147 Nop14:  Nop14-like family ;  InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [].
Probab=32.57  E-value=6.8  Score=42.83  Aligned_cols=13  Identities=23%  Similarity=0.227  Sum_probs=7.9

Q ss_pred             ecccccccccccc
Q psy5811          98 FRLTLTATCKMFL  110 (329)
Q Consensus        98 ~r~~~~~~C~mdl  110 (329)
                      ..+-+++.||-.+
T Consensus       416 ~elPftf~~P~s~  428 (840)
T PF04147_consen  416 SELPFTFPCPSSH  428 (840)
T ss_pred             cCCCceecCCCCH
Confidence            4555667777554


No 33 
>PF04712 Radial_spoke:  Radial spokehead-like protein
Probab=32.10  E-value=12  Score=38.33  Aligned_cols=20  Identities=15%  Similarity=0.414  Sum_probs=8.0

Q ss_pred             eeEeeeeecccccccceEeee
Q psy5811         118 QTCPLLVGSFGYTSNDVKYKW  138 (329)
Q Consensus       118 Q~C~L~f~S~~y~~~ev~l~~  138 (329)
                      +-+.+.|| |+....+..|.+
T Consensus       436 ~f~niYiG-~G~K~~~~~f~P  455 (491)
T PF04712_consen  436 KFGNIYIG-WGLKNSDENFSP  455 (491)
T ss_pred             eEEEEEEe-cCccCCCCCCCC
Confidence            33444443 344444434433


No 34 
>PF08553 VID27:  VID27 cytoplasmic protein;  InterPro: IPR013863  This entry represents fungal and plant proteins and contains many hypothetical proteins. Vid27p is a cytoplasmic protein of unknown function, possibly regulates import of fructose-1,6-bisphosphatase into Vacuolar Import and Degradation (Vid) vesicles and is not essential for proteasome-dependent degradation of fructose-1,6-bisphosphatase (FBPase) [, ].
Probab=31.96  E-value=17  Score=39.42  Aligned_cols=12  Identities=33%  Similarity=0.528  Sum_probs=7.4

Q ss_pred             EEEEeecCcCCC
Q psy5811         240 SYLVLYPSLAPY  251 (329)
Q Consensus       240 ~~l~v~~~llp~  251 (329)
                      .||+++...+.-
T Consensus       639 tyLlLi~t~~~~  650 (794)
T PF08553_consen  639 TYLLLIDTLIKD  650 (794)
T ss_pred             ceEEEEEEeeec
Confidence            567766666553


No 35 
>PF04147 Nop14:  Nop14-like family ;  InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [].
Probab=31.94  E-value=7.3  Score=42.61  Aligned_cols=9  Identities=44%  Similarity=0.545  Sum_probs=3.4

Q ss_pred             hHHHHHHHH
Q psy5811         305 RLFLLTILL  313 (329)
Q Consensus       305 ~~~~~~~~~  313 (329)
                      |..+|..++
T Consensus       675 k~~lL~~~l  683 (840)
T PF04147_consen  675 KLSLLATAL  683 (840)
T ss_pred             HHHHHHHHH
Confidence            333333333


No 36 
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=30.76  E-value=9.1  Score=40.42  Aligned_cols=29  Identities=10%  Similarity=0.202  Sum_probs=19.4

Q ss_pred             EEEEEEEeccceeeEeecchhHHHHhhhheeee
Q psy5811         179 QINFQLKRNTGFFVLQTYVPCSLMVCSSWVSFW  211 (329)
Q Consensus       179 ~~~~~LkR~~~~yi~~iilP~~llvlLs~lsFw  211 (329)
                      .+.|.|=||..-|-...+-|.+..    -+..|
T Consensus       303 e~rl~LlRHWSLydSm~~S~yvas----kL~lW  331 (622)
T PF02724_consen  303 ELRLMLLRHWSLYDSMYHSSYVAS----KLKLW  331 (622)
T ss_pred             ccceeeeccCcHHHHHhhchhhHh----hcchh
Confidence            556777888888777777775433    44566


No 37 
>PF01056 Myc_N:  Myc amino-terminal region;  InterPro: IPR012682 The class III basic helix-turn-helix (bHLH) transcription factors have proliferative and apoptotic roles and are characterised by the presence of a leucine zipper adjacent to the bHLH domain. The myc oncogene gene was first discovered in small-cell lung cancer cell lines where it is found to be deregulated []. Although the biochemical function of the gene product is unknown, as a nuclear protein with a short half-life it may play a direct or indirect role in controlling gene expression []. Myc forms a heterodimer with Max, and this complex regulates cell growth through direct activation of genes involved in cell replication []. This entry represents the N-terminal domain found adjacent to the basic helix-loop-helix (bHLH) region (IPR001092 from INTERPRO).; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1EE4_C.
Probab=30.56  E-value=17  Score=35.38  Aligned_cols=11  Identities=18%  Similarity=0.226  Sum_probs=0.0

Q ss_pred             hhceeeecCcc
Q psy5811          62 QEEEFYTKSPK   72 (329)
Q Consensus        62 ~~~E~~t~s~~   72 (329)
                      ||-.+.|-.+|
T Consensus       242 EEIDVVTVEkr  252 (329)
T PF01056_consen  242 EEIDVVTVEKR  252 (329)
T ss_dssp             -----------
T ss_pred             cceEEEEeeec
Confidence            33344444443


No 38 
>PHA03171 UL37 tegument protein; Provisional
Probab=29.48  E-value=17  Score=36.01  Aligned_cols=10  Identities=20%  Similarity=0.345  Sum_probs=5.1

Q ss_pred             eeeechHHHH
Q psy5811          24 RVVVDDKRVK   33 (329)
Q Consensus        24 ~~~~~~~~~~   33 (329)
                      -+++|+|.++
T Consensus        58 ~gvi~ge~~~   67 (499)
T PHA03171         58 HGVIDGENSE   67 (499)
T ss_pred             cCcccCCCcc
Confidence            3456665443


No 39 
>KOG2395|consensus
Probab=28.76  E-value=27  Score=36.03  Aligned_cols=12  Identities=33%  Similarity=0.528  Sum_probs=7.0

Q ss_pred             EEEEeecCcCCC
Q psy5811         240 SYLVLYPSLAPY  251 (329)
Q Consensus       240 ~~l~v~~~llp~  251 (329)
                      .||+++...+.-
T Consensus       492 tyLlLi~t~~kd  503 (644)
T KOG2395|consen  492 TYLLLIDTLIKD  503 (644)
T ss_pred             cEEEEEEEeccc
Confidence            566666655533


No 40 
>PF15017 AF1Q:  Drug resistance and apoptosis regulator
Probab=25.69  E-value=9.9  Score=29.70  Aligned_cols=10  Identities=20%  Similarity=0.275  Sum_probs=3.7

Q ss_pred             hhhceeeecC
Q psy5811          61 EQEEEFYTKS   70 (329)
Q Consensus        61 ~~~~E~~t~s   70 (329)
                      ++.+=-.|.|
T Consensus        70 dD~gGWITPs   79 (87)
T PF15017_consen   70 DDGGGWITPS   79 (87)
T ss_pred             CCCCccccch
Confidence            3333333333


No 41 
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion]
Probab=25.23  E-value=31  Score=35.64  Aligned_cols=14  Identities=0%  Similarity=-0.259  Sum_probs=6.7

Q ss_pred             CceEEEeeCCeEEE
Q psy5811          83 RASILLINMALTLF   96 (329)
Q Consensus        83 ~~~v~V~~dG~V~~   96 (329)
                      +-+..|..+..|-.
T Consensus       428 n~rsyVtR~n~IGV  441 (776)
T COG5167         428 NERSYVTRGNSIGV  441 (776)
T ss_pred             ccceeEeeCCeeee
Confidence            44445555555443


No 42 
>PF03115 Astro_capsid:  Astrovirus capsid protein precursor;  InterPro: IPR004337 The astrovirus genome is apparently organised with nonstructural proteins encoded at the 5' end and structural proteins at the 3' end []. Proteins in this family are encoded by astrovirus ORF2, one of the three astrovirus ORFs (1a, 1b, 2). The proteins contain a viral RNA-dependent RNA polymerase motif []. The 87kDa precursor polyprotein undergoes an intracellular cleavage to form a 79kDa protein. Subsequently, extracellular trypsin cleavage yields the three proteins forming the infectious virion [].; PDB: 3QSQ_A 3TS3_D.
Probab=24.81  E-value=25  Score=38.17  Aligned_cols=14  Identities=21%  Similarity=0.095  Sum_probs=0.0

Q ss_pred             cCCCCcceeeEeee
Q psy5811         110 LRKFPFDTQTCPLL  123 (329)
Q Consensus       110 l~~FPFD~Q~C~L~  123 (329)
                      .+-||=+.|.+.-.
T Consensus       732 ~RAfPT~aek~~r~  745 (787)
T PF03115_consen  732 KRAFPTLAEKERRN  745 (787)
T ss_dssp             --------------
T ss_pred             hccCCCchhhhhhh
Confidence            35677666665543


No 43 
>PF04874 Mak16:  Mak16 protein C-terminal region;  InterPro: IPR006958 The function of these proteins is unknown. The yeast orthologues have been implicated in cell cycle progression and biogenesis of 60S ribosomal subunits. The Schistosoma mansoni (Blood fluke) Mak16 has been shown to target protein transport to the nucleolus [].
Probab=23.26  E-value=9.1  Score=30.74  Aligned_cols=7  Identities=14%  Similarity=0.558  Sum_probs=3.3

Q ss_pred             cccccce
Q psy5811           8 NSALGGV   14 (329)
Q Consensus         8 ~~~~~~~   14 (329)
                      +.+-|.+
T Consensus        36 ~G~Ygd~   42 (101)
T PF04874_consen   36 SGTYGDI   42 (101)
T ss_pred             cCCcccc
Confidence            3444544


No 44 
>KOG0299|consensus
Probab=23.11  E-value=28  Score=35.04  Aligned_cols=10  Identities=0%  Similarity=-0.323  Sum_probs=4.4

Q ss_pred             eCCeEEEEec
Q psy5811          90 NMALTLFCFR   99 (329)
Q Consensus        90 ~dG~V~~~~r   99 (329)
                      ..|+|.-...
T Consensus       115 ~~Gr~~r~~a  124 (479)
T KOG0299|consen  115 QSGRVRRLVA  124 (479)
T ss_pred             hcceeehhhh
Confidence            3455444433


No 45 
>PF00183 HSP90:  Hsp90 protein;  InterPro: IPR001404 Molecular chaperones, or heat shock proteins (Hsps) are ubiquitous proteins that act to maintain proper protein folding within the cell []. They assist in the folding of nascent polypeptide chains, and are also involved in the re-folding of denatured proteins following proteotoxic stress. As their name implies, the heat shock proteins were first identified as proteins that were up-regulated under conditions of elevated temperature. However, subsequent studies have shown that increased Hsp expression is induced by a variety of cellular stresses, including oxidative stress and inflammation. Five major Hsp families have been determined, and are categorized according to their molecular size (Hsp100, Hsp90, Hsp70, Hsp60, and the small Hsps). Hsps are involved in a variety of cellular processes that are ATP-dependent. These include: prevention of protein aggregation, protein degradation, protein trafficking, and maintenance of signalling proteins in a conformation that permits activation. Hsp90 chaperones are unique in their ability to regulate a specific subset of cellular signalling proteins that have been implicated in disease processes, including intracellular protein kinases, steroid hormone receptors, and growth factor receptors [].; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding, 0006950 response to stress; PDB: 3K99_D 2H55_A 3RLP_A 1OSF_A 3R4M_A 1YES_A 1UY9_A 3FT8_A 2YE2_A 2QF6_A ....
Probab=22.94  E-value=11  Score=39.07  Aligned_cols=40  Identities=13%  Similarity=-0.115  Sum_probs=18.8

Q ss_pred             ceEEEeeCCeEEEEeccccccccccccCCCCcceeeEeeeee
Q psy5811          84 ASILLINMALTLFCFRLTLTATCKMFLRKFPFDTQTCPLLVG  125 (329)
Q Consensus        84 ~~v~V~~dG~V~~~~r~~~~~~C~mdl~~FPFD~Q~C~L~f~  125 (329)
                      ..+...-+|.+.+..-+-+--.-|+++.  -.+.+...+.+.
T Consensus       124 ~~iH~~~eg~~~~~~lLyiP~~~p~~~~--~~~~~~~~ikLY  163 (531)
T PF00183_consen  124 FWIHFNAEGPFEFKSLLYIPKRAPFDLF--ENDKKKNGIKLY  163 (531)
T ss_dssp             EEEEEEEESSSEEEEEEEEESS-SCCCC--SSSTT--SEEEE
T ss_pred             hheeccccccceeeEEEEeCCCCchhhh--hhhhccccceee
Confidence            3344455677666655555554555543  233444455543


No 46 
>KOG2153|consensus
Probab=22.87  E-value=19  Score=37.86  Aligned_cols=11  Identities=27%  Similarity=0.528  Sum_probs=4.8

Q ss_pred             HHHHHHHHHhc
Q psy5811         308 LLTILLRNVFS  318 (329)
Q Consensus       308 ~~~~~~~~~~~  318 (329)
                      +|.+.-+|.|-
T Consensus       457 iLkiVFtiYFr  467 (704)
T KOG2153|consen  457 ILKIVFTIYFR  467 (704)
T ss_pred             HHHHHHHHHHH
Confidence            34444444443


No 47 
>KOG3803|consensus
Probab=22.55  E-value=35  Score=35.87  Aligned_cols=18  Identities=11%  Similarity=-0.049  Sum_probs=7.9

Q ss_pred             cchhHHHHhhhheeeecc
Q psy5811         196 YVPCSLMVCSSWVSFWID  213 (329)
Q Consensus       196 ilP~~llvlLs~lsFwlp  213 (329)
                      +=|.+|.+..+.+.--.|
T Consensus       371 ippeILamhe~vlkcptP  388 (968)
T KOG3803|consen  371 IPPEILAMHENVLKCPTP  388 (968)
T ss_pred             CCHHHHHHHHHhhcCCCC
Confidence            344444444444444444


No 48 
>KOG1144|consensus
Probab=22.10  E-value=98  Score=33.67  Aligned_cols=15  Identities=20%  Similarity=0.426  Sum_probs=8.2

Q ss_pred             ccccccCcccceeee
Q psy5811         279 RHYPLANNEAESVYS  293 (329)
Q Consensus       279 ~~~~~~~~~~~~~~~  293 (329)
                      ..|+++-|.--+-|-
T Consensus       593 tpFivALNKiDRLYg  607 (1064)
T KOG1144|consen  593 TPFIVALNKIDRLYG  607 (1064)
T ss_pred             CCeEEeehhhhhhcc
Confidence            346666666544443


No 49 
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=21.71  E-value=1e+02  Score=30.18  Aligned_cols=95  Identities=12%  Similarity=0.237  Sum_probs=0.0

Q ss_pred             echHHHHhhhhhhhHHHHHHHHHHHHHHHHHHHhhhhceeeecCccccccccccCCCceEEEeeCCeEEEEecccccccc
Q psy5811          27 VDDKRVKKIKMKEEEEEKEEEEQEEEEEEEEEEEEQEEEFYTKSPKCLELMLQCSPRASILLINMALTLFCFRLTLTATC  106 (329)
Q Consensus        27 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~~t~s~~s~~~~~~~~~~~~v~V~~dG~V~~~~r~~~~~~C  106 (329)
                      +|+..+....++++..++.+|++|+.+.++++++..+++-..-..............      .+-.|++..--..++.+
T Consensus       273 ~DG~~d~~~~e~~~~~~~~d~d~~~~~~~~~~~~~~~~~~~~~~dd~~~~~~~~~~~------~~~~~~c~~~kv~r~k~  346 (375)
T PF03153_consen  273 LDGAGDDSDDEEDDDDDDDDEDDEDKDKDEDDEDAINSDLDDSDDDVSDEDDEDDFD------TDNVVLCQYDKVTRVKN  346 (375)
T ss_dssp             -----------------------------------------------B-------ST------TS-EEEEEEEEEEEETT
T ss_pred             ccCCCCCccccccccccccccccccccccccccccccCCcCCccccccccccccccC------cCCEEEEEeeccccccc


Q ss_pred             ccccCCCCcceeeEeeeeecccccccceEee
Q psy5811         107 KMFLRKFPFDTQTCPLLVGSFGYTSNDVKYK  137 (329)
Q Consensus       107 ~mdl~~FPFD~Q~C~L~f~S~~y~~~ev~l~  137 (329)
                      .          -.|.|+=|--..++.+..|.
T Consensus       347 ~----------wk~~lk~g~~~~~~~d~~f~  367 (375)
T PF03153_consen  347 K----------WKCTLKDGIMHINGKDYVFQ  367 (375)
T ss_dssp             E----------EEEEEEEEEEEETTEEEEEE
T ss_pred             e----------eEEEeeeeEEEECCeEEEEe


No 50 
>KOG4264|consensus
Probab=21.69  E-value=9.8  Score=38.93  Aligned_cols=19  Identities=21%  Similarity=-0.099  Sum_probs=10.3

Q ss_pred             cCCchhhhhHHHHHHHHHH
Q psy5811         297 AEPKVYSTRLFLLTILLRN  315 (329)
Q Consensus       297 ~~~~~~~~~~~~~~~~~~~  315 (329)
                      +.|+.|+.|..=-+-+-|+
T Consensus       443 ~ap~~~s~~~~~q~ea~~~  461 (694)
T KOG4264|consen  443 RAPSHQSDRNDDQFEAHRR  461 (694)
T ss_pred             cccccccccchHHHHHHHH
Confidence            4566666665544444433


No 51 
>PF00183 HSP90:  Hsp90 protein;  InterPro: IPR001404 Molecular chaperones, or heat shock proteins (Hsps) are ubiquitous proteins that act to maintain proper protein folding within the cell []. They assist in the folding of nascent polypeptide chains, and are also involved in the re-folding of denatured proteins following proteotoxic stress. As their name implies, the heat shock proteins were first identified as proteins that were up-regulated under conditions of elevated temperature. However, subsequent studies have shown that increased Hsp expression is induced by a variety of cellular stresses, including oxidative stress and inflammation. Five major Hsp families have been determined, and are categorized according to their molecular size (Hsp100, Hsp90, Hsp70, Hsp60, and the small Hsps). Hsps are involved in a variety of cellular processes that are ATP-dependent. These include: prevention of protein aggregation, protein degradation, protein trafficking, and maintenance of signalling proteins in a conformation that permits activation. Hsp90 chaperones are unique in their ability to regulate a specific subset of cellular signalling proteins that have been implicated in disease processes, including intracellular protein kinases, steroid hormone receptors, and growth factor receptors [].; GO: 0005524 ATP binding, 0051082 unfolded protein binding, 0006457 protein folding, 0006950 response to stress; PDB: 3K99_D 2H55_A 3RLP_A 1OSF_A 3R4M_A 1YES_A 1UY9_A 3FT8_A 2YE2_A 2QF6_A ....
Probab=21.23  E-value=26  Score=36.38  Aligned_cols=7  Identities=14%  Similarity=0.069  Sum_probs=3.3

Q ss_pred             eEEeccc
Q psy5811          15 VSISSSQ   21 (329)
Q Consensus        15 ~~~~~~~   21 (329)
                      |++|+.-
T Consensus        19 i~~PI~l   25 (531)
T PF00183_consen   19 ISFPIYL   25 (531)
T ss_dssp             SSSEEEE
T ss_pred             cccceeE
Confidence            4455543


No 52 
>PF14153 Spore_coat_CotO:  Spore coat protein CotO
Probab=21.20  E-value=1.6e+02  Score=26.21  Aligned_cols=14  Identities=7%  Similarity=-0.038  Sum_probs=7.0

Q ss_pred             CCCceEEEeeCCeE
Q psy5811          81 SPRASILLINMALT   94 (329)
Q Consensus        81 ~~~~~v~V~~dG~V   94 (329)
                      +|...|.|--+|..
T Consensus       133 lp~i~C~i~t~~~~  146 (185)
T PF14153_consen  133 LPPIKCEIETKDKS  146 (185)
T ss_pred             CCCCceEEEeCCce
Confidence            45555555554443


No 53 
>PF08553 VID27:  VID27 cytoplasmic protein;  InterPro: IPR013863  This entry represents fungal and plant proteins and contains many hypothetical proteins. Vid27p is a cytoplasmic protein of unknown function, possibly regulates import of fructose-1,6-bisphosphatase into Vacuolar Import and Degradation (Vid) vesicles and is not essential for proteasome-dependent degradation of fructose-1,6-bisphosphatase (FBPase) [, ].
Probab=21.09  E-value=26  Score=38.12  Aligned_cols=11  Identities=0%  Similarity=0.069  Sum_probs=6.7

Q ss_pred             ccccceeeeee
Q psy5811         150 LELAQYALVNM  160 (329)
Q Consensus       150 ~~~~eW~l~~~  160 (329)
                      .-..+|++..-
T Consensus       515 KVV~eW~~~~~  525 (794)
T PF08553_consen  515 KVVEEWKVHDD  525 (794)
T ss_pred             cEEEEeecCCC
Confidence            34567777653


No 54 
>KOG4364|consensus
Probab=21.03  E-value=14  Score=38.88  Aligned_cols=38  Identities=21%  Similarity=0.450  Sum_probs=0.0

Q ss_pred             HHhhhhhhhHHHHHHHHHHHHHHHHHHH-hhhhceeeec
Q psy5811          32 VKKIKMKEEEEEKEEEEQEEEEEEEEEE-EEQEEEFYTK   69 (329)
Q Consensus        32 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~E~~t~   69 (329)
                      +.+++|+|+.-|.=-..|.+++++.||+ ||++..||+.
T Consensus       523 SDeEWEEEepGESlS~sEddedd~~eEd~edEdDgffVP  561 (811)
T KOG4364|consen  523 SDEEWEEEEPGESLSDSEDDEDDSLEEDCEDEDDGFFVP  561 (811)
T ss_pred             CcccccccCCCccccccccccccccccccccccCCeecC


No 55 
>KOG4101|consensus
Probab=20.93  E-value=77  Score=27.11  Aligned_cols=14  Identities=0%  Similarity=0.010  Sum_probs=10.3

Q ss_pred             ceEEEeeCCeEEEE
Q psy5811          84 ASILLINMALTLFC   97 (329)
Q Consensus        84 ~~v~V~~dG~V~~~   97 (329)
                      -.|+|.--|.|+..
T Consensus        38 ePvviRG~GniTVF   51 (175)
T KOG4101|consen   38 EPVVIRGAGNITVF   51 (175)
T ss_pred             CCeEEeccCceEEE
Confidence            46778888888754


Done!