Query         psy5836
Match_columns 66
No_of_seqs    207 out of 1024
Neff          8.0 
Searched_HMMs 46136
Date          Fri Aug 16 19:17:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5836.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5836hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14843 GF_recep_IV:  Growth f  99.5 1.1E-14 2.3E-19   85.3   3.0   58    2-64     29-97  (132)
  2 smart00261 FU Furin-like repea  99.4 5.2E-13 1.1E-17   65.2   2.9   45   18-64      2-46  (46)
  3 cd00064 FU Furin-like repeats.  99.3 1.9E-12 4.1E-17   64.1   2.5   42   22-65      1-42  (49)
  4 KOG1025|consensus               98.7 5.2E-09 1.1E-13   75.9   2.6   59    2-64    516-577 (1177)
  5 PTZ00214 high cysteine membran  98.7 8.5E-09 1.8E-13   74.3   3.5   62    3-65    560-627 (800)
  6 PF03302 VSP:  Giardia variant-  98.7 1.4E-08   3E-13   68.4   4.0   58    4-62     92-153 (397)
  7 PTZ00214 high cysteine membran  98.6 5.3E-08 1.1E-12   70.3   3.8   57    4-61    417-478 (800)
  8 PF14843 GF_recep_IV:  Growth f  98.6   3E-08 6.4E-13   58.1   1.8   38    2-39     85-132 (132)
  9 PF00757 Furin-like:  Furin-lik  98.4 1.4E-07 3.1E-12   56.3   2.6   42   17-64     47-89  (149)
 10 KOG4260|consensus               97.5 2.5E-05 5.5E-10   51.1  -0.0   48    7-56    183-235 (350)
 11 PF00757 Furin-like:  Furin-lik  97.4 8.2E-05 1.8E-09   44.5   1.2   53    2-64     77-129 (149)
 12 KOG4258|consensus               97.1 0.00026 5.7E-09   52.0   1.5   56    3-64    215-274 (1025)
 13 KOG1025|consensus               97.0  0.0003 6.5E-09   52.1   1.6   35   23-61    223-258 (1177)
 14 PTZ00382 Variant-specific surf  96.5   0.004 8.6E-08   34.8   3.0   49    2-55      4-54  (96)
 15 PF13948 DUF4215:  Domain of un  95.7  0.0068 1.5E-07   29.6   1.4   27   38-64      1-27  (47)
 16 PF07562 NCD3G:  Nine Cysteines  95.1  0.0071 1.5E-07   30.3   0.3   47    2-63      3-53  (54)
 17 PF03302 VSP:  Giardia variant-  94.5   0.028 6.1E-07   38.2   2.1   40    7-48    274-313 (397)
 18 cd00185 TNFR Tumor necrosis fa  93.6   0.099 2.1E-06   28.9   2.8   22    4-25     13-40  (98)
 19 KOG4258|consensus               93.4   0.024 5.1E-07   42.2   0.1   19    2-20    262-280 (1025)
 20 PF07699 GCC2_GCC3:  GCC2 and G  90.7    0.48   1E-05   22.8   3.0    9   37-45     27-35  (48)
 21 PHA02637 TNF-alpha-receptor-li  88.2    0.77 1.7E-05   27.0   3.0   42    7-48     31-75  (127)
 22 cd00185 TNFR Tumor necrosis fa  88.0     1.4 2.9E-05   24.2   3.8   12   52-65     75-86  (98)
 23 PHA02637 TNF-alpha-receptor-li  84.1     1.4   3E-05   25.9   2.7   40    3-42     42-87  (127)
 24 PF00020 TNFR_c6:  TNFR/NGFR cy  84.1    0.55 1.2E-05   21.5   0.8   16    8-23      1-18  (39)
 25 PF09064 Tme5_EGF_like:  Thromb  82.6    0.92   2E-05   20.8   1.2   14    7-20     21-34  (34)
 26 smart00208 TNFR Tumor necrosis  80.3     2.8   6E-05   18.9   2.5   16    8-23      1-18  (39)
 27 PF12662 cEGF:  Complement Clr-  76.6     1.7 3.6E-05   18.3   1.0   15   41-55      6-20  (24)
 28 KOG0196|consensus               72.8     5.5 0.00012   30.3   3.4   54    8-64    263-318 (996)
 29 PF12798 Fer4_3:  4Fe-4S bindin  70.7       1 2.2E-05   16.8  -0.4   10   52-61      5-14  (15)
 30 PHA02714 CD-30-like protein; P  70.1     2.6 5.5E-05   23.9   1.0   19    6-24     22-41  (110)
 31 PF12661 hEGF:  Human growth fa  64.3     3.3 7.1E-05   14.8   0.5    8   58-65      4-11  (13)
 32 PF09305 TACI-CRD2:  TACI, cyst  63.6     3.9 8.5E-05   19.4   0.8   22    7-28      2-26  (41)
 33 PF01826 TIL:  Trypsin Inhibito  61.0     3.7 8.1E-05   19.9   0.5   13    8-20     37-49  (55)
 34 PF12191 stn_TNFRSF12A:  Tumour  60.4     7.9 0.00017   22.8   1.8   34    6-42     34-68  (129)
 35 PF01683 EB:  EB module;  Inter  58.5      20 0.00043   17.1   3.0   13   51-65     36-48  (52)
 36 PF01607 CBM_14:  Chitin bindin  56.0       7 0.00015   18.1   1.0   16    6-21     29-45  (53)
 37 KOG2813|consensus               55.7       9  0.0002   26.2   1.7   31   17-47    234-268 (406)
 38 PF14670 FXa_inhibition:  Coagu  51.8       7 0.00015   17.8   0.6   10   40-49     22-31  (36)
 39 PF12800 Fer4_4:  4Fe-4S bindin  50.3      11 0.00023   14.3   0.9    9    2-10      8-16  (17)
 40 PF07974 EGF_2:  EGF-like domai  48.2      11 0.00023   16.7   0.9   12   52-65     19-30  (32)
 41 PF13922 PHD_3:  PHD domain of   47.8     4.2   9E-05   21.4  -0.6   25   17-42     43-68  (69)
 42 PF05571 DUF766:  Protein of un  47.0      12 0.00026   25.0   1.3   20    7-26     25-44  (296)
 43 KOG1836|consensus               41.6      30 0.00064   28.4   2.8   54    6-65    759-821 (1705)
 44 PF09257 BCMA-Tall_bind:  BCMA,  40.9       8 0.00017   17.9  -0.2   19   11-29      5-23  (39)
 45 PF12837 Fer4_6:  4Fe-4S bindin  40.8     6.3 0.00014   16.3  -0.5   10   52-61     13-22  (24)
 46 PF00037 Fer4:  4Fe-4S binding   40.4     7.7 0.00017   15.8  -0.3   10   52-61     12-21  (24)
 47 smart00180 EGF_Lam Laminin-typ  39.7      25 0.00054   16.5   1.5    8   57-64     33-40  (46)
 48 PF02822 Antistasin:  Antistasi  37.4      23 0.00049   14.9   1.0   18    4-22      6-23  (26)
 49 KOG0994|consensus               34.9      21 0.00046   28.6   1.1   18    7-24    949-968 (1758)
 50 KOG4611|consensus               34.5      24 0.00051   24.9   1.2   26    7-32    102-127 (747)
 51 COG1150 HdrC Heterodisulfide r  31.6      25 0.00054   22.2   0.9   14    2-15     45-58  (195)
 52 PF00008 EGF:  EGF-like domain   29.8      25 0.00054   15.2   0.5   13   51-65     19-31  (32)
 53 PF13746 Fer4_18:  4Fe-4S diclu  26.3      25 0.00054   18.0   0.2   11   52-62     56-66  (69)
 54 smart00494 ChtBD2 Chitin-bindi  25.9      51  0.0011   15.0   1.3   10    7-16     32-41  (56)
 55 KOG3744|consensus               25.7      34 0.00075   22.6   0.8   21    7-27     32-52  (311)
 56 PF13187 Fer4_9:  4Fe-4S diclus  25.7      19 0.00042   17.0  -0.3   12    2-13      6-17  (55)
 57 KOG3525|consensus               25.6      57  0.0012   22.8   1.9   39    4-45    207-245 (431)
 58 smart00289 WR1 Worm-specific r  25.2      59  0.0013   14.1   1.4    6   57-62     21-26  (38)
 59 PF07645 EGF_CA:  Calcium-bindi  25.1      26 0.00056   16.0   0.1   10   52-63     25-34  (42)
 60 TIGR03478 DMSO_red_II_bet DMSO  24.5      28 0.00061   23.5   0.2   26   35-61    188-213 (321)
 61 PF12838 Fer4_7:  4Fe-4S diclus  23.1      24 0.00051   16.6  -0.2   10    2-11      6-15  (52)
 62 PF04942 CC:  CC domain;  Inter  22.4      53  0.0012   14.9   0.9   14    7-20     19-32  (36)
 63 PF13484 Fer4_16:  4Fe-4S doubl  21.8      16 0.00035   18.1  -1.0   10    2-11      6-15  (67)

No 1  
>PF14843 GF_recep_IV:  Growth factor receptor domain IV; PDB: 1N8Z_C 1S78_A 3N85_A 2A91_A 3MZW_A 3BE1_A 3U2P_A 2AHX_B 3LTF_A 3I2T_A ....
Probab=99.51  E-value=1.1e-14  Score=85.32  Aligned_cols=58  Identities=47%  Similarity=1.171  Sum_probs=45.3

Q ss_pred             CcccccCCCCe-----eeCCccccccCcccc------ccCCCCCcccccccCCCccccccccccccccccCccc
Q psy5836           2 STCVSRCPPRS-----FPNQGGVCWPCHESC------ETCAGAGQDSCLTCAPAHLRVTDLAICLQQCPEGYFE   64 (66)
Q Consensus         2 ~~Cv~~C~~g~-----y~~~~~~C~~C~~~C------~~C~g~~~~~C~~C~~~~~~~~~~~~Cv~~Cp~g~y~   64 (66)
                      ++||.+||.++     |.+ .++|++||++|      .+|+||++++|++|+.  ++  +.++||..||.|+|.
T Consensus        29 g~Cv~~C~~~~~~~~~~~~-~~~C~~Ch~~C~~~~~~~~C~Gp~~~~C~~C~~--~~--~~~~Cv~~CP~~~~~   97 (132)
T PF14843_consen   29 GTCVASCPDGYYFDGSYED-SNTCQPCHPECLPSNGSETCTGPGADQCLSCAH--FR--DGGQCVSSCPEGTYG   97 (132)
T ss_dssp             TEEESSTSSSSSSSSEEEE-TTEEEE--TTB---TTSSSBSSSSTTTBSSBSS--EE--ETTEEESS--EEEEB
T ss_pred             Ccchhhccccccccccccc-CCcCcccChhhCccccCcCcCCCCcchhhhccc--cC--CCCcccCcCCCCCcc
Confidence            68999999763     333 79999999999      9999999999999994  44  479999999999643


No 2  
>smart00261 FU Furin-like repeats.
Probab=99.36  E-value=5.2e-13  Score=65.25  Aligned_cols=45  Identities=38%  Similarity=1.037  Sum_probs=40.9

Q ss_pred             cccccCccccccCCCCCcccccccCCCccccccccccccccccCccc
Q psy5836          18 GVCWPCHESCETCAGAGQDSCLTCAPAHLRVTDLAICLQQCPEGYFE   64 (66)
Q Consensus        18 ~~C~~C~~~C~~C~g~~~~~C~~C~~~~~~~~~~~~Cv~~Cp~g~y~   64 (66)
                      +.|.+||++|.+|.|+++++|++|..++++.  .++||..||+++|.
T Consensus         2 ~~C~~C~~~C~~C~~~~~~~C~~C~~~~~l~--~~~Cv~~C~~~~~~   46 (46)
T smart00261        2 GECKPCHPECATCTGPGPDDCTSCKHGFFLD--GGTCVSECPPGTYA   46 (46)
T ss_pred             CccccccccccccCCcCcCcCccCCcccCCC--CCCccCcCCCCccC
Confidence            5799999999999999999999999988775  48999999999884


No 3  
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=99.29  E-value=1.9e-12  Score=64.08  Aligned_cols=42  Identities=40%  Similarity=1.043  Sum_probs=38.0

Q ss_pred             cCccccccCCCCCcccccccCCCccccccccccccccccCcccC
Q psy5836          22 PCHESCETCAGAGQDSCLTCAPAHLRVTDLAICLQQCPEGYFES   65 (66)
Q Consensus        22 ~C~~~C~~C~g~~~~~C~~C~~~~~~~~~~~~Cv~~Cp~g~y~~   65 (66)
                      +||++|.+|+|+++++|++|..++++.  .++||..||+++|.+
T Consensus         1 ~C~~~C~~C~g~~~~~C~~C~~~~~~~--~~~Cv~~C~~~~~~~   42 (49)
T cd00064           1 PCHPSCATCTGPGPDQCTSCRHGFYLD--GGTCVSECPEGTYAD   42 (49)
T ss_pred             CCCCccCCCcCcCcCcCccCcCccCCC--CCcccccCCCCceec
Confidence            589999999999999999999998854  699999999999874


No 4  
>KOG1025|consensus
Probab=98.75  E-value=5.2e-09  Score=75.91  Aligned_cols=59  Identities=42%  Similarity=0.959  Sum_probs=48.4

Q ss_pred             CcccccCCC--Ceee-CCccccccCccccccCCCCCcccccccCCCccccccccccccccccCccc
Q psy5836           2 STCVSRCPP--RSFP-NQGGVCWPCHESCETCAGAGQDSCLTCAPAHLRVTDLAICLQQCPEGYFE   64 (66)
Q Consensus         2 ~~Cv~~C~~--g~y~-~~~~~C~~C~~~C~~C~g~~~~~C~~C~~~~~~~~~~~~Cv~~Cp~g~y~   64 (66)
                      ++||+.|..  |-+. ..+..|..||+.|+||+|+++++|+.|.  .|.  +...||..||+|--+
T Consensus       516 g~CVe~C~~l~g~~rf~~~~~C~~ChPEC~TCnG~G~d~C~~Ca--Hf~--dgp~CV~~CP~G~~G  577 (1177)
T KOG1025|consen  516 GTCVEKCNLLGGEPRFVNSRECERCHPECETCNGPGADNCLQCA--HFR--DGPHCVSDCPDGVTG  577 (1177)
T ss_pred             ceehhhccccCCcccccccceecccChhhccCCCCCccchhhhh--hcC--CCcchhccCCCcccC
Confidence            579999973  3333 3468999999999999999999999998  443  578999999998644


No 5  
>PTZ00214 high cysteine membrane protein Group 4; Provisional
Probab=98.74  E-value=8.5e-09  Score=74.30  Aligned_cols=62  Identities=21%  Similarity=0.588  Sum_probs=52.3

Q ss_pred             cccccCCCCeeeCCccccccCccccccCCCCCcccccccCCCcccccc----cccccc--ccccCcccC
Q psy5836           3 TCVSRCPPRSFPNQGGVCWPCHESCETCAGAGQDSCLTCAPAHLRVTD----LAICLQ--QCPEGYFES   65 (66)
Q Consensus         3 ~Cv~~C~~g~y~~~~~~C~~C~~~C~~C~g~~~~~C~~C~~~~~~~~~----~~~Cv~--~Cp~g~y~~   65 (66)
                      +|. +|..|||.+....|++|+++|.+|.++++.+|++|..+++|...    .+.||.  .|++|||.+
T Consensus       560 ~Ct-~C~~GYyl~~~~~C~~Cd~~C~~C~~~~~~~C~sC~~g~yL~~~~~~~~g~Cv~~~~C~~GYY~d  627 (800)
T PTZ00214        560 KCT-TTKKGYGISPDGKLLECDPTCLACTAPGPGRCTRCPSDKLLKRASGAATGSCVDPGACVDGYYAD  627 (800)
T ss_pred             ccc-ccccCcccCCCCccccccchhhhccCCCCCcceECCCCCEeccccccccccccCcccCCCCcccC
Confidence            454 57789998778889999999999999999999999999988532    357884  899999986


No 6  
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=98.72  E-value=1.4e-08  Score=68.36  Aligned_cols=58  Identities=38%  Similarity=0.966  Sum_probs=48.2

Q ss_pred             ccccCCCCeeeCCccccccCccccccCCCCCcccccccCCCcccccc----ccccccccccCc
Q psy5836           4 CVSRCPPRSFPNQGGVCWPCHESCETCAGAGQDSCLTCAPAHLRVTD----LAICLQQCPEGY   62 (66)
Q Consensus         4 Cv~~C~~g~y~~~~~~C~~C~~~C~~C~g~~~~~C~~C~~~~~~~~~----~~~Cv~~Cp~g~   62 (66)
                      +...||+|||.+ ++.|.+||++|.+|.++.+++|++|.++++|...    .++|+..|-++.
T Consensus        92 ~c~~C~~G~y~~-~~~C~~C~~~C~~C~~~~~~~Ct~C~~g~~L~~~~~~~~~tC~~~c~~~~  153 (397)
T PF03302_consen   92 CCSECPDGYYKN-GNKCVPCHESCATCSGGAPNQCTSCKPGKVLKYGTDGTKGTCGAECTEDC  153 (397)
T ss_pred             cccCCCCCcccc-CCCCCCCCccccccCCCCCCCCcccCCCcccccccCCCcCcccccccccc
Confidence            456899999985 6799999999999999999999999999987641    367887775543


No 7  
>PTZ00214 high cysteine membrane protein Group 4; Provisional
Probab=98.58  E-value=5.3e-08  Score=70.28  Aligned_cols=57  Identities=32%  Similarity=0.870  Sum_probs=48.2

Q ss_pred             ccccCCCCeeeCCccccccCccccccCCCCCcccccccCCCccccc-----cccccccccccC
Q psy5836           4 CVSRCPPRSFPNQGGVCWPCHESCETCAGAGQDSCLTCAPAHLRVT-----DLAICLQQCPEG   61 (66)
Q Consensus         4 Cv~~C~~g~y~~~~~~C~~C~~~C~~C~g~~~~~C~~C~~~~~~~~-----~~~~Cv~~Cp~g   61 (66)
                      |+..|++|||. ..+.|.+||++|.+|.++++..|++|.++++|..     ..++||..|+++
T Consensus       417 C~c~C~~G~y~-~~g~C~~C~~sCa~C~~~~~~~CtsC~~g~~L~~~~~~~~~gtCv~~C~~~  478 (800)
T PTZ00214        417 CRCVCKPTFYN-SSGTCTPCTDSCAVCKDGTPTGCQQCSPGKILEFSIVSSESADCVDQCSVG  478 (800)
T ss_pred             ccccCCCCccc-CCCCccCCCCcccccCCCCcCcCccCCCCcEecccccCCCCCceeccCCCC
Confidence            55578999996 4789999999999999999999999999987742     357899999864


No 8  
>PF14843 GF_recep_IV:  Growth factor receptor domain IV; PDB: 1N8Z_C 1S78_A 3N85_A 2A91_A 3MZW_A 3BE1_A 3U2P_A 2AHX_B 3LTF_A 3I2T_A ....
Probab=98.57  E-value=3e-08  Score=58.06  Aligned_cols=38  Identities=45%  Similarity=1.224  Sum_probs=28.4

Q ss_pred             CcccccCCCCe---------eeCCccccccCcccc-ccCCCCCccccc
Q psy5836           2 STCVSRCPPRS---------FPNQGGVCWPCHESC-ETCAGAGQDSCL   39 (66)
Q Consensus         2 ~~Cv~~C~~g~---------y~~~~~~C~~C~~~C-~~C~g~~~~~C~   39 (66)
                      ++||++||.|+         |.+..++|++||++| ..|+||.+.+|.
T Consensus        85 ~~Cv~~CP~~~~~~~~~~~~~~~~~~~C~~Ch~~C~~gC~Gp~~~~C~  132 (132)
T PF14843_consen   85 GQCVSSCPEGTYGENFPIYYYPDSNGVCQPCHPSCTQGCTGPSASDCQ  132 (132)
T ss_dssp             TEEESS--EEEEBTTSEEEEEE-TTSBEEE-STTSTT-BSSSSTTCC-
T ss_pred             CcccCcCCCCCccccccceecCCCCCccCCcCccccCcCCCCCcccCC
Confidence            57999999994         556689999999999 899999998873


No 9  
>PF00757 Furin-like:  Furin-like cysteine rich region;  InterPro: IPR006211 The furin-like cysteine rich region has been found in a variety of proteins from eukaryotes that are involved in the mechanism of signal transduction by receptor tyrosine kinases, which involves receptor aggregation [].; GO: 0004714 transmembrane receptor protein tyrosine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation, 0007169 transmembrane receptor protein tyrosine kinase signaling pathway, 0016020 membrane; PDB: 3U2P_A 2AHX_B 1N8Y_C 1IGR_A 1S78_A 3MZW_A 2A91_A 1N8Z_C 3N85_A 3H3B_B ....
Probab=98.45  E-value=1.4e-07  Score=56.34  Aligned_cols=42  Identities=40%  Similarity=1.120  Sum_probs=31.3

Q ss_pred             ccccccCcccc-ccCCCCCcccccccCCCccccccccccccccccCccc
Q psy5836          17 GGVCWPCHESC-ETCAGAGQDSCLTCAPAHLRVTDLAICLQQCPEGYFE   64 (66)
Q Consensus        17 ~~~C~~C~~~C-~~C~g~~~~~C~~C~~~~~~~~~~~~Cv~~Cp~g~y~   64 (66)
                      ...|  ||++| ..|+||++++|++|+  .+.+  +++||+.||+|+|.
T Consensus        47 ~~~C--Ch~eClGGC~gp~~~~C~aCr--~~~~--~g~Cv~~CP~~~Y~   89 (149)
T PF00757_consen   47 PGDC--CHEECLGGCSGPNPSDCYACR--HFSY--NGTCVEQCPPGKYE   89 (149)
T ss_dssp             CGGB----TTEESEESSSSTTSESCES--SEEE--TTEEESS-STT-EE
T ss_pred             cccc--hhHHHhhcCCCCCCCcCHHHh--CcCc--CCeecccCChhhcc
Confidence            4555  99999 689999999999999  3443  69999999999874


No 10 
>KOG4260|consensus
Probab=97.47  E-value=2.5e-05  Score=51.09  Aligned_cols=48  Identities=29%  Similarity=0.627  Sum_probs=40.1

Q ss_pred             cCCCCeeeC----CccccccCccccc-cCCCCCcccccccCCCcccccccccccc
Q psy5836           7 RCPPRSFPN----QGGVCWPCHESCE-TCAGAGQDSCLTCAPAHLRVTDLAICLQ   56 (66)
Q Consensus         7 ~C~~g~y~~----~~~~C~~C~~~C~-~C~g~~~~~C~~C~~~~~~~~~~~~Cv~   56 (66)
                      .|..+||..    +..+|.+||..|. .|+|+++.+|..|+.+|.|.  ...||+
T Consensus       183 ~Cg~eyfes~Rne~~lvCt~Ch~~C~~~Csg~~~k~C~kCkkGW~ld--e~gCvD  235 (350)
T KOG4260|consen  183 YCGIEYFESSRNEQHLVCTACHEGCLGVCSGESSKGCSKCKKGWKLD--EEGCVD  235 (350)
T ss_pred             ccchHHHHhhcccccchhhhhhhhhhcccCCCCCCChhhhcccceec--cccccc
Confidence            567778753    2689999999997 99999999999999999986  466664


No 11 
>PF00757 Furin-like:  Furin-like cysteine rich region;  InterPro: IPR006211 The furin-like cysteine rich region has been found in a variety of proteins from eukaryotes that are involved in the mechanism of signal transduction by receptor tyrosine kinases, which involves receptor aggregation [].; GO: 0004714 transmembrane receptor protein tyrosine kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation, 0007169 transmembrane receptor protein tyrosine kinase signaling pathway, 0016020 membrane; PDB: 3U2P_A 2AHX_B 1N8Y_C 1IGR_A 1S78_A 3MZW_A 2A91_A 1N8Z_C 3N85_A 3H3B_B ....
Probab=97.36  E-value=8.2e-05  Score=44.49  Aligned_cols=53  Identities=30%  Similarity=0.729  Sum_probs=30.6

Q ss_pred             CcccccCCCCeeeCCccccccCccccccCCCCCcccccccCCCccccccccccccccccCccc
Q psy5836           2 STCVSRCPPRSFPNQGGVCWPCHESCETCAGAGQDSCLTCAPAHLRVTDLAICLQQCPEGYFE   64 (66)
Q Consensus         2 ~~Cv~~C~~g~y~~~~~~C~~C~~~C~~C~g~~~~~C~~C~~~~~~~~~~~~Cv~~Cp~g~y~   64 (66)
                      ++||++||.|+|.- +.+|.. ...|..-..       .=.. ..++..++.||..||.||..
T Consensus        77 g~Cv~~CP~~~Y~~-~~rCVt-~~~C~~~~~-------~~~~-~~~~~~~~~Cv~~CP~gy~~  129 (149)
T PF00757_consen   77 GTCVEQCPPGKYEF-GRRCVT-KEECPSMCE-------SSKE-YPFLIFNGSCVRECPSGYME  129 (149)
T ss_dssp             TEEESS-STT-EEE-TTEEE--HSSHHCCTT-------TTST-TSEEEETTEEESS-TTTEEE
T ss_pred             CeecccCChhhccc-ccEeec-cccCCchhh-------cccc-cceeeeCCcccccCCCCCEE
Confidence            67999999999975 666653 234432211       0011 22223579999999999986


No 12 
>KOG4258|consensus
Probab=97.07  E-value=0.00026  Score=52.03  Aligned_cols=56  Identities=32%  Similarity=0.926  Sum_probs=40.3

Q ss_pred             cccccCCCCee--eCCccccccCcccc-ccCCCCCc-ccccccCCCccccccccccccccccCccc
Q psy5836           3 TCVSRCPPRSF--PNQGGVCWPCHESC-ETCAGAGQ-DSCLTCAPAHLRVTDLAICLQQCPEGYFE   64 (66)
Q Consensus         3 ~Cv~~C~~g~y--~~~~~~C~~C~~~C-~~C~g~~~-~~C~~C~~~~~~~~~~~~Cv~~Cp~g~y~   64 (66)
                      .|..+||..--  -++++.|  ||..| ..|..+.. +.|.+|+.  ++  .+|.||.+||.+||.
T Consensus       215 ~CQK~Cp~~~g~gC~ang~c--CH~eClGgC~~~~dptaC~aCr~--~y--~~G~CV~~Cp~~~Y~  274 (1025)
T KOG4258|consen  215 HCQKSCPENCGNGCTANGEC--CHEECLGGCSQPNDPTACVACRG--LY--DDGVCVEACPPDYYL  274 (1025)
T ss_pred             chhccCccccccCccccccc--ccHhhccCcCCCCChhHhHHhhc--cc--cCCceeccCCcchhh
Confidence            46667764221  2345565  99999 68998875 78999983  22  259999999999986


No 13 
>KOG1025|consensus
Probab=97.05  E-value=0.0003  Score=52.06  Aligned_cols=35  Identities=34%  Similarity=1.089  Sum_probs=29.1

Q ss_pred             Ccccc-ccCCCCCcccccccCCCccccccccccccccccC
Q psy5836          23 CHESC-ETCAGAGQDSCLTCAPAHLRVTDLAICLQQCPEG   61 (66)
Q Consensus        23 C~~~C-~~C~g~~~~~C~~C~~~~~~~~~~~~Cv~~Cp~g   61 (66)
                      ||..| ..|+||+..+|++|.  .|.  +.+.|+..||.-
T Consensus       223 Ch~~CagGCtGp~~~dC~AC~--~f~--d~G~C~~~CP~~  258 (1177)
T KOG1025|consen  223 CHSECAGGCTGPKDKDCIACR--KFN--DSGICVETCPQL  258 (1177)
T ss_pred             HHHHhccCCCCCCCCCeeeec--ccc--cCceecccCCCc
Confidence            89999 699999999999998  443  468888888865


No 14 
>PTZ00382 Variant-specific surface protein (VSP); Provisional
Probab=96.47  E-value=0.004  Score=34.79  Aligned_cols=49  Identities=24%  Similarity=0.667  Sum_probs=38.0

Q ss_pred             CcccccCCCCeeeCC-ccccccCc-cccccCCCCCcccccccCCCccccccccccc
Q psy5836           2 STCVSRCPPRSFPNQ-GGVCWPCH-ESCETCAGAGQDSCLTCAPAHLRVTDLAICL   55 (66)
Q Consensus         2 ~~Cv~~C~~g~y~~~-~~~C~~C~-~~C~~C~g~~~~~C~~C~~~~~~~~~~~~Cv   55 (66)
                      .+| ..|..|||.+. ...|.+|. +.|.+|.++  ..|..|..+|++.  .+.|+
T Consensus         4 ~~C-t~C~~g~~~~~~~~~C~~C~~~~C~~C~~~--~~C~~C~~GY~~~--~~~Cv   54 (96)
T PTZ00382          4 AVC-TSCDSDKKPNKDGSGCVLCSVGNCKSCVVD--GVCGECNSGFSLD--NGKCV   54 (96)
T ss_pred             ccc-CcCCCCCccCCCCCcCCcCCCCCCcCCCCC--CccccCcCCcccC--CCccc
Confidence            356 47899998865 45699998 599999864  5799999998764  56776


No 15 
>PF13948 DUF4215:  Domain of unknown function (DUF4215)
Probab=95.72  E-value=0.0068  Score=29.61  Aligned_cols=27  Identities=22%  Similarity=0.507  Sum_probs=22.1

Q ss_pred             ccccCCCccccccccccccccccCccc
Q psy5836          38 CLTCAPAHLRVTDLAICLQQCPEGYFE   64 (66)
Q Consensus        38 C~~C~~~~~~~~~~~~Cv~~Cp~g~y~   64 (66)
                      |+.|..+|++....++|++.|++|+..
T Consensus         1 C~~C~~G~~l~~~~~~C~~~CGDgii~   27 (47)
T PF13948_consen    1 CLQCQDGYYLNQNNNKCEPICGDGIIV   27 (47)
T ss_pred             CCcccCccEEcCCCCccccccCCCeEE
Confidence            678888998876678899999998653


No 16 
>PF07562 NCD3G:  Nine Cysteines Domain of family 3 GPCR;  InterPro: IPR011500 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes). They show considerable diversity at the sequence level, on the basis of which they can be separated into distinct groups. We use the term clan to describe the GPCRs, as they embrace a group of families for which there are indications of evolutionary relationship, but between which there is no statistically significant similarity in sequence []. The currently known clan members include the rhodopsin-like GPCRs, the secretin-like GPCRs, the cAMP receptors, the fungal mating pheromone receptors, and the metabotropic glutamate receptor family. There is a specialised database for GPCRs (http://www.gpcr.org/7tm/).  GPCR family 3 receptors (also known as family C) are structurally similar to other GPCRs, but do not show any significant sequence similarity and thus represent a distinct group. Structurally they are composed of four elements; an N-terminal signal sequence; a large hydrophilic extracellular agonist-binding region containing several conserved cysteine residues which could be involved in disulphide bonds; a shorter region containing seven transmembrane domains; and a C-terminal cytoplasmic domain of variable length []. Family 3 members include the metabotropic glutamate receptors, the extracellular calcium-sensing receptors, the gamma-amino-butyric acid (GABA) type B receptors, and the vomeronasal type-2 receptors [, , , ]. As these receptors regulate many important physiological processes they are potentially promising targets for drug development. This entry represents a conserved sequence, found in the extracellular region, that contains several highly-conserved Cys residues that are predicted to form disulphide bridges.; GO: 0004930 G-protein coupled receptor activity, 0007186 G-protein coupled receptor protein signaling pathway; PDB: 2E4X_B 2E4Y_A 2E4U_B 2E4V_B 2E4W_A.
Probab=95.08  E-value=0.0071  Score=30.28  Aligned_cols=47  Identities=32%  Similarity=0.848  Sum_probs=23.2

Q ss_pred             CcccccCCCCeeeCC---ccccccCccccccCCCCCcccccccCCCccccc-cccccccccccCcc
Q psy5836           2 STCVSRCPPRSFPNQ---GGVCWPCHESCETCAGAGQDSCLTCAPAHLRVT-DLAICLQQCPEGYF   63 (66)
Q Consensus         2 ~~Cv~~C~~g~y~~~---~~~C~~C~~~C~~C~g~~~~~C~~C~~~~~~~~-~~~~Cv~~Cp~g~y   63 (66)
                      .+|...|+.|++...   ...|         |.     +|+.|..+.+... +...|+ .||+|++
T Consensus         3 S~CS~~C~pG~~k~~~~~~~~C---------Cw-----~C~~C~~~~is~~~~~~~C~-~C~~~~w   53 (54)
T PF07562_consen    3 SVCSEPCPPGQRKKIQKGQPSC---------CW-----DCVPCPEGEISNQTDSTSCT-KCPEGQW   53 (54)
T ss_dssp             --SS----TTTEEEE--SSS-S----------------EEEE--TTEEEE--ETTEEE-E--TTEE
T ss_pred             cccCCCCCCCCEECccCCCcce---------EE-----EeecCCCCcEECCCCccccc-cCCCccC
Confidence            578999999998743   3334         22     6788887777653 456787 6888876


No 17 
>PF03302 VSP:  Giardia variant-specific surface protein;  InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein).
Probab=94.48  E-value=0.028  Score=38.22  Aligned_cols=40  Identities=28%  Similarity=0.761  Sum_probs=29.9

Q ss_pred             cCCCCeeeCCccccccCccccccCCCCCcccccccCCCcccc
Q psy5836           7 RCPPRSFPNQGGVCWPCHESCETCAGAGQDSCLTCAPAHLRV   48 (66)
Q Consensus         7 ~C~~g~y~~~~~~C~~C~~~C~~C~g~~~~~C~~C~~~~~~~   48 (66)
                      .|..|||.+ ...|.+|+..|.+|.+ ....|++|..++|+.
T Consensus       274 ~C~~g~~~~-~~~C~~C~~~c~tC~g-~~~~Ct~C~~Gyy~~  313 (397)
T PF03302_consen  274 TCANGYYKD-VGGCTKCTAGCATCTG-DAATCTACADGYYKS  313 (397)
T ss_pred             cccCCcccc-ccccccCCCcccccCC-ccccccchhcccccc
Confidence            566677764 6788888888888885 457888888887753


No 18 
>cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains. When bound to TNF-like cytokines, TNFRs trigger multiple signal transduction pathways, they are involved in inflammation response, apoptosis, autoimmunity and organogenesis. TNFRs domains are elongated with generally three tandem repeats of cysteine-rich domains (CRDs). They fit in the grooves between protomers within the ligand trimer. Some TNFRs, such as NGFR and HveA, bind ligands with no structural similarity to TNF and do not bind ligand trimers.
Probab=93.58  E-value=0.099  Score=28.86  Aligned_cols=22  Identities=36%  Similarity=1.105  Sum_probs=11.7

Q ss_pred             ccccCCCCeeeCC------ccccccCcc
Q psy5836           4 CVSRCPPRSFPNQ------GGVCWPCHE   25 (66)
Q Consensus         4 Cv~~C~~g~y~~~------~~~C~~C~~   25 (66)
                      |-..||.|++...      +.+|.+|.+
T Consensus        13 cC~~C~pG~~~~~~C~~~~~t~C~~C~~   40 (98)
T cd00185          13 CCDQCPPGTYLSKDCTPGSDTVCEPCPP   40 (98)
T ss_pred             CCCCCCCCccCCCcCCCCCCCeecCCCC
Confidence            3456777766532      244555544


No 19 
>KOG4258|consensus
Probab=93.41  E-value=0.024  Score=42.24  Aligned_cols=19  Identities=32%  Similarity=0.819  Sum_probs=15.5

Q ss_pred             CcccccCCCCeeeCCcccc
Q psy5836           2 STCVSRCPPRSFPNQGGVC   20 (66)
Q Consensus         2 ~~Cv~~C~~g~y~~~~~~C   20 (66)
                      +.||.+||.++|...+.+|
T Consensus       262 G~CV~~Cp~~~Y~~e~~RC  280 (1025)
T KOG4258|consen  262 GVCVEACPPDYYLFENWRC  280 (1025)
T ss_pred             CceeccCCcchhhhcccee
Confidence            5799999999998766555


No 20 
>PF07699 GCC2_GCC3:  GCC2 and GCC3;  InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   This entry represents various ephrin type A and B receptors, which have tyrosine kinase activity.
Probab=90.73  E-value=0.48  Score=22.77  Aligned_cols=9  Identities=44%  Similarity=1.191  Sum_probs=4.0

Q ss_pred             cccccCCCc
Q psy5836          37 SCLTCAPAH   45 (66)
Q Consensus        37 ~C~~C~~~~   45 (66)
                      .|+.|..+.
T Consensus        27 ~C~~Cp~g~   35 (48)
T PF07699_consen   27 SCTPCPPGS   35 (48)
T ss_pred             cCccCcCCC
Confidence            444444443


No 21 
>PHA02637 TNF-alpha-receptor-like protein; Provisional
Probab=88.20  E-value=0.77  Score=27.00  Aligned_cols=42  Identities=14%  Similarity=0.519  Sum_probs=28.3

Q ss_pred             cCCCCeeeCCccccccCcccc---ccCCCCCcccccccCCCcccc
Q psy5836           7 RCPPRSFPNQGGVCWPCHESC---ETCAGAGQDSCLTCAPAHLRV   48 (66)
Q Consensus         7 ~C~~g~y~~~~~~C~~C~~~C---~~C~g~~~~~C~~C~~~~~~~   48 (66)
                      .|.++.|...+.-|.+|.+.=   .-|+..+.+.|..|..+.|+.
T Consensus        31 ~C~e~EY~~~~~CC~kCPPGt~v~~~Ct~~t~T~C~PCp~GTYTe   75 (127)
T PHA02637         31 KCKDNEYKRHNLCCLSCPPGTYASRLCDIKTNTQCTPCGSGTFTS   75 (127)
T ss_pred             CCCCCcCcCCCeEcCCCCCCCEEeCcCCCCCCcccccCCCCCeec
Confidence            566666654456677776554   456666677888888887654


No 22 
>cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains. When bound to TNF-like cytokines, TNFRs trigger multiple signal transduction pathways, they are involved in inflammation response, apoptosis, autoimmunity and organogenesis. TNFRs domains are elongated with generally three tandem repeats of cysteine-rich domains (CRDs). They fit in the grooves between protomers within the ligand trimer. Some TNFRs, such as NGFR and HveA, bind ligands with no structural similarity to TNF and do not bind ligand trimers.
Probab=87.96  E-value=1.4  Score=24.24  Aligned_cols=12  Identities=25%  Similarity=0.913  Sum_probs=7.7

Q ss_pred             cccccccccCcccC
Q psy5836          52 AICLQQCPEGYFES   65 (66)
Q Consensus        52 ~~Cv~~Cp~g~y~~   65 (66)
                      ..|.  |++|||.+
T Consensus        75 t~C~--C~~G~y~~   86 (98)
T cd00185          75 TVCG--CKPGFYCL   86 (98)
T ss_pred             CeEe--CCCCCEec
Confidence            4554  78887753


No 23 
>PHA02637 TNF-alpha-receptor-like protein; Provisional
Probab=84.11  E-value=1.4  Score=25.93  Aligned_cols=40  Identities=28%  Similarity=0.751  Sum_probs=22.1

Q ss_pred             cccccCCCCeeeCC------ccccccCccccccCCCCCcccccccC
Q psy5836           3 TCVSRCPPRSFPNQ------GGVCWPCHESCETCAGAGQDSCLTCA   42 (66)
Q Consensus         3 ~Cv~~C~~g~y~~~------~~~C~~C~~~C~~C~g~~~~~C~~C~   42 (66)
                      .|-..||.|+|...      ..+|.+|.+.=.+=..-....|+.|.
T Consensus        42 ~CC~kCPPGt~v~~~Ct~~t~T~C~PCp~GTYTe~~N~~~~C~~C~   87 (127)
T PHA02637         42 LCCLSCPPGTYASRLCDIKTNTQCTPCGSGTFTSHNNHLPACLSCN   87 (127)
T ss_pred             eEcCCCCCCCEEeCcCCCCCCcccccCCCCCeeccCCCCCcccccC
Confidence            45667888877632      34676776553322223345666665


No 24 
>PF00020 TNFR_c6:  TNFR/NGFR cysteine-rich region;  InterPro: IPR001368 A number of proteins, some of which are known to be receptors for growth factors have been found to contain a cysteine-rich domain at the N-terminal region that can be subdivided into four (or in some cases, three) repeats containing six conserved cysteines all of which are involved in intrachain disulphide bonds [].  CD27 (also called S152 or T14) mediates a co-stimulatory signal for T and B cell activation and is involved in murine T cell development. Tyrosine-phosphorylation of ZAP-70 following CD27 ligation of T cells has been reported [], but not confirmed independently. CD30 was originally identified as Ki-1, an antigen expressed on Reed-Sternberg cells in Hodgkin's lymphomas and other non-Hodgkin's lymphomas, particularly diffuse large-cell lymphoma and immunoblastic lymphoma. CD30 has pleiotropic effects on CD30-positive lymphoma cell lines ranging from cell proliferation to cell death. It is thought to be involved in negative selection of T-cells in the thymus and is involved in TCR-mediated cell death. CD30 is a member of the TNFR family of molecules, activate NFkB through interaction with TRAF2 and TRAF5. CD40 (Bp50) plays a central role in the regulation of cell-mediated immunity as well as antibody mediated immunity. It is central to T cell dependent (TD)-responses and may influence survival of B cell lymphomas. CD95 (also called APO-1, fas antigen, Fas tumour necrosis factor receptor superfamily, member 6, TNFRSF6 or apoptosis antigen 1, APT1) is expressed, typically at high levels, on activated T and B cells. It is involved in the mediation of apoptosis-inducing signals.  Other proteins known to belong to this family [, , , ] are, tumour Necrosis Factor type I and type II receptors (TNFR), Rabbit fibroma virus soluble TNF receptor (protein T2), lymphotoxin alpha/beta receptor, low-affinity nerve growth factor receptor (LA-NGFR) (p75), T-cell antigen OX40, Wsl-1, a receptor (for a yet undefined ligand) that mediates apoptosis and Vaccinia virus protein A53 (SalF19R). CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/).; GO: 0005488 binding; PDB: 3TJE_F 3QD6_S 3ALQ_U 3IJ2_Y 3BUK_D 1SG1_X 1NCF_B 1EXT_A 1FT4_B 1TNR_R ....
Probab=84.09  E-value=0.55  Score=21.54  Aligned_cols=16  Identities=38%  Similarity=1.271  Sum_probs=10.2

Q ss_pred             CCCCeeeCCc--cccccC
Q psy5836           8 CPPRSFPNQG--GVCWPC   23 (66)
Q Consensus         8 C~~g~y~~~~--~~C~~C   23 (66)
                      |+.|+|.+..  ..|.+|
T Consensus         1 C~~g~y~~~~~~~~C~~C   18 (39)
T PF00020_consen    1 CPPGTYSDSENHPQCLPC   18 (39)
T ss_dssp             ECTTEEEESSCSSSEEEE
T ss_pred             CccCcccCCCCCCcCCcc
Confidence            6888888642  455444


No 25 
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=82.62  E-value=0.92  Score=20.80  Aligned_cols=14  Identities=29%  Similarity=0.838  Sum_probs=10.3

Q ss_pred             cCCCCeeeCCcccc
Q psy5836           7 RCPPRSFPNQGGVC   20 (66)
Q Consensus         7 ~C~~g~y~~~~~~C   20 (66)
                      .||+||..+.+..|
T Consensus        21 ~CPeGyIlde~~~c   34 (34)
T PF09064_consen   21 FCPEGYILDEGSMC   34 (34)
T ss_pred             eCCCceEecCCccC
Confidence            48899988776554


No 26 
>smart00208 TNFR Tumor necrosis factor receptor / nerve growth factor receptor repeats. Repeats in growth factor receptors that are involved in growth factor binding. TNF/TNFR
Probab=80.29  E-value=2.8  Score=18.87  Aligned_cols=16  Identities=25%  Similarity=0.877  Sum_probs=9.6

Q ss_pred             CCCCeeeCCc--cccccC
Q psy5836           8 CPPRSFPNQG--GVCWPC   23 (66)
Q Consensus         8 C~~g~y~~~~--~~C~~C   23 (66)
                      |+.|+|.+..  ..|++|
T Consensus         1 C~~g~y~~~~~~~~C~~C   18 (39)
T smart00208        1 CKEGTYCSDGNHSSCLRC   18 (39)
T ss_pred             CCCCeecCCCCCccCccC
Confidence            6778887643  345444


No 27 
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=76.64  E-value=1.7  Score=18.31  Aligned_cols=15  Identities=27%  Similarity=0.437  Sum_probs=7.0

Q ss_pred             cCCCccccccccccc
Q psy5836          41 CAPAHLRVTDLAICL   55 (66)
Q Consensus        41 C~~~~~~~~~~~~Cv   55 (66)
                      |.+||.|..+...|+
T Consensus         6 C~~Gy~l~~d~~~C~   20 (24)
T PF12662_consen    6 CPPGYQLSPDGRSCE   20 (24)
T ss_pred             CCCCCcCCCCCCccc
Confidence            455554444444444


No 28 
>KOG0196|consensus
Probab=72.79  E-value=5.5  Score=30.35  Aligned_cols=54  Identities=24%  Similarity=0.650  Sum_probs=24.0

Q ss_pred             CCCCeeeC-CccccccCccccccCCCCCcccccccCCCccccc-cccccccccccCccc
Q psy5836           8 CPPRSFPN-QGGVCWPCHESCETCAGAGQDSCLTCAPAHLRVT-DLAICLQQCPEGYFE   64 (66)
Q Consensus         8 C~~g~y~~-~~~~C~~C~~~C~~C~g~~~~~C~~C~~~~~~~~-~~~~Cv~~Cp~g~y~   64 (66)
                      |..||-.. .+..|++|.+.-..=.. +...|..|+++-.... ....|.  |-.|||.
T Consensus       263 C~aGye~~~~~~~C~aCp~G~yK~~~-~~~~C~~CP~~S~s~~ega~~C~--C~~gyyR  318 (996)
T KOG0196|consen  263 CKAGYEEAENGKACQACPPGTYKASQ-GDSLCLPCPPNSHSSSEGATSCT--CENGYYR  318 (996)
T ss_pred             ecCCCCcccCCCcceeCCCCcccCCC-CCCCCCCCCCCCCCCCCCCCccc--ccCCccc
Confidence            44554331 24555555544322111 2345666665443321 123443  6666663


No 29 
>PF12798 Fer4_3:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=70.72  E-value=1  Score=16.80  Aligned_cols=10  Identities=40%  Similarity=1.291  Sum_probs=7.3

Q ss_pred             cccccccccC
Q psy5836          52 AICLQQCPEG   61 (66)
Q Consensus        52 ~~Cv~~Cp~g   61 (66)
                      +.|+..||.|
T Consensus         5 ~~C~~~Cp~~   14 (15)
T PF12798_consen    5 GACVEVCPTG   14 (15)
T ss_pred             hHHHHHhcCC
Confidence            5678888865


No 30 
>PHA02714 CD-30-like protein; Provisional
Probab=70.08  E-value=2.6  Score=23.91  Aligned_cols=19  Identities=26%  Similarity=0.807  Sum_probs=15.3

Q ss_pred             ccCCCCeeeCC-ccccccCc
Q psy5836           6 SRCPPRSFPNQ-GGVCWPCH   24 (66)
Q Consensus         6 ~~C~~g~y~~~-~~~C~~C~   24 (66)
                      .+|+.+||.|. ...|.+|-
T Consensus        22 kqC~~dYY~Dpe~g~CtACV   41 (110)
T PHA02714         22 KTCPKDYYLEPEDGLCTACV   41 (110)
T ss_pred             ccCCCcccccCCCCceeeec
Confidence            47999999984 78888773


No 31 
>PF12661 hEGF:  Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A.
Probab=64.35  E-value=3.3  Score=14.82  Aligned_cols=8  Identities=38%  Similarity=1.111  Sum_probs=4.7

Q ss_pred             cccCcccC
Q psy5836          58 CPEGYFES   65 (66)
Q Consensus        58 Cp~g~y~~   65 (66)
                      ||+||..+
T Consensus         4 C~~G~~G~   11 (13)
T PF12661_consen    4 CPPGWTGP   11 (13)
T ss_dssp             E-TTEETT
T ss_pred             CcCCCcCC
Confidence            77887654


No 32 
>PF09305 TACI-CRD2:  TACI, cysteine-rich domain;  InterPro: IPR015384 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  This entry represents a cysteine-rich domain found in the TACI family of proteins. Members of this family are predominantly found in tumour necrosis factor receptor superfamily, member 13b (TACI), and are required for binding to the ligands APRIL and BAFF []. ; PDB: 1XU1_T 1XUT_A.
Probab=63.59  E-value=3.9  Score=19.43  Aligned_cols=22  Identities=23%  Similarity=0.674  Sum_probs=14.9

Q ss_pred             cCCC--CeeeCC-ccccccCccccc
Q psy5836           7 RCPP--RSFPNQ-GGVCWPCHESCE   28 (66)
Q Consensus         7 ~C~~--g~y~~~-~~~C~~C~~~C~   28 (66)
                      +|+.  |.|+|. -+.|..|.+.|.
T Consensus         2 sC~keqg~YyD~LL~~CisC~siCg   26 (41)
T PF09305_consen    2 SCPKEQGQYYDPLLRDCISCKSICG   26 (41)
T ss_dssp             ---GGGTEEEETTTTEEEEGGGTTT
T ss_pred             CchhhhhHHHHHHHHHHccchhhhc
Confidence            4553  567766 789999998886


No 33 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=61.03  E-value=3.7  Score=19.91  Aligned_cols=13  Identities=46%  Similarity=1.132  Sum_probs=7.1

Q ss_pred             CCCCeeeCCcccc
Q psy5836           8 CPPRSFPNQGGVC   20 (66)
Q Consensus         8 C~~g~y~~~~~~C   20 (66)
                      |+.||+.+.++.|
T Consensus        37 C~~G~v~~~~~~C   49 (55)
T PF01826_consen   37 CPPGYVRNDNGRC   49 (55)
T ss_dssp             ETTTEEEETTSEE
T ss_pred             CCCCeeEcCCCCE
Confidence            4666666544444


No 34 
>PF12191 stn_TNFRSF12A:  Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain;  InterPro: IPR022316 The tumour necrosis factor (TNF) receptor (TNFR) superfamily comprises more than 20 type-I transmembrane proteins. Family members are defined based on similarity in their extracellular domain - a region that contains many cysteine residues arranged in a specific repetitive pattern []. The cysteines allow formation of an extended rod-like structure, responsible for ligand binding []. Upon receptor activation, different intracellular signalling complexes are assembled for different members of the TNFR superfamily, depending on their intracellular domains and sequences []. Activation of TNFRs can therefore induce a range of disparate effects, including cell proliferation, differentiation, survival, or apoptotic cell death, depending upon the receptor involved []. TNFRs are widely distributed and play important roles in many crucial biological processes, such as lymphoid and neuronal development, innate and adaptive immunity, and maintenance of cellular homeostasis []. Drugs that manipulate their signalling have potential roles in the prevention and treatment of many diseases, such as viral infections, coronary heart disease, transplant rejection, and immune disease []. TNF receptor 12 (also known as TWEAK receptor, and fibroblast growth factor-inducible-14 (Fn14)) has been implicated in endothelial cell growth and migration []. The receptor may also play a role in cell-matrix interactions [].; PDB: 2KN0_A 2RPJ_A 2KMZ_A 2EQP_A.
Probab=60.42  E-value=7.9  Score=22.82  Aligned_cols=34  Identities=26%  Similarity=0.544  Sum_probs=19.6

Q ss_pred             ccCCCCeeeCC-ccccccCccccccCCCCCcccccccC
Q psy5836           6 SRCPPRSFPNQ-GGVCWPCHESCETCAGAGQDSCLTCA   42 (66)
Q Consensus         6 ~~C~~g~y~~~-~~~C~~C~~~C~~C~g~~~~~C~~C~   42 (66)
                      ..||.|+..+. ...|.+|. +|.+  -|....|..|.
T Consensus        34 ~~Cp~G~sWs~dLdkCm~Cs-sC~~--~P~S~~C~~C~   68 (129)
T PF12191_consen   34 TPCPRGSSWSADLDKCMSCS-SCPA--YPKSPFCQGCP   68 (129)
T ss_dssp             SSS-SSEEEETTTTEEEECC-CHCC---TT-CCCCCHS
T ss_pred             CCCCCCCcCcccccccccCc-cCCC--CCCCccccCCC
Confidence            47999998765 66887774 3322  23345566665


No 35 
>PF01683 EB:  EB module;  InterPro: IPR006149  The EB domain has no known function. It is found in several Caenorhabditis sp. and Drosophila sp. proteins. The domain contains 8 conserved cysteines that probably form four disulphide bridges and is found associated with kunitz domains IPR002223 from INTERPRO 
Probab=58.54  E-value=20  Score=17.06  Aligned_cols=13  Identities=46%  Similarity=1.042  Sum_probs=9.2

Q ss_pred             ccccccccccCcccC
Q psy5836          51 LAICLQQCPEGYFES   65 (66)
Q Consensus        51 ~~~Cv~~Cp~g~y~~   65 (66)
                      .+.|+  |++||...
T Consensus        36 ~g~C~--C~~g~~~~   48 (52)
T PF01683_consen   36 NGRCQ--CPPGYVEV   48 (52)
T ss_pred             CCEeE--CCCCCEec
Confidence            46776  99987654


No 36 
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=55.98  E-value=7  Score=18.12  Aligned_cols=16  Identities=25%  Similarity=0.625  Sum_probs=7.7

Q ss_pred             ccCCCCeeeCC-ccccc
Q psy5836           6 SRCPPRSFPNQ-GGVCW   21 (66)
Q Consensus         6 ~~C~~g~y~~~-~~~C~   21 (66)
                      ..||.|++.|. .++|.
T Consensus        29 ~~C~~g~~fd~~~~~C~   45 (53)
T PF01607_consen   29 QRCPEGLYFDPSSQRCV   45 (53)
T ss_dssp             EE-TTS-EE-TTTSSEE
T ss_pred             CCCcCCCEECcCcCEEc
Confidence            46788777664 45543


No 37 
>KOG2813|consensus
Probab=55.66  E-value=9  Score=26.22  Aligned_cols=31  Identities=35%  Similarity=0.985  Sum_probs=24.2

Q ss_pred             ccccccCc----cccccCCCCCcccccccCCCccc
Q psy5836          17 GGVCWPCH----ESCETCAGAGQDSCLTCAPAHLR   47 (66)
Q Consensus        17 ~~~C~~C~----~~C~~C~g~~~~~C~~C~~~~~~   47 (66)
                      ..+|..||    ..|.+|.|.+..-|++|.....|
T Consensus       234 ~~~C~~C~G~G~~~C~tC~grG~k~C~TC~gtgsl  268 (406)
T KOG2813|consen  234 HDLCYMCHGRGIKECHTCKGRGKKPCTTCSGTGSL  268 (406)
T ss_pred             cchhhhccCCCcccCCcccCCCCcccccccCccce
Confidence            56788887    46889999999999999865444


No 38 
>PF14670 FXa_inhibition:  Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A ....
Probab=51.83  E-value=7  Score=17.83  Aligned_cols=10  Identities=20%  Similarity=0.497  Sum_probs=3.7

Q ss_pred             ccCCCccccc
Q psy5836          40 TCAPAHLRVT   49 (66)
Q Consensus        40 ~C~~~~~~~~   49 (66)
                      +|+.+|.|..
T Consensus        22 ~C~~Gy~L~~   31 (36)
T PF14670_consen   22 SCPPGYKLAE   31 (36)
T ss_dssp             E-STTEEE-T
T ss_pred             ECCCCCEECc
Confidence            3455554443


No 39 
>PF12800 Fer4_4:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 1BD6_A 1BQX_A 1BWE_A 1BC6_A.
Probab=50.32  E-value=11  Score=14.27  Aligned_cols=9  Identities=44%  Similarity=1.276  Sum_probs=5.9

Q ss_pred             CcccccCCC
Q psy5836           2 STCVSRCPP   10 (66)
Q Consensus         2 ~~Cv~~C~~   10 (66)
                      +.|+..||.
T Consensus         8 ~~C~~~Cp~   16 (17)
T PF12800_consen    8 GSCVDVCPT   16 (17)
T ss_dssp             SSSTTTSTT
T ss_pred             chHHhhccC
Confidence            357777774


No 40 
>PF07974 EGF_2:  EGF-like domain;  InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. The list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied. The functional significance of EGF domains in what appear to be unrelated proteins is not yet clear. However, a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF domain includes six cysteine residues which have been shown (in EGF) to be involved in disulphide bonds. The main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. Subdomains between the conserved cysteines vary in length. This entry contains EGF domains found in a variety of extracellular and membrane proteins
Probab=48.16  E-value=11  Score=16.70  Aligned_cols=12  Identities=33%  Similarity=0.949  Sum_probs=8.8

Q ss_pred             cccccccccCcccC
Q psy5836          52 AICLQQCPEGYFES   65 (66)
Q Consensus        52 ~~Cv~~Cp~g~y~~   65 (66)
                      ++|+  |.+||+.+
T Consensus        19 g~C~--C~~g~~G~   30 (32)
T PF07974_consen   19 GRCV--CDSGYTGP   30 (32)
T ss_pred             CEEE--CCCCCcCC
Confidence            5565  89998875


No 41 
>PF13922 PHD_3:  PHD domain of transcriptional enhancer, Asx
Probab=47.82  E-value=4.2  Score=21.39  Aligned_cols=25  Identities=28%  Similarity=0.850  Sum_probs=19.1

Q ss_pred             ccccccCcccc-ccCCCCCcccccccC
Q psy5836          17 GGVCWPCHESC-ETCAGAGQDSCLTCA   42 (66)
Q Consensus        17 ~~~C~~C~~~C-~~C~g~~~~~C~~C~   42 (66)
                      --+|+.|-..| .-|.||+ ..|++|.
T Consensus        43 Mi~Cq~CGAFCHDDCIgps-kLCvsCl   68 (69)
T PF13922_consen   43 MIMCQGCGAFCHDDCIGPS-KLCVSCL   68 (69)
T ss_pred             HHHHhhccchhccccccHH-HHhHhhc
Confidence            35788898888 6899984 5777774


No 42 
>PF05571 DUF766:  Protein of unknown function (DUF766);  InterPro: IPR008485 This family consists of several eukaryotic proteins of unknown function.
Probab=46.96  E-value=12  Score=25.02  Aligned_cols=20  Identities=35%  Similarity=0.871  Sum_probs=13.5

Q ss_pred             cCCCCeeeCCccccccCccc
Q psy5836           7 RCPPRSFPNQGGVCWPCHES   26 (66)
Q Consensus         7 ~C~~g~y~~~~~~C~~C~~~   26 (66)
                      .||-|+-.|++..|++|..+
T Consensus        25 aCprG~R~n~~~iC~pC~~~   44 (296)
T PF05571_consen   25 ACPRGYRVNESSICQPCDDS   44 (296)
T ss_pred             CCCCccccCCCcccccCCCC
Confidence            56777766666777777644


No 43 
>KOG1836|consensus
Probab=41.55  E-value=30  Score=28.43  Aligned_cols=54  Identities=28%  Similarity=0.661  Sum_probs=32.7

Q ss_pred             ccCCCCeeeCC----ccccccCcc----cc-ccCCCCCcccccccCCCccccccccccccccccCcccC
Q psy5836           6 SRCPPRSFPNQ----GGVCWPCHE----SC-ETCAGAGQDSCLTCAPAHLRVTDLAICLQQCPEGYFES   65 (66)
Q Consensus         6 ~~C~~g~y~~~----~~~C~~C~~----~C-~~C~g~~~~~C~~C~~~~~~~~~~~~Cv~~Cp~g~y~~   65 (66)
                      ..|..|||.+.    ..-|++|+-    .| .++. ...-.|+.|++++.    +-.|. .|-+|||.+
T Consensus       759 ~~C~~GfYg~~~~~~~~dC~~C~Cp~~~~~~~~~~-~~~~iCk~Cp~gyt----G~rCe-~c~dgyfg~  821 (1705)
T KOG1836|consen  759 AQCVDGFYGLPDLGTSGDCQPCPCPNGGACGQTPE-ILEVVCKNCPPGYT----GLRCE-ECADGYFGN  821 (1705)
T ss_pred             hhhcCCCCCccccCCCCCCccCCCCCChhhcCcCc-ccceecCCCCCCCc----ccccc-cCCCccccC
Confidence            36788999753    233888852    22 2221 23457888887764    34565 678888765


No 44 
>PF09257 BCMA-Tall_bind:  BCMA, TALL-1 binding;  InterPro: IPR015337 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  Members of this entry, which are predominantly found in the tumour necrosis factor receptor superfamily member 17, BCMA, are required for binding to tumour necrosis factor ligand TALL-1 []. ; PDB: 2KN1_A 1OQD_R 1XU2_T.
Probab=40.93  E-value=8  Score=17.93  Aligned_cols=19  Identities=32%  Similarity=0.704  Sum_probs=13.1

Q ss_pred             CeeeCCccccccCcccccc
Q psy5836          11 RSFPNQGGVCWPCHESCET   29 (66)
Q Consensus        11 g~y~~~~~~C~~C~~~C~~   29 (66)
                      .||...-..|.+||-.|..
T Consensus         5 EYfD~LL~aCkPChLRCsn   23 (39)
T PF09257_consen    5 EYFDRLLHACKPCHLRCSN   23 (39)
T ss_dssp             EEEETTTTEEEEHHHHHTS
T ss_pred             HHHHHHHHhcccceeecCC
Confidence            3444347899999988753


No 45 
>PF12837 Fer4_6:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=40.76  E-value=6.3  Score=16.31  Aligned_cols=10  Identities=50%  Similarity=1.308  Sum_probs=6.6

Q ss_pred             cccccccccC
Q psy5836          52 AICLQQCPEG   61 (66)
Q Consensus        52 ~~Cv~~Cp~g   61 (66)
                      +.|+..||.+
T Consensus        13 g~C~~~Cp~~   22 (24)
T PF12837_consen   13 GDCVRVCPEG   22 (24)
T ss_pred             hHHHHhcchh
Confidence            4577777754


No 46 
>PF00037 Fer4:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 1DUR_A 1H98_A 1BD6_A 1BQX_A 1BWE_A 1BC6_A 3BK7_A 1FCA_A 1FDN_A 2FDN_A ....
Probab=40.44  E-value=7.7  Score=15.84  Aligned_cols=10  Identities=30%  Similarity=0.939  Sum_probs=6.7

Q ss_pred             cccccccccC
Q psy5836          52 AICLQQCPEG   61 (66)
Q Consensus        52 ~~Cv~~Cp~g   61 (66)
                      +.|+..||.+
T Consensus        12 g~C~~~CP~~   21 (24)
T PF00037_consen   12 GRCVEACPFD   21 (24)
T ss_dssp             THHHHHSTTS
T ss_pred             chhhhhcccc
Confidence            4577777765


No 47 
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai.
Probab=39.69  E-value=25  Score=16.52  Aligned_cols=8  Identities=38%  Similarity=1.310  Sum_probs=4.7

Q ss_pred             ccccCccc
Q psy5836          57 QCPEGYFE   64 (66)
Q Consensus        57 ~Cp~g~y~   64 (66)
                      .|++|||.
T Consensus        33 ~C~~g~~g   40 (46)
T smart00180       33 RCAPGYYG   40 (46)
T ss_pred             cCCCCcCC
Confidence            56666654


No 48 
>PF02822 Antistasin:  Antistasin family;  InterPro: IPR004094 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  This group of serine protease inhibitors belong to MEROPS inhibitor family I15, clan IO. They inhibit serine peptidases of the S1 family (IPR001254 from INTERPRO) [] and are characterised by a well conserved pattern of cysteine residues. Many of the proteins that belong to this family are anti-coagulants.; GO: 0004867 serine-type endopeptidase inhibitor activity; PDB: 1HIA_I 1BX8_A 1BX7_A 3BG4_D 1C9P_B 1EJA_B 1SKZ_A.
Probab=37.37  E-value=23  Score=14.94  Aligned_cols=18  Identities=22%  Similarity=0.425  Sum_probs=8.3

Q ss_pred             ccccCCCCeeeCCcccccc
Q psy5836           4 CVSRCPPRSFPNQGGVCWP   22 (66)
Q Consensus         4 Cv~~C~~g~y~~~~~~C~~   22 (66)
                      |...||.||-.|. +.|..
T Consensus         6 C~~~C~~Gf~~D~-~GC~~   23 (26)
T PF02822_consen    6 CRMYCPYGFKTDE-NGCPT   23 (26)
T ss_dssp             ES---TT-EEE-T-TSSEE
T ss_pred             cCCcCCCcccCCC-CCCCc
Confidence            7778999988763 44443


No 49 
>KOG0994|consensus
Probab=34.95  E-value=21  Score=28.58  Aligned_cols=18  Identities=39%  Similarity=0.946  Sum_probs=12.9

Q ss_pred             cCCCCeeeCC--ccccccCc
Q psy5836           7 RCPPRSFPNQ--GGVCWPCH   24 (66)
Q Consensus         7 ~C~~g~y~~~--~~~C~~C~   24 (66)
                      .|-+|||.+.  ++.|++|.
T Consensus       949 ~CA~~~fGnP~~GGtCq~Ce  968 (1758)
T KOG0994|consen  949 ICADNHFGNPSEGGTCQKCE  968 (1758)
T ss_pred             hhcccccCCcccCCcccccc
Confidence            5667787754  78888874


No 50 
>KOG4611|consensus
Probab=34.50  E-value=24  Score=24.93  Aligned_cols=26  Identities=27%  Similarity=0.714  Sum_probs=20.6

Q ss_pred             cCCCCeeeCCccccccCccccccCCC
Q psy5836           7 RCPPRSFPNQGGVCWPCHESCETCAG   32 (66)
Q Consensus         7 ~C~~g~y~~~~~~C~~C~~~C~~C~g   32 (66)
                      .|..|+|.+.++-|.+|..+|..=..
T Consensus       102 ncasgfyrndngyctkcetscsemns  127 (747)
T KOG4611|consen  102 NCASGFYRNDNGYCTKCETSCSEMNS  127 (747)
T ss_pred             cccccceECCCcccccccccHhhhcC
Confidence            56789999889999999998864433


No 51 
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]
Probab=31.65  E-value=25  Score=22.17  Aligned_cols=14  Identities=36%  Similarity=1.004  Sum_probs=11.3

Q ss_pred             CcccccCCCCeeeC
Q psy5836           2 STCVSRCPPRSFPN   15 (66)
Q Consensus         2 ~~Cv~~C~~g~y~~   15 (66)
                      ++|..+||.|-|.+
T Consensus        45 G~CT~sCPs~r~t~   58 (195)
T COG1150          45 GTCTGSCPSGRFTD   58 (195)
T ss_pred             CcccCCCCCcccCC
Confidence            67999999987654


No 52 
>PF00008 EGF:  EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry;  InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins. The list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied. The functional significance of EGF domains in what appear to be unrelated proteins is not yet clear. However, a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase). The EGF domain includes six cysteine residues which have been shown (in EGF) to be involved in disulphide bonds. The main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet. Subdomains between the conserved cysteines vary in length.; GO: 0005515 protein binding; PDB: 1WHE_A 1CCF_A 1APO_A 1WHF_A 2VJ3_A 1TOZ_A 4D90_B 3CFW_A 1EDM_B 1IXA_A ....
Probab=29.78  E-value=25  Score=15.18  Aligned_cols=13  Identities=38%  Similarity=0.810  Sum_probs=9.3

Q ss_pred             ccccccccccCcccC
Q psy5836          51 LAICLQQCPEGYFES   65 (66)
Q Consensus        51 ~~~Cv~~Cp~g~y~~   65 (66)
                      ...|.  |+.||..+
T Consensus        19 ~y~C~--C~~G~~G~   31 (32)
T PF00008_consen   19 GYTCE--CPPGYTGK   31 (32)
T ss_dssp             EEEEE--EBTTEEST
T ss_pred             CEEeE--CCCCCccC
Confidence            45675  89998765


No 53 
>PF13746 Fer4_18:  4Fe-4S dicluster domain
Probab=26.27  E-value=25  Score=18.03  Aligned_cols=11  Identities=36%  Similarity=1.102  Sum_probs=8.0

Q ss_pred             cccccccccCc
Q psy5836          52 AICLQQCPEGY   62 (66)
Q Consensus        52 ~~Cv~~Cp~g~   62 (66)
                      +.|+..||.+-
T Consensus        56 grCv~~CP~~I   66 (69)
T PF13746_consen   56 GRCVRVCPAGI   66 (69)
T ss_pred             ChHhhhcCCCC
Confidence            56777898763


No 54 
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=25.90  E-value=51  Score=15.00  Aligned_cols=10  Identities=20%  Similarity=0.481  Sum_probs=6.1

Q ss_pred             cCCCCeeeCC
Q psy5836           7 RCPPRSFPNQ   16 (66)
Q Consensus         7 ~C~~g~y~~~   16 (66)
                      .||.|++.+.
T Consensus        32 ~C~~g~~f~~   41 (56)
T smart00494       32 SCPAGLVFDP   41 (56)
T ss_pred             cCcCCCeECC
Confidence            5677765554


No 55 
>KOG3744|consensus
Probab=25.75  E-value=34  Score=22.63  Aligned_cols=21  Identities=38%  Similarity=0.683  Sum_probs=14.0

Q ss_pred             cCCCCeeeCCccccccCcccc
Q psy5836           7 RCPPRSFPNQGGVCWPCHESC   27 (66)
Q Consensus         7 ~C~~g~y~~~~~~C~~C~~~C   27 (66)
                      .||-|+-.|+...|++|+.+-
T Consensus        32 vCprG~R~Na~~~C~pC~~~l   52 (311)
T KOG3744|consen   32 VCPRGQRTNAQKYCQPCTESP   52 (311)
T ss_pred             CCCCccccchhhhcCCCCCCC
Confidence            467777666677777776543


No 56 
>PF13187 Fer4_9:  4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J.
Probab=25.70  E-value=19  Score=16.96  Aligned_cols=12  Identities=33%  Similarity=0.861  Sum_probs=8.1

Q ss_pred             CcccccCCCCee
Q psy5836           2 STCVSRCPPRSF   13 (66)
Q Consensus         2 ~~Cv~~C~~g~y   13 (66)
                      +.|+..||.+.+
T Consensus         6 g~C~~~CP~~~~   17 (55)
T PF13187_consen    6 GRCVEACPVGVI   17 (55)
T ss_dssp             THHHHHSTTT-E
T ss_pred             chHHHHCCccCe
Confidence            468888987654


No 57 
>KOG3525|consensus
Probab=25.62  E-value=57  Score=22.79  Aligned_cols=39  Identities=23%  Similarity=0.725  Sum_probs=29.2

Q ss_pred             ccccCCCCeeeCCccccccCccccccCCCCCcccccccCCCc
Q psy5836           4 CVSRCPPRSFPNQGGVCWPCHESCETCAGAGQDSCLTCAPAH   45 (66)
Q Consensus         4 Cv~~C~~g~y~~~~~~C~~C~~~C~~C~g~~~~~C~~C~~~~   45 (66)
                      ++..|+..  ......|..++.++.++.++ ...|+.|....
T Consensus       207 ~~~~~~~~--p~y~~~C~~~~~s~~s~~~~-~~~~~~~~~~~  245 (431)
T KOG3525|consen  207 CATQCGKK--PQYRERCASCLASTYSSGGP-TEECIVCTDPR  245 (431)
T ss_pred             cccccCCC--ccccccccccccccccCCCC-cceeeeecCCC
Confidence            44555552  22368999999999999999 88999998654


No 58 
>smart00289 WR1 Worm-specific repeat type 1. Worm-specific repeat type 1. Cysteine-rich domain apparently unique (so far) to C. elegans. Often appears with KU domains. About 3 dozen worm proteins contain this domain.
Probab=25.19  E-value=59  Score=14.11  Aligned_cols=6  Identities=67%  Similarity=1.879  Sum_probs=2.8

Q ss_pred             ccccCc
Q psy5836          57 QCPEGY   62 (66)
Q Consensus        57 ~Cp~g~   62 (66)
                      .||.||
T Consensus        21 ~CP~g~   26 (38)
T smart00289       21 SCPSGY   26 (38)
T ss_pred             CCCCCC
Confidence            455444


No 59 
>PF07645 EGF_CA:  Calcium-binding EGF domain;  InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins. Many of these proteins require calcium for their biological function and a calcium-binding site has been found at the N terminus of some EGF-like domains []. Calcium-binding may be crucial for numerous protein-protein interactions. For human coagulation factor IX it has been shown [] that the calcium-ligands form a pentagonal bipyramid. The first, third and fourth conserved negatively charged or polar residues are side chain ligands. The latter is possibly hydroxylated (see aspartic acid and asparagine hydroxylation site) []. A conserved aromatic residue, as well as the second conserved negative residue, are thought to be involved in stabilising the calcium-binding site. As in non-calcium binding EGF-like domains, there are six conserved cysteines and the structure of both types is very similar as calcium-binding induces only strictly local structural changes [].  +------------------+ +---------+ | | | | nxnnC-x(3,14)-C-x(3,7)-CxxbxxxxaxC-x(1,6)-C-x(8,13)-Cx | | +------------------+ 'n': negatively charged or polar residue [DEQN] 'b': possibly beta-hydroxylated residue [DN] 'a': aromatic amino acid 'C': cysteine, involved in disulphide bond 'x': any amino acid. ; GO: 0005509 calcium ion binding; PDB: 2VJ3_A 1TOZ_A 1LMJ_A 1UZQ_A 1UZK_A 1UZJ_B 1UZP_A 1EMO_A 1EMN_A 2RR0_A ....
Probab=25.08  E-value=26  Score=15.98  Aligned_cols=10  Identities=50%  Similarity=1.148  Sum_probs=6.0

Q ss_pred             cccccccccCcc
Q psy5836          52 AICLQQCPEGYF   63 (66)
Q Consensus        52 ~~Cv~~Cp~g~y   63 (66)
                      ..|+  |++||.
T Consensus        25 y~C~--C~~Gy~   34 (42)
T PF07645_consen   25 YSCS--CPPGYE   34 (42)
T ss_dssp             EEEE--ESTTEE
T ss_pred             EEee--CCCCcE
Confidence            4565  666665


No 60 
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit. This model represents the iron-sulfur subunit, typically called the beta subunit, of various proteins that also contain a molybdopterin subunit and a heme b subunit. The group includes two distinct but very closely related periplasmic proteins of anaerobic respiration, selenate reductase and chlorate reductase. Other members of this family include dimethyl sulphide dehydrogenase and ethylbenzene dehydrogenase.
Probab=24.45  E-value=28  Score=23.54  Aligned_cols=26  Identities=27%  Similarity=0.797  Sum_probs=16.6

Q ss_pred             cccccccCCCccccccccccccccccC
Q psy5836          35 QDSCLTCAPAHLRVTDLAICLQQCPEG   61 (66)
Q Consensus        35 ~~~C~~C~~~~~~~~~~~~Cv~~Cp~g   61 (66)
                      ...|+.|..- .-......||..||.+
T Consensus       188 ~eKC~~C~~R-ie~G~~PaCv~aCP~~  213 (321)
T TIGR03478       188 SEKCIGCYPR-IEKGIAPACVKQCPGR  213 (321)
T ss_pred             hhhCCCchhh-hccCCCCHHHhhcCcc
Confidence            4689999631 1111246899999976


No 61 
>PF12838 Fer4_7:  4Fe-4S dicluster domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 3CF4_A 1K0T_A 2VKR_C 1JB0_C 3PCQ_C.
Probab=23.11  E-value=24  Score=16.61  Aligned_cols=10  Identities=40%  Similarity=1.122  Sum_probs=6.0

Q ss_pred             CcccccCCCC
Q psy5836           2 STCVSRCPPR   11 (66)
Q Consensus         2 ~~Cv~~C~~g   11 (66)
                      +.|+..||.+
T Consensus         6 ~~C~~~CP~~   15 (52)
T PF12838_consen    6 GACVEACPTG   15 (52)
T ss_dssp             -HHHHH-TTH
T ss_pred             CchHHhcCcc
Confidence            4578888865


No 62 
>PF04942 CC:  CC domain;  InterPro: IPR007026 This short domain contains four conserved cysteines that are probably required for the formation of two disulphide bonds. The domain is only found in proteins from Caenorhabditis species. The domain is named after the characteristic CC motif.
Probab=22.40  E-value=53  Score=14.90  Aligned_cols=14  Identities=29%  Similarity=0.548  Sum_probs=8.6

Q ss_pred             cCCCCeeeCCcccc
Q psy5836           7 RCPPRSFPNQGGVC   20 (66)
Q Consensus         7 ~C~~g~y~~~~~~C   20 (66)
                      .||.||....++.|
T Consensus        19 ~CP~G~~~i~g~~C   32 (36)
T PF04942_consen   19 VCPSGYTVITGNGC   32 (36)
T ss_pred             cCCCCCEEECCCcc
Confidence            57777766544554


No 63 
>PF13484 Fer4_16:  4Fe-4S double cluster binding domain
Probab=21.85  E-value=16  Score=18.07  Aligned_cols=10  Identities=30%  Similarity=0.996  Sum_probs=7.4

Q ss_pred             CcccccCCCC
Q psy5836           2 STCVSRCPPR   11 (66)
Q Consensus         2 ~~Cv~~C~~g   11 (66)
                      +.|++.||.+
T Consensus         6 ~~C~~~CP~~   15 (67)
T PF13484_consen    6 GKCAEACPTG   15 (67)
T ss_pred             hHHHHhCcHh
Confidence            4688889865


Done!