Query         psy5838
Match_columns 215
No_of_seqs    119 out of 1200
Neff          10.6
Searched_HMMs 46136
Date          Fri Aug 16 19:19:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5838.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5838hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3513|consensus               99.9 7.6E-21 1.6E-25  161.5  18.1  176   13-209   327-563 (1051)
  2 KOG3513|consensus               99.9 4.2E-20 9.1E-25  157.1  16.8  179   14-213   237-475 (1051)
  3 KOG4221|consensus               99.8 1.4E-17 3.1E-22  142.1  16.1  171   15-208   138-372 (1381)
  4 KOG4194|consensus               99.8 4.2E-18 9.2E-23  136.7  12.2  190    9-207   495-750 (873)
  5 PHA02785 IL-beta-binding prote  99.8 4.9E-17 1.1E-21  127.2  16.3  155   26-206    35-265 (326)
  6 KOG4222|consensus               99.6 2.8E-15 6.1E-20  127.6  11.9  169   17-205   131-357 (1281)
  7 KOG4221|consensus               99.6 1.4E-14 3.1E-19  124.1  12.6  177   14-209    38-282 (1381)
  8 KOG4222|consensus               99.6 2.1E-14 4.6E-19  122.4  10.7  173   13-201    27-263 (1281)
  9 cd05762 Ig8_MLCK Eighth immuno  99.5   2E-13 4.4E-18   88.2  11.6   93   18-162     1-94  (98)
 10 PHA02826 IL-1 receptor-like pr  99.5 3.7E-13 7.9E-18   99.7  13.3   75  126-209    99-179 (227)
 11 cd05882 Ig1_Necl-1 First (N-te  99.5 8.6E-13 1.9E-17   84.5  10.7   78   24-109     4-81  (95)
 12 cd05747 Ig5_Titin_like M5, fif  99.5 8.9E-13 1.9E-17   84.3   9.3   79   16-111     2-80  (92)
 13 cd07701 Ig1_Necl-3 First (N-te  99.4 4.1E-12 8.9E-17   81.5  10.1   79   24-110     4-82  (95)
 14 cd05737 Ig_Myomesin_like_C C-t  99.4 2.9E-12 6.3E-17   81.9   8.6   32   24-62      8-39  (92)
 15 cd05865 Ig1_NCAM-1 First immun  99.4 2.9E-12 6.3E-17   82.3   8.4   37   23-66      6-43  (96)
 16 cd05851 Ig3_Contactin-1 Third   99.4 4.6E-12 9.9E-17   80.2   9.0   39   17-62      1-39  (88)
 17 PF07679 I-set:  Immunoglobulin  99.4   3E-12 6.4E-17   81.5   8.2   76   18-110     1-76  (90)
 18 KOG4194|consensus               99.4 7.4E-12 1.6E-16  101.4  12.1  136   14-165   609-802 (873)
 19 cd05881 Ig1_Necl-2 First (N-te  99.4 1.4E-11   3E-16   78.5  10.8   83   24-114     4-86  (95)
 20 cd05870 Ig5_NCAM-2 Fifth immun  99.4 7.7E-12 1.7E-16   80.9   9.3   38   17-62      2-39  (98)
 21 cd05866 Ig1_NCAM-2 First immun  99.4 4.5E-12 9.8E-17   80.7   7.6   37   22-66      5-41  (92)
 22 cd04977 Ig1_NCAM-1_like First   99.3 1.2E-11 2.6E-16   79.0   8.7   37   22-66      5-41  (92)
 23 cd05894 Ig_C5_MyBP-C C5 immuno  99.3 2.1E-11 4.6E-16   76.8   8.7   31   25-62      3-33  (86)
 24 cd05891 Ig_M-protein_C C-termi  99.3 2.4E-11 5.1E-16   77.6   8.4   33   23-62      7-39  (92)
 25 cd05892 Ig_Myotilin_C C-termin  99.3 1.7E-11 3.7E-16   75.0   6.9   62   35-111     1-62  (75)
 26 cd05728 Ig4_Contactin-2-like F  99.3 3.4E-11 7.4E-16   75.7   8.2   36   20-62      2-37  (85)
 27 cd05869 Ig5_NCAM-1 Fifth immun  99.3 5.2E-11 1.1E-15   76.9   8.9   38   17-61      2-39  (97)
 28 cd05717 Ig1_Necl-1-3_like Firs  99.3 7.3E-11 1.6E-15   75.9   9.5   34   24-64      4-37  (95)
 29 PHA03376 BARF1; Provisional     99.3   2E-10 4.4E-15   80.2  12.1  142   25-203    19-164 (221)
 30 cd05852 Ig5_Contactin-1 Fifth   99.3 1.8E-11 3.9E-16   74.6   6.3   60   32-111     1-60  (73)
 31 cd04975 Ig4_SCFR_like Fourth i  99.3 1.7E-10 3.6E-15   74.8  11.1   35   24-66     10-45  (101)
 32 cd04972 Ig_TrkABC_d4 Fourth do  99.3 7.5E-11 1.6E-15   75.0   8.9   35   21-62      4-38  (90)
 33 cd05735 Ig8_DSCAM Eight immuno  99.2 1.6E-10 3.4E-15   73.2  10.1   85   32-163     1-86  (88)
 34 cd05732 Ig5_NCAM-1_like Fifth   99.2 8.1E-11 1.8E-15   75.8   8.8   38   17-62      2-39  (96)
 35 cd05752 Ig1_FcgammaR_like Frst  99.2 6.2E-11 1.3E-15   73.1   7.6   66   18-111     1-67  (78)
 36 cd04968 Ig3_Contactin_like Thi  99.2 1.1E-10 2.5E-15   73.9   8.7   39   18-63      2-40  (88)
 37 cd05745 Ig3_Peroxidasin Third   99.2   3E-11 6.4E-16   74.0   5.6   25   31-62      1-25  (74)
 38 cd05893 Ig_Palladin_C C-termin  99.2 5.6E-11 1.2E-15   72.8   6.6   62   35-111     1-62  (75)
 39 cd04973 Ig1_FGFR First immunog  99.2 9.7E-11 2.1E-15   72.6   7.6   66   24-111     1-66  (79)
 40 cd05730 Ig3_NCAM-1_like Third   99.2 3.3E-10   7E-15   72.8  10.2   30   25-61     11-40  (95)
 41 cd07693 Ig1_Robo First immunog  99.2 4.4E-10 9.6E-15   72.7  10.6   41   17-65      1-41  (100)
 42 cd05740 Ig_CEACAM_D4 Fourth im  99.2 1.2E-10 2.5E-15   74.2   7.3   31   24-62     10-40  (91)
 43 cd05724 Ig2_Robo Second immuno  99.2 1.1E-10 2.5E-15   73.5   7.2   32   23-61      2-34  (86)
 44 cd05848 Ig1_Contactin-5 First   99.2 1.7E-10 3.6E-15   74.0   8.0   40   18-65      2-44  (94)
 45 cd07690 Ig1_CD4 First immunogl  99.2 1.6E-10 3.4E-15   73.7   7.5   29   27-62      2-30  (94)
 46 cd05743 Ig_Perlecan_D2_like Im  99.2 1.5E-10 3.2E-15   71.6   7.2   63   32-111     1-63  (78)
 47 cd04969 Ig5_Contactin_like Fif  99.2 1.3E-10 2.8E-15   70.9   6.3   60   32-111     1-60  (73)
 48 cd05726 Ig4_Robo Fhird immunog  99.2 4.7E-10   1E-14   71.3   9.0   82   32-160     1-83  (90)
 49 cd05744 Ig_Myotilin_C_like Imm  99.2 2.1E-10 4.5E-15   70.3   7.1   23   35-65      1-23  (75)
 50 cd05849 Ig1_Contactin-1 First   99.1 1.9E-10   4E-15   73.5   6.5   38   18-62      2-42  (93)
 51 cd05857 Ig2_FGFR Second immuno  99.1 2.7E-10 5.8E-15   71.6   7.0   29   27-62      4-32  (85)
 52 cd05773 Ig8_hNephrin_like Eigh  99.1 1.9E-09 4.1E-14   71.0  11.1  100   16-162     3-108 (109)
 53 cd05859 Ig4_PDGFR-alpha Fourth  99.1 9.1E-10   2E-14   71.4   9.0   33   26-66     12-44  (101)
 54 cd04983 IgV_TCR_alpha_like Imm  99.1 1.1E-09 2.3E-14   72.3   9.4   34   22-62      3-36  (109)
 55 cd05723 Ig4_Neogenin Fourth im  99.1 4.5E-10 9.8E-15   68.1   6.8   22   34-62      1-22  (71)
 56 cd05854 Ig6_Contactin-2 Sixth   99.1 2.3E-09 4.9E-14   67.3  10.1   37  126-162    48-85  (85)
 57 cd05899 IgV_TCR_beta Immunoglo  99.1 1.2E-09 2.6E-14   72.2   9.1   33   22-62      3-35  (110)
 58 cd05748 Ig_Titin_like Immunogl  99.1 7.9E-10 1.7E-14   67.6   7.7   22   34-62      1-22  (74)
 59 cd05867 Ig4_L1-CAM_like Fourth  99.1 8.6E-10 1.9E-14   67.8   7.9   26   32-65      1-26  (76)
 60 cd05850 Ig1_Contactin-2 First   99.1   6E-10 1.3E-14   71.4   7.4   40   18-65      2-44  (94)
 61 cd05845 Ig2_L1-CAM_like Second  99.1 5.3E-10 1.1E-14   71.0   6.5   76   17-111     2-80  (95)
 62 cd05873 Ig_Sema4D_like Immunog  99.1   8E-10 1.7E-14   69.3   7.2   69   23-112     2-70  (87)
 63 cd05722 Ig1_Neogenin First imm  99.1 8.2E-10 1.8E-14   70.9   7.3   39   20-66      2-40  (95)
 64 cd04974 Ig3_FGFR Third immunog  99.1 4.3E-10 9.3E-15   71.5   5.9   23   32-61      1-23  (90)
 65 cd05758 Ig5_KIRREL3-like Fifth  99.1 1.6E-09 3.4E-14   70.0   8.6   37   18-62      3-40  (98)
 66 cd05853 Ig6_Contactin-4 Sixth   99.1 1.9E-09 4.2E-14   67.3   8.4   36  127-162    49-85  (85)
 67 cd05764 Ig_2 Subgroup of the i  99.1 8.7E-10 1.9E-14   67.4   6.7   27   32-65      1-27  (74)
 68 cd05771 IgC_Tapasin_R Tapasin-  99.0 2.3E-09   5E-14   73.8   9.5   75  126-203     2-79  (139)
 69 cd04970 Ig6_Contactin_like Six  99.0 3.7E-09 8.1E-14   66.4   9.6   37  126-162    48-85  (85)
 70 cd05746 Ig4_Peroxidasin Fourth  99.0 4.4E-10 9.5E-15   67.7   5.1   57   35-111     1-57  (69)
 71 cd05858 Ig3_FGFR-2 Third immun  99.0 7.5E-10 1.6E-14   70.4   6.4   23   32-61      1-23  (90)
 72 cd05725 Ig3_Robo Third immunog  99.0 8.5E-10 1.8E-14   66.5   6.2   22   35-63      1-22  (69)
 73 cd05749 Ig2_Tyro3_like Second   99.0   1E-09 2.2E-14   68.1   6.6   37   20-64      1-38  (81)
 74 cd05863 Ig2_VEGFR-3 Second imm  99.0 2.2E-09 4.7E-14   64.0   6.8   24   35-66      1-24  (67)
 75 cd05756 Ig1_IL1R_like First im  99.0 1.9E-09 4.1E-14   69.0   7.0   32   25-63      7-43  (94)
 76 cd05868 Ig4_NrCAM Fourth immun  99.0 2.1E-09 4.6E-14   66.0   6.9   27   32-66      1-27  (76)
 77 cd04980 IgV_L_kappa Immunoglob  99.0 5.4E-09 1.2E-13   68.6   9.2   82   21-110     4-91  (106)
 78 cd05713 Ig_MOG_like Immunoglob  99.0 1.5E-08 3.2E-13   65.7  11.1   30   32-65      1-30  (100)
 79 cd05738 Ig2_RPTP_IIa_LAR_like   99.0 1.5E-09 3.3E-14   66.3   6.0   21   35-62      1-21  (74)
 80 cd05856 Ig2_FGFRL1-like Second  99.0 2.3E-09   5E-14   66.8   6.9   29   27-62      4-32  (82)
 81 cd00099 IgV Immunoglobulin var  99.0 5.1E-09 1.1E-13   68.4   8.8   29   27-62      1-30  (105)
 82 cd05765 Ig_3 Subgroup of the i  99.0 2.1E-09 4.6E-14   66.8   6.5   23   32-61      1-23  (81)
 83 cd04978 Ig4_L1-NrCAM_like Four  99.0 1.4E-09   3E-14   66.8   5.4   26   32-65      1-26  (76)
 84 PF00047 ig:  Immunoglobulin do  99.0 7.3E-09 1.6E-13   61.3   8.3   62   32-109     1-64  (64)
 85 cd04982 IgV_TCR_gamma Immunogl  99.0 8.9E-09 1.9E-13   68.7   9.5   33   22-61      3-37  (116)
 86 cd05775 Ig_SLAM-CD84_like_N N-  99.0 2.7E-09 5.9E-14   68.7   6.6   26   30-62      2-28  (97)
 87 PHA02785 IL-beta-binding prote  99.0 1.3E-08 2.9E-13   79.9  11.7   64   25-110   129-197 (326)
 88 cd04979 Ig_Semaphorin_C Immuno  99.0 8.6E-09 1.9E-13   65.3   8.8   33   23-63      2-34  (89)
 89 cd05712 Ig_Siglec_N Immunoglob  98.9 3.2E-08   7E-13   66.2  11.7   83   23-109     5-99  (119)
 90 cd05760 Ig2_PTK7 Second immuno  98.9   3E-09 6.6E-14   65.5   6.2   21   35-62      1-21  (77)
 91 cd04967 Ig1_Contactin First Ig  98.9 6.1E-09 1.3E-13   66.3   7.6   38   18-62      2-42  (91)
 92 cd04976 Ig2_VEGFR Second immun  98.9 4.6E-09   1E-13   63.6   6.6   23   35-65      1-23  (71)
 93 cd05879 Ig_P0 Immunoglobulin (  98.9 2.1E-08 4.6E-13   66.5  10.3   21   24-44      5-25  (116)
 94 cd05876 Ig3_L1-CAM Third immun  98.9 9.1E-09   2E-13   62.3   7.9   22   35-63      1-22  (71)
 95 cd07706 IgV_TCR_delta Immunogl  98.9 1.1E-08 2.3E-13   68.2   8.9   35   21-62      3-38  (116)
 96 cd05900 Ig_Aggrecan Immunoglob  98.9 1.1E-08 2.3E-13   67.4   8.5   14   31-44      1-14  (112)
 97 cd05880 Ig_EVA1 Immunoglobulin  98.9 1.6E-08 3.5E-13   67.2   9.4   33   24-60      5-38  (115)
 98 cd05715 Ig_P0-like Immunoglobu  98.9 2.1E-08 4.5E-13   66.9   9.9   34   24-61      5-39  (116)
 99 cd05739 Ig3_RPTP_IIa_LAR_like   98.9 4.7E-09   1E-13   63.1   6.1   24   32-62      1-24  (69)
100 cd05734 Ig7_DSCAM Seventh immu  98.9 4.8E-09   1E-13   64.9   6.3   22   35-63      1-22  (79)
101 cd05753 Ig2_FcgammaR_like Seco  98.9 3.1E-09 6.7E-14   66.4   5.1   61   26-111     8-69  (83)
102 cd05727 Ig2_Contactin-2-like S  98.9 5.1E-09 1.1E-13   66.7   6.0   71   24-111    10-81  (96)
103 cd04984 IgV_L_lambda Immunoglo  98.9   2E-08 4.2E-13   64.9   8.9   75   28-110     2-83  (98)
104 cd07702 Ig2_VEGFR-1 Second imm  98.9 3.2E-09 6.9E-14   64.2   4.8   57   35-111     1-57  (72)
105 cd05855 Ig_TrkB_d5 Fifth domai  98.9 8.1E-09 1.8E-13   63.5   6.6   22   37-66      3-24  (79)
106 cd05774 Ig_CEACAM_D1 First imm  98.9 3.8E-09 8.3E-14   68.7   5.4   32   23-61      4-35  (105)
107 cd04971 Ig_TrKABC_d5 Fifth dom  98.9 8.4E-09 1.8E-13   64.1   6.7   22   37-66      3-24  (81)
108 cd05763 Ig_1 Subgroup of the i  98.9 6.4E-09 1.4E-13   63.7   6.0   22   35-63      1-22  (75)
109 cd05864 Ig2_VEGFR-2 Second imm  98.9 4.1E-09 8.8E-14   63.5   4.9   24   35-66      1-24  (70)
110 cd05742 Ig1_VEGFR_like First i  98.9 6.7E-09 1.4E-13   65.1   5.9   24   32-62      1-26  (84)
111 cd05754 Ig3_Perlecan_like Thir  98.9 8.9E-09 1.9E-13   64.7   6.3   67   22-111     6-73  (85)
112 cd05861 Ig1_PDGFR-alphabeta Fr  98.9 2.2E-08 4.8E-13   62.7   7.8   24   32-62      1-24  (84)
113 cd05846 Ig1_MRC-OX-2_like Firs  98.8 2.1E-08 4.7E-13   64.6   7.8   25   32-62      1-25  (97)
114 cd05729 Ig2_FGFR_like Second i  98.8 2.6E-08 5.7E-13   62.3   8.0   30   26-62      3-32  (85)
115 cd05741 Ig_CEACAM_D1_like Firs  98.8 9.2E-09   2E-13   65.6   5.9   26   32-64      1-26  (92)
116 cd05731 Ig3_L1-CAM_like Third   98.8 9.7E-09 2.1E-13   62.1   5.5   22   35-63      1-22  (71)
117 cd05750 Ig_Pro_neuregulin Immu  98.8 1.4E-08   3E-13   62.1   6.2   24   35-66      1-25  (75)
118 cd05733 Ig6_L1-CAM_like Sixth   98.8 1.2E-08 2.6E-13   62.8   5.6   22   35-64      1-22  (77)
119 smart00409 IG Immunoglobulin.   98.8   1E-07 2.2E-12   59.1  10.0   30   25-61      2-31  (86)
120 smart00410 IG_like Immunoglobu  98.8   1E-07 2.2E-12   59.1  10.0   30   25-61      2-31  (86)
121 PF07686 V-set:  Immunoglobulin  98.8 2.6E-08 5.7E-13   65.8   7.6   33   23-62      7-40  (114)
122 cd05716 Ig_pIgR Immunoglobulin  98.8 3.6E-08 7.9E-13   63.6   8.0   29   27-62      2-31  (98)
123 KOG3515|consensus               98.8 1.7E-08 3.7E-13   85.0   7.8   80  125-205   163-248 (741)
124 cd05878 Ig_Aggrecan_like Immun  98.8 5.3E-08 1.2E-12   64.2   8.4   36  124-159    71-107 (110)
125 cd05714 Ig_CSPGs_LP Immunoglob  98.8   5E-08 1.1E-12   63.9   8.0   37  123-159    66-103 (106)
126 cd05871 Ig_Semaphorin_classIII  98.8 4.2E-08   9E-13   62.3   7.1   29   26-62      5-33  (91)
127 cd05720 Ig_CD8_alpha Immunoglo  98.8 1.2E-07 2.7E-12   61.8   9.5   75   28-110     2-89  (104)
128 cd05877 Ig_LP_like Immunoglobu  98.7 7.9E-08 1.7E-12   63.0   8.2   35  124-158    67-102 (106)
129 cd05895 Ig_Pro_neuregulin-1 Im  98.7 4.8E-08   1E-12   59.9   6.7   24   35-66      1-25  (76)
130 PHA02987 Ig domain OX-2-like p  98.7 9.2E-08   2E-12   67.3   8.3   32   25-63     23-55  (189)
131 cd05718 Ig1_PVR_like First imm  98.7 1.8E-07   4E-12   60.2   9.3   23  124-146    61-83  (98)
132 cd05872 Ig_Sema4B_like Immunog  98.7 3.2E-08   7E-13   61.6   5.4   64   25-110     4-67  (85)
133 cd04981 IgV_H Immunoglobulin (  98.7 1.8E-07 3.9E-12   62.4   9.4   33   23-62      3-37  (117)
134 cd05736 Ig2_Follistatin_like S  98.7 4.1E-08 8.9E-13   60.2   5.8   21   35-62      1-21  (76)
135 cd05888 Ig1_Nectin-4_like Frst  98.7   1E-07 2.2E-12   61.7   7.9   25   34-62      2-26  (100)
136 cd05874 Ig6_NrCAM Sixth immuno  98.7 4.1E-08 8.8E-13   60.4   5.7   21   35-62      1-21  (77)
137 cd05898 Ig5_KIRREL3 Fifth immu  98.7 2.1E-07 4.5E-12   59.7   9.0   34   22-61      6-39  (98)
138 cd07700 IgV_CD8_beta Immunoglo  98.7 2.2E-07 4.8E-12   60.9   8.8   29   28-63      2-31  (107)
139 cd05886 Ig1_Nectin-1_like Firs  98.7 2.6E-07 5.6E-12   59.5   8.9   22  125-146    63-84  (99)
140 cd05887 Ig1_Nectin-3_like Firs  98.7 5.3E-07 1.2E-11   57.6  10.2   29  124-152    59-87  (96)
141 smart00408 IGc2 Immunoglobulin  98.7   1E-07 2.2E-12   55.6   6.2   60   31-111     1-60  (63)
142 cd05757 Ig2_IL1R_like Second i  98.7 6.2E-08 1.3E-12   61.6   5.4   32   26-65      4-40  (92)
143 cd05875 Ig6_hNeurofascin_like   98.6 1.2E-07 2.6E-12   58.3   5.9   21   35-62      1-21  (77)
144 cd05862 Ig1_VEGFR First immuno  98.6 1.7E-07 3.6E-12   58.9   6.7   27   32-63      1-27  (86)
145 PHA02826 IL-1 receptor-like pr  98.6 1.5E-07 3.2E-12   70.0   7.4   68   24-110   136-208 (227)
146 cd05889 Ig1_DNAM-1_like First   98.6 1.2E-06 2.6E-11   56.0  10.6   35  124-158    59-93  (96)
147 cd04974 Ig3_FGFR Third immunog  98.6 2.1E-07 4.7E-12   59.0   6.9   58  101-158     2-89  (90)
148 cd05902 Ig_Neurocan Immunoglob  98.6 2.7E-07 5.9E-12   60.6   7.4   23  124-146    71-93  (110)
149 cd05751 Ig1_LILRB1_like First   98.6 1.9E-07 4.1E-12   59.4   6.4   73   17-111     2-74  (91)
150 cd05901 Ig_Versican Immunoglob  98.6 2.3E-06 4.9E-11   56.5  11.4   35  124-158    78-113 (117)
151 smart00406 IGv Immunoglobulin   98.6 5.5E-07 1.2E-11   55.6   8.0   70   34-108     1-80  (81)
152 cd05892 Ig_Myotilin_C C-termin  98.6 2.9E-07 6.3E-12   56.2   6.5   54  104-157     2-74  (75)
153 cd05896 Ig1_IL1RAPL-1_like Fir  98.5   3E-07 6.5E-12   59.0   5.8   17   25-41      8-24  (104)
154 cd05711 Ig_FcalphaRI Immunoglo  98.5 3.9E-07 8.5E-12   58.2   6.3   36   18-62      2-37  (94)
155 cd05852 Ig5_Contactin-1 Fifth   98.5 4.9E-07 1.1E-11   54.9   6.2   56  102-157     3-72  (73)
156 cd05745 Ig3_Peroxidasin Third   98.5 4.2E-07 9.2E-12   55.4   5.7   57  101-157     3-73  (74)
157 cd05893 Ig_Palladin_C C-termin  98.5 4.9E-07 1.1E-11   55.2   6.0   54  104-157     2-74  (75)
158 PF13895 Ig_2:  Immunoglobulin   98.5 7.3E-07 1.6E-11   54.8   6.9   58   27-111     9-66  (80)
159 cd05870 Ig5_NCAM-2 Fifth immun  98.5 1.3E-06 2.8E-11   56.3   7.7   59   99-157    15-97  (98)
160 cd05894 Ig_C5_MyBP-C C5 immuno  98.5 1.3E-06 2.9E-11   54.8   7.4   58  100-157    10-85  (86)
161 cd05864 Ig2_VEGFR-2 Second imm  98.5 5.9E-07 1.3E-11   54.0   5.5   55  104-158     2-68  (70)
162 cd05857 Ig2_FGFR Second immuno  98.4 1.2E-06 2.6E-11   54.8   7.1   61   97-157     6-84  (85)
163 PF13927 Ig_3:  Immunoglobulin   98.4 3.7E-07   8E-12   55.4   4.6   72   18-110     2-74  (75)
164 cd05865 Ig1_NCAM-1 First immun  98.4 2.3E-06   5E-11   54.9   8.4   61   98-158    13-95  (96)
165 cd05868 Ig4_NrCAM Fourth immun  98.4 8.3E-07 1.8E-11   54.4   6.0   57  102-158     3-75  (76)
166 cd05882 Ig1_Necl-1 First (N-te  98.4 1.7E-06 3.7E-11   55.3   7.6   59   99-157    11-94  (95)
167 cd05744 Ig_Myotilin_C_like Imm  98.4 1.4E-06 3.1E-11   53.2   6.9   53  105-157     3-74  (75)
168 cd05725 Ig3_Robo Third immunog  98.4 9.6E-07 2.1E-11   53.0   5.9   53  104-156     2-67  (69)
169 cd05858 Ig3_FGFR-2 Third immun  98.4 1.4E-06 3.1E-11   55.2   6.8   57  102-158     3-89  (90)
170 cd05748 Ig_Titin_like Immunogl  98.4 1.7E-06 3.8E-11   52.6   7.0   53  104-156     3-72  (74)
171 cd05869 Ig5_NCAM-1 Fifth immun  98.4 2.2E-06 4.8E-11   55.1   7.7   58  100-157    17-96  (97)
172 cd05763 Ig_1 Subgroup of the i  98.4 1.7E-06 3.6E-11   52.8   6.7   55  104-158     2-74  (75)
173 cd04968 Ig3_Contactin_like Thi  98.4 1.6E-06 3.4E-11   54.7   6.6   60   99-158    15-87  (88)
174 cd05723 Ig4_Neogenin Fourth im  98.4 8.6E-07 1.9E-11   53.5   4.9   53  104-156     3-69  (71)
175 cd05737 Ig_Myomesin_like_C C-t  98.4 2.7E-06 5.8E-11   54.1   7.3   58   99-156    15-90  (92)
176 cd04978 Ig4_L1-NrCAM_like Four  98.4   2E-06 4.4E-11   52.5   6.4   57  102-158     3-75  (76)
177 cd05731 Ig3_L1-CAM_like Third   98.4 1.3E-06 2.8E-11   52.6   5.4   54  105-158     3-70  (71)
178 cd05721 IgV_CTLA-4 Immunoglobu  98.3 1.3E-05 2.8E-10   52.4   9.6   38   23-64      4-41  (115)
179 cd04972 Ig_TrkABC_d4 Fourth do  98.3 5.3E-06 1.1E-10   52.5   7.5   60   98-157    13-89  (90)
180 cd05732 Ig5_NCAM-1_like Fifth   98.3 5.6E-06 1.2E-10   53.0   7.6   59   99-157    15-95  (96)
181 cd05734 Ig7_DSCAM Seventh immu  98.3 3.3E-06 7.1E-11   52.1   6.2   43  105-147     3-66  (79)
182 cd05861 Ig1_PDGFR-alphabeta Fr  98.3   1E-05 2.2E-10   50.5   8.5   57  102-158     3-82  (84)
183 PF07679 I-set:  Immunoglobulin  98.3 2.4E-06 5.3E-11   53.9   5.8   59   99-157    14-89  (90)
184 cd05740 Ig_CEACAM_D4 Fourth im  98.3 4.9E-06 1.1E-10   52.8   7.1   61   97-158    15-90  (91)
185 cd04969 Ig5_Contactin_like Fif  98.3 3.2E-06 6.9E-11   51.3   6.0   55  102-156     3-71  (73)
186 cd05765 Ig_3 Subgroup of the i  98.3 4.3E-06 9.4E-11   51.7   6.6   56  102-157     3-80  (81)
187 cd05856 Ig2_FGFRL1-like Second  98.3 3.7E-06   8E-11   52.1   6.3   49   99-147     8-70  (82)
188 cd05855 Ig_TrkB_d5 Fifth domai  98.3 4.1E-06   9E-11   51.5   6.1   51  106-156     4-76  (79)
189 cd05764 Ig_2 Subgroup of the i  98.3 4.5E-06 9.7E-11   50.7   6.2   47  101-147     2-62  (74)
190 cd05746 Ig4_Peroxidasin Fourth  98.2 3.2E-06   7E-11   50.7   5.3   43  105-147     3-58  (69)
191 cd05866 Ig1_NCAM-2 First immun  98.2 8.7E-06 1.9E-10   51.7   7.4   50   97-147    12-78  (92)
192 cd04977 Ig1_NCAM-1_like First   98.2 1.2E-05 2.6E-10   51.1   8.0   50   97-147    12-79  (92)
193 cd05738 Ig2_RPTP_IIa_LAR_like   98.2 6.1E-06 1.3E-10   50.2   6.3   55  104-158     2-73  (74)
194 cd05760 Ig2_PTK7 Second immuno  98.2 6.3E-06 1.4E-10   50.6   6.3   44  104-147     2-60  (77)
195 cd05743 Ig_Perlecan_D2_like Im  98.2 6.5E-06 1.4E-10   50.6   6.3   45  102-146     3-63  (78)
196 cd05897 Ig2_IL1R2_like Second   98.2 2.7E-06 5.9E-11   54.2   4.6   31   27-65      5-40  (95)
197 cd07702 Ig2_VEGFR-1 Second imm  98.2 4.5E-06 9.7E-11   50.4   5.3   43  104-146     2-57  (72)
198 cd07701 Ig1_Necl-3 First (N-te  98.2 1.5E-05 3.2E-10   51.0   8.0   58  100-157    12-94  (95)
199 cd05860 Ig4_SCFR Fourth immuno  98.2 5.6E-05 1.2E-09   48.4  10.1   33   24-62     10-42  (101)
200 cd04971 Ig_TrKABC_d5 Fifth dom  98.2 8.2E-06 1.8E-10   50.6   6.3   51  106-156     4-78  (81)
201 cd05742 Ig1_VEGFR_like First i  98.2 1.2E-05 2.6E-10   50.1   7.0   56  102-157     3-82  (84)
202 cd05851 Ig3_Contactin-1 Third   98.2 7.6E-06 1.6E-10   51.6   5.9   42  162-206     2-43  (88)
203 cd05736 Ig2_Follistatin_like S  98.1 1.8E-05 3.9E-10   48.3   7.2   55  104-158     2-73  (76)
204 cd05749 Ig2_Tyro3_like Second   98.1 6.7E-06 1.4E-10   50.9   4.6   36  170-206     5-41  (81)
205 cd05724 Ig2_Robo Second immuno  98.1 2.5E-05 5.4E-10   48.8   7.0   49   99-147    10-73  (86)
206 cd05747 Ig5_Titin_like M5, fif  98.1 1.2E-05 2.5E-10   51.2   5.4   45  161-208     3-47  (92)
207 cd05762 Ig8_MLCK Eighth immuno  98.1 1.4E-05 2.9E-10   51.5   5.7   41  170-211     7-47  (98)
208 cd05733 Ig6_L1-CAM_like Sixth   98.1 2.4E-05 5.2E-10   47.9   6.5   44  104-147     2-65  (77)
209 cd07693 Ig1_Robo First immunog  98.0 1.2E-05 2.6E-10   51.7   5.3   43  162-207     2-44  (100)
210 cd05750 Ig_Pro_neuregulin Immu  98.0 3.1E-05 6.7E-10   47.0   6.9   43  105-147     3-65  (75)
211 cd05730 Ig3_NCAM-1_like Third   98.0   1E-05 2.2E-10   51.7   4.9   45  162-207     2-46  (95)
212 cd05891 Ig_M-protein_C C-termi  98.0 3.1E-05 6.7E-10   49.2   6.8   45  102-146    18-79  (92)
213 cd05874 Ig6_NrCAM Sixth immuno  98.0 5.1E-05 1.1E-09   46.5   7.3   44  105-148     3-66  (77)
214 cd05875 Ig6_hNeurofascin_like   98.0 5.5E-05 1.2E-09   46.3   7.2   45  104-148     2-66  (77)
215 cd05849 Ig1_Contactin-1 First   98.0 3.2E-05 6.9E-10   49.3   6.2   47  101-147    20-80  (93)
216 cd04975 Ig4_SCFR_like Fourth i  98.0 1.6E-05 3.4E-10   51.5   4.8   37  171-208    11-48  (101)
217 cd05717 Ig1_Necl-1-3_like Firs  98.0 8.9E-05 1.9E-09   47.3   8.1   35  123-157    60-94  (95)
218 cd05759 Ig2_KIRREL3-like Secon  98.0 7.6E-05 1.6E-09   46.2   7.6   24   34-65      1-25  (82)
219 cd05850 Ig1_Contactin-2 First   97.9   9E-05   2E-09   47.3   7.8   48  100-147    19-81  (94)
220 cd05728 Ig4_Contactin-2-like F  97.9 2.4E-05 5.2E-10   48.9   4.6   38  170-208     6-43  (85)
221 cd05756 Ig1_IL1R_like First im  97.9   6E-05 1.3E-09   48.1   6.2   47  100-146    14-81  (94)
222 cd05722 Ig1_Neogenin First imm  97.9 3.1E-05 6.8E-10   49.5   4.9   38  170-208     6-43  (95)
223 cd05848 Ig1_Contactin-5 First   97.9 5.4E-05 1.2E-09   48.3   5.7   31  177-208    18-48  (94)
224 cd05752 Ig1_FcgammaR_like Frst  97.8 0.00013 2.9E-09   44.7   7.0   58   98-157    13-77  (78)
225 cd05758 Ig5_KIRREL3-like Fifth  97.8 7.6E-05 1.6E-09   48.0   6.0   37  171-208     9-46  (98)
226 cd05739 Ig3_RPTP_IIa_LAR_like   97.8 3.6E-05 7.9E-10   46.1   4.0   28  178-206     1-28  (69)
227 cd05881 Ig1_Necl-2 First (N-te  97.8 0.00027 5.8E-09   45.1   8.1   47  111-157    48-94  (95)
228 cd05859 Ig4_PDGFR-alpha Fourth  97.8 5.3E-05 1.1E-09   49.0   4.8   36  172-208    12-47  (101)
229 cd05895 Ig_Pro_neuregulin-1 Im  97.8 0.00018 3.9E-09   43.8   6.7   23  125-147    44-66  (76)
230 cd05885 Ig2_Necl-4 Second immu  97.8 0.00015 3.2E-09   44.6   6.2   20  127-146    45-64  (80)
231 cd05729 Ig2_FGFR_like Second i  97.7 0.00025 5.4E-09   44.0   7.4   48  100-147     9-73  (85)
232 cd05754 Ig3_Perlecan_like Thir  97.7 0.00018 3.8E-09   44.9   6.5   49   98-146    14-73  (85)
233 cd05867 Ig4_L1-CAM_like Fourth  97.7 6.5E-05 1.4E-09   45.8   4.0   29  178-207     1-29  (76)
234 cd05862 Ig1_VEGFR First immuno  97.7 0.00047   1E-08   43.2   7.7   34  125-158    50-84  (86)
235 cd00096 Ig Immunoglobulin doma  97.6 0.00013 2.9E-09   42.6   4.7   21   35-62      1-21  (74)
236 cd05773 Ig8_hNephrin_like Eigh  97.6 0.00012 2.6E-09   48.1   4.5   30  177-207    22-51  (109)
237 cd05898 Ig5_KIRREL3 Fifth immu  97.6  0.0007 1.5E-08   43.4   7.7   60   97-156    13-97  (98)
238 cd04973 Ig1_FGFR First immunog  97.6 0.00021 4.6E-09   43.9   4.9   38  172-211     3-40  (79)
239 cd05863 Ig2_VEGFR-3 Second imm  97.5 0.00012 2.5E-09   43.5   3.2   25  181-206     1-25  (67)
240 cd00098 IgC Immunoglobulin Con  97.5 0.00029 6.2E-09   44.9   5.2   28   30-65     11-40  (95)
241 cd05755 Ig2_ICAM-1_like Second  97.5 0.00055 1.2E-08   44.0   6.3   34   25-62      9-42  (100)
242 cd07690 Ig1_CD4 First immunogl  97.5 0.00046   1E-08   43.9   5.8   23  124-146    64-86  (94)
243 cd05753 Ig2_FcgammaR_like Seco  97.5  0.0007 1.5E-08   42.1   6.4   49   99-147    13-70  (83)
244 cd05771 IgC_Tapasin_R Tapasin-  97.4   0.002 4.2E-08   44.2   9.1   39   17-62     38-78  (139)
245 cd07694 Ig2_CD4 Second immunog  97.4 0.00093   2E-08   41.4   6.5   32   26-64      8-41  (88)
246 smart00408 IGc2 Immunoglobulin  97.4  0.0008 1.7E-08   38.5   5.9   45  102-146     4-60  (63)
247 PF00047 ig:  Immunoglobulin do  97.4 0.00046   1E-08   40.3   4.8   43  102-144     3-64  (64)
248 cd05757 Ig2_IL1R_like Second i  97.4 0.00064 1.4E-08   43.1   5.4   47  100-146    10-73  (92)
249 cd05735 Ig8_DSCAM Eight immuno  97.3 0.00033 7.1E-09   44.1   3.8   29  178-207     1-29  (88)
250 cd05873 Ig_Sema4D_like Immunog  97.3 0.00056 1.2E-08   42.8   4.8   37  170-208     3-39  (87)
251 cd07698 IgC_MHC_I_alpha3 Class  97.3  0.0032   7E-08   40.0   8.4   26   32-62     14-39  (93)
252 cd05889 Ig1_DNAM-1_like First   97.3 0.00046   1E-08   44.1   4.1   76   33-114     1-84  (96)
253 cd05887 Ig1_Nectin-3_like Firs  97.2 0.00049 1.1E-08   43.9   3.7   76   33-114     1-84  (96)
254 cd05871 Ig_Semaphorin_classIII  97.2  0.0027 5.8E-08   40.2   7.1   35  125-159    53-89  (91)
255 cd04967 Ig1_Contactin First Ig  97.2 0.00098 2.1E-08   42.1   5.0   29  177-206    18-46  (91)
256 cd04976 Ig2_VEGFR Second immun  97.2 0.00042 9.2E-09   41.6   3.1   27  181-208     1-27  (71)
257 cd05883 Ig2_Necl-2 Second immu  97.2  0.0098 2.1E-07   36.7   9.1   21  126-146    45-65  (82)
258 PF13895 Ig_2:  Immunoglobulin   97.1  0.0027 5.9E-08   38.5   6.5   51   98-148    12-68  (80)
259 cd05886 Ig1_Nectin-1_like Firs  97.1  0.0027 5.9E-08   40.8   6.1   79   33-115     1-88  (99)
260 cd07696 IgC_CH3 CH3 domain (th  97.1   0.003 6.5E-08   40.4   6.2   33   26-63      8-41  (96)
261 cd05761 Ig2_Necl-1-4_like Seco  97.0  0.0054 1.2E-07   37.9   7.1   23   35-65      2-25  (82)
262 cd05766 IgC_MHC_II_beta Class   97.0   0.011 2.3E-07   37.6   8.6   28   31-64     13-40  (94)
263 cd05845 Ig2_L1-CAM_like Second  97.0  0.0017 3.6E-08   41.4   4.7   38  170-207    10-48  (95)
264 PHA02982 hypothetical protein;  97.0   0.003 6.6E-08   45.4   6.3   83   23-112    30-122 (251)
265 PF13927 Ig_3:  Immunoglobulin   97.0  0.0017 3.6E-08   38.9   4.4   44  103-146    18-75  (75)
266 cd05767 IgC_MHC_II_alpha Class  97.0  0.0094   2E-07   37.9   7.9   28   31-64     14-41  (94)
267 cd05770 IgC_beta2m Class I maj  97.0   0.014   3E-07   37.1   8.6   29   31-65     14-42  (93)
268 cd04979 Ig_Semaphorin_C Immuno  97.0  0.0023   5E-08   40.2   5.0   35  171-207     4-38  (89)
269 cd05876 Ig3_L1-CAM Third immun  96.9  0.0011 2.3E-08   39.8   3.1   25  181-206     1-25  (71)
270 cd05741 Ig_CEACAM_D1_like Firs  96.9    0.01 2.2E-07   37.3   7.8   25  124-148    56-80  (92)
271 cd05847 IgC_CH2_IgE CH2 domain  96.9  0.0056 1.2E-07   39.0   6.4   28   31-64     13-40  (94)
272 cd07705 Ig2_Necl-1 Second immu  96.9  0.0055 1.2E-07   38.0   6.3   22  126-147    47-68  (83)
273 cd05769 IgC_TCR_beta T cell re  96.9  0.0065 1.4E-07   40.2   6.6   31   28-64     14-44  (115)
274 cd05714 Ig_CSPGs_LP Immunoglob  96.8  0.0027 5.9E-08   41.3   4.8   78   31-112     1-90  (106)
275 cd05718 Ig1_PVR_like First imm  96.8  0.0043 9.4E-08   39.6   5.5   76   33-112     1-84  (98)
276 cd05877 Ig_LP_like Immunoglobu  96.8  0.0038 8.2E-08   40.6   5.3   78   31-112     1-90  (106)
277 cd05884 Ig2_Necl-3 Second immu  96.8  0.0096 2.1E-07   36.9   6.9   22  126-147    47-68  (83)
278 cd05772 IgC_SIRP Signal-regula  96.8  0.0022 4.7E-08   42.2   4.0   47  158-206     2-50  (111)
279 cd05897 Ig2_IL1R2_like Second   96.8  0.0049 1.1E-07   39.3   5.4   22  125-146    55-76  (95)
280 smart00410 IG_like Immunoglobu  96.8    0.02 4.2E-07   34.7   8.2   22  125-146    51-72  (86)
281 smart00409 IG Immunoglobulin.   96.8    0.02 4.2E-07   34.7   8.2   22  125-146    51-72  (86)
282 cd05726 Ig4_Robo Fhird immunog  96.8  0.0019 4.2E-08   40.6   3.5   25  178-203     1-25  (90)
283 cd05759 Ig2_KIRREL3-like Secon  96.7  0.0076 1.6E-07   37.1   6.0   44  104-147     3-68  (82)
284 smart00407 IGc1 Immunoglobulin  96.7   0.011 2.3E-07   35.9   6.5   25   34-64      1-25  (75)
285 cd05888 Ig1_Nectin-4_like Frst  96.7  0.0055 1.2E-07   39.5   5.3   19  127-145    66-84  (100)
286 cd05775 Ig_SLAM-CD84_like_N N-  96.6   0.005 1.1E-07   39.4   4.7   22   89-110    60-81  (97)
287 cd05878 Ig_Aggrecan_like Immun  96.6  0.0066 1.4E-07   39.9   5.4   78   31-112     1-94  (110)
288 cd05885 Ig2_Necl-4 Second immu  96.6  0.0031 6.8E-08   38.8   3.3   25  181-206     2-27  (80)
289 cd07692 Ig_CD3_epsilon Immunog  96.6  0.0052 1.1E-07   35.8   4.0   23   30-62      5-27  (65)
290 PF07654 C1-set:  Immunoglobuli  96.6   0.019 4.2E-07   35.4   6.9   25   32-61      8-32  (83)
291 cd05854 Ig6_Contactin-2 Sixth   96.5  0.0045 9.7E-08   38.6   4.0   28  179-207     1-30  (85)
292 cd05727 Ig2_Contactin-2-like S  96.5  0.0062 1.3E-07   38.9   4.6   33  172-205    12-45  (96)
293 cd05768 IgC_CH4 CH4 domain (fo  96.5  0.0075 1.6E-07   39.0   4.9   29   28-61     12-40  (102)
294 cd07699 IgC_L Immunoglobulin C  96.5  0.0066 1.4E-07   39.1   4.6   32   28-65     13-44  (100)
295 cd05846 Ig1_MRC-OX-2_like Firs  96.5  0.0088 1.9E-07   38.2   5.1   22  125-146    61-82  (97)
296 cd05774 Ig_CEACAM_D1 First imm  96.5  0.0075 1.6E-07   39.2   4.7   21   91-111    71-91  (105)
297 PF08205 C2-set_2:  CD80-like C  96.4   0.018 3.9E-07   36.0   6.4   26   32-64     14-40  (89)
298 cd05879 Ig_P0 Immunoglobulin (  96.4   0.011 2.4E-07   39.2   5.6   22  125-146    80-101 (116)
299 cd04983 IgV_TCR_alpha_like Imm  96.4   0.014   3E-07   38.0   6.0   25  122-146    67-91  (109)
300 cd05900 Ig_Aggrecan Immunoglob  96.4    0.01 2.2E-07   39.1   5.2   21  125-145    74-94  (112)
301 cd04986 IgC_CH2 CH2 domain (se  96.4   0.015 3.3E-07   37.3   5.8   33   27-63     14-46  (99)
302 cd04970 Ig6_Contactin_like Six  96.4  0.0066 1.4E-07   37.7   4.1   28  179-207     1-30  (85)
303 cd07697 IgC_TCR_gamma T cell r  96.3   0.033 7.1E-07   35.6   6.9   28   31-64     15-42  (96)
304 cd05772 IgC_SIRP Signal-regula  96.3    0.03 6.6E-07   36.8   6.9   32   28-65     17-48  (111)
305 cd00099 IgV Immunoglobulin var  96.2   0.019 4.2E-07   37.0   5.9   25  123-147    65-89  (105)
306 KOG3515|consensus               96.2   0.035 7.6E-07   48.0   8.7   45  155-200   293-338 (741)
307 cd05751 Ig1_LILRB1_like First   96.2   0.047   1E-06   34.4   7.3   23  124-146    52-74  (91)
308 cd05902 Ig_Neurocan Immunoglob  96.2   0.012 2.7E-07   38.5   4.6   77   31-111     1-93  (110)
309 PF08204 V-set_CD47:  CD47 immu  96.1   0.013 2.7E-07   39.4   4.6   35   29-68     24-60  (130)
310 PHA03273 envelope glycoprotein  96.1    0.34 7.3E-06   39.5  13.1   77  125-206   198-280 (486)
311 cd07699 IgC_L Immunoglobulin C  96.1  0.0092   2E-07   38.4   3.8   31  175-206    14-46  (100)
312 cd05755 Ig2_ICAM-1_like Second  96.1   0.014   3E-07   37.5   4.5   34  172-206    10-46  (100)
313 cd05880 Ig_EVA1 Immunoglobulin  96.1   0.014 3.1E-07   38.6   4.6   20  126-145    80-99  (115)
314 PHA03270 envelope glycoprotein  96.1    0.55 1.2E-05   38.0  13.9  179   16-206    76-264 (466)
315 cd05715 Ig_P0-like Immunoglobu  96.0   0.017 3.7E-07   38.2   4.9   20  126-145    81-100 (116)
316 PHA02633 hypothetical protein;  96.0    0.02 4.3E-07   32.9   4.3   20  127-146    20-39  (63)
317 cd07691 Ig_CD3_gamma_delta Imm  96.0   0.021 4.5E-07   33.6   4.4   18   32-60      6-23  (69)
318 PHA03271 envelope glycoprotein  95.9    0.15 3.3E-06   40.8  10.3  180   16-207    93-291 (490)
319 cd05883 Ig2_Necl-2 Second immu  95.9   0.013 2.7E-07   36.2   3.6   25  181-206     2-27  (82)
320 PF07686 V-set:  Immunoglobulin  95.9   0.047   1E-06   35.4   6.6   26  122-147    76-101 (114)
321 cd05769 IgC_TCR_beta T cell re  95.9   0.015 3.4E-07   38.4   4.0   44  161-206     2-47  (115)
322 cd05872 Ig_Sema4B_like Immunog  95.8   0.019 4.1E-07   35.7   4.1   36  172-209     5-40  (85)
323 cd05896 Ig1_IL1RAPL-1_like Fir  95.8   0.017 3.6E-07   37.3   3.8    7   56-62     43-49  (104)
324 cd05768 IgC_CH4 CH4 domain (fo  95.8   0.018 3.8E-07   37.3   4.0   31  175-206    13-45  (102)
325 cd05860 Ig4_SCFR Fourth immuno  95.8    0.03 6.5E-07   36.0   4.9   34  171-205    11-45  (101)
326 PHA03269 envelope glycoprotein  95.7    0.32   7E-06   39.9  11.5   79  123-206   287-372 (566)
327 cd04980 IgV_L_kappa Immunoglob  95.6   0.039 8.4E-07   35.8   5.3   23  123-145    69-91  (106)
328 cd05884 Ig2_Necl-3 Second immu  95.6   0.019 4.1E-07   35.6   3.6   25  181-206     2-27  (83)
329 cd07705 Ig2_Necl-1 Second immu  95.5   0.022 4.7E-07   35.3   3.5   25  181-206     2-27  (83)
330 cd04984 IgV_L_lambda Immunoglo  95.5    0.07 1.5E-06   34.0   6.0   23  123-145    61-83  (98)
331 cd05853 Ig6_Contactin-4 Sixth   95.5   0.029 6.2E-07   35.0   3.9   28  179-207     1-30  (85)
332 cd05766 IgC_MHC_II_beta Class   95.5   0.049 1.1E-06   34.6   5.1   31  176-207    12-44  (94)
333 cd05761 Ig2_Necl-1-4_like Seco  95.4   0.025 5.4E-07   34.9   3.6   25  181-206     2-27  (82)
334 smart00406 IGv Immunoglobulin   95.4   0.022 4.8E-07   34.5   3.4   23  122-144    59-81  (81)
335 cd05767 IgC_MHC_II_alpha Class  95.4   0.049 1.1E-06   34.6   5.0   29  177-206    14-44  (94)
336 cd07697 IgC_TCR_gamma T cell r  95.2   0.029 6.3E-07   35.8   3.5   31  175-206    13-45  (96)
337 cd05716 Ig_pIgR Immunoglobulin  95.2   0.039 8.4E-07   35.2   4.1   19  127-145    66-84  (98)
338 cd05770 IgC_beta2m Class I maj  95.2    0.06 1.3E-06   34.2   4.8   30  176-206    13-44  (93)
339 PHA02633 hypothetical protein;  95.2   0.021 4.6E-07   32.8   2.4   25   88-112    16-40  (63)
340 cd04985 IgC_CH1 CH1 domain (fi  95.1    0.15 3.3E-06   32.4   6.6   26   31-61     15-40  (95)
341 cd07698 IgC_MHC_I_alpha3 Class  95.1   0.065 1.4E-06   33.9   4.9   25  178-203    14-40  (93)
342 cd00098 IgC Immunoglobulin Con  95.1   0.036 7.9E-07   35.0   3.7   31  176-207    11-43  (95)
343 cd07689 Ig2_VCAM-1 Second immu  94.7     0.3 6.5E-06   31.2   7.0   29   30-62     13-41  (99)
344 cd05899 IgV_TCR_beta Immunoglo  94.7   0.066 1.4E-06   35.0   4.3   32  169-201     4-35  (110)
345 PF08205 C2-set_2:  CD80-like C  94.6   0.038 8.1E-07   34.5   2.8   27  178-205    14-41  (89)
346 PF11465 Receptor_2B4:  Natural  94.5    0.77 1.7E-05   29.7   8.5   24  125-148    71-94  (108)
347 cd00096 Ig Immunoglobulin doma  94.3    0.23 4.9E-06   28.2   5.7   24  124-147    42-65  (74)
348 PF07354 Sp38:  Zona-pellucida-  94.2    0.07 1.5E-06   40.1   3.7   43   56-110    15-57  (271)
349 cd05713 Ig_MOG_like Immunoglob  94.2   0.033 7.1E-07   35.6   1.8   36   78-113    51-88  (100)
350 cd07706 IgV_TCR_delta Immunogl  94.1    0.19 4.2E-06   33.1   5.6   34  113-146    59-93  (116)
351 PHA02987 Ig domain OX-2-like p  93.8    0.24 5.2E-06   35.5   5.7   39  122-160    82-123 (189)
352 cd07704 Ig2_Nectin-3-4_like Se  93.8    0.83 1.8E-05   29.2   7.6   30   25-61      9-40  (97)
353 smart00407 IGc1 Immunoglobulin  93.6    0.13 2.7E-06   31.1   3.6   24  181-205     2-27  (75)
354 cd04982 IgV_TCR_gamma Immunogl  93.6    0.16 3.6E-06   33.4   4.5   31  170-200     5-37  (116)
355 cd05712 Ig_Siglec_N Immunoglob  93.6   0.098 2.1E-06   34.8   3.4   25  122-146    77-101 (119)
356 cd07694 Ig2_CD4 Second immunog  93.4       1 2.2E-05   28.1   7.3   42  105-146    19-72  (88)
357 cd04985 IgC_CH1 CH1 domain (fi  93.4    0.26 5.6E-06   31.4   4.9   27  177-204    15-43  (95)
358 PF07654 C1-set:  Immunoglobuli  93.2    0.17 3.7E-06   31.1   3.8   29  177-206     7-37  (83)
359 cd05719 Ig2_PVR_like Second im  93.1     1.4 3.1E-05   28.0   9.0   23   32-61     15-38  (95)
360 cd07696 IgC_CH3 CH3 domain (th  93.0    0.13 2.8E-06   32.8   3.1   29  175-203    11-42  (96)
361 cd05847 IgC_CH2_IgE CH2 domain  93.0    0.14   3E-06   32.5   3.2   28  177-205    13-42  (94)
362 cd05720 Ig_CD8_alpha Immunoglo  92.6     0.2 4.4E-06   32.3   3.7   23  123-145    67-89  (104)
363 cd05711 Ig_FcalphaRI Immunoglo  92.5     1.1 2.4E-05   28.3   6.9   22  124-145    54-75  (94)
364 KOG1480|consensus               91.9    0.11 2.4E-06   44.7   2.2  106   17-144   129-235 (909)
365 cd04986 IgC_CH2 CH2 domain (se  91.8    0.39 8.4E-06   30.8   4.1   28  175-203    16-46  (99)
366 PHA02914 Immunoglobulin-like d  91.7     1.5 3.3E-05   35.2   8.0   83   24-111   271-367 (500)
367 cd05901 Ig_Versican Immunoglob  91.7    0.12 2.7E-06   34.2   1.8   78   31-112     1-101 (117)
368 PHA03240 envelope glycoprotein  91.7    0.38 8.3E-06   34.9   4.3   29   25-60     31-59  (258)
369 cd07700 IgV_CD8_beta Immunoglo  91.5     0.2 4.3E-06   32.5   2.7   21  125-145    72-92  (107)
370 PHA02914 Immunoglobulin-like d  91.2     6.5 0.00014   31.8  10.9   21   24-44     18-39  (500)
371 KOG4597|consensus               91.2    0.48   1E-05   38.8   4.9   80   18-111   197-278 (560)
372 KOG1480|consensus               90.7    0.44 9.4E-06   41.4   4.5   43   16-61     23-65  (909)
373 PHA03042 CD47-like protein; Pr  90.5    0.96 2.1E-05   34.4   5.6   33   29-66     28-62  (286)
374 cd07703 Ig2_Nectin-2_like Seco  90.2     3.3 7.2E-05   26.3   9.4   21   34-61     17-38  (95)
375 PHA03052 Hypothetical protein;  89.8     1.7 3.8E-05   25.5   5.1   35   24-62      4-38  (69)
376 cd07704 Ig2_Nectin-3-4_like Se  88.9       1 2.2E-05   28.8   4.2   30  171-200     9-40  (97)
377 PHA03052 Hypothetical protein;  87.2     2.9 6.2E-05   24.6   4.9   33  172-205     6-41  (69)
378 cd04981 IgV_H Immunoglobulin (  86.0     1.8 3.9E-05   28.6   4.3   31  171-201     5-37  (117)
379 cd07691 Ig_CD3_gamma_delta Imm  85.4     5.5 0.00012   23.6   5.5   34  124-160    32-65  (69)
380 cd07692 Ig_CD3_epsilon Immunog  84.7     1.1 2.4E-05   26.2   2.4   27  176-206     5-31  (65)
381 cd07689 Ig2_VCAM-1 Second immu  83.5     2.3 4.9E-05   27.3   3.6   28  175-203    12-42  (99)
382 PHA03189 UL14 tegument protein  80.6      25 0.00055   27.5   9.1   25   24-48     59-83  (348)
383 cd05719 Ig2_PVR_like Second im  80.4     2.9 6.2E-05   26.6   3.4   23  178-200    15-38  (95)
384 PF05790 C2-set:  Immunoglobuli  80.2      11 0.00024   23.1   7.6   27  127-153    45-71  (80)
385 cd07703 Ig2_Nectin-2_like Seco  79.3       3 6.4E-05   26.5   3.2   22  179-200    16-38  (95)
386 PHA03376 BARF1; Provisional     77.5     1.6 3.4E-05   31.6   1.6   36   77-113    75-110 (221)
387 PHA03270 envelope glycoprotein  76.1      43 0.00093   27.6  11.3   42   16-63    220-261 (466)
388 PF07354 Sp38:  Zona-pellucida-  72.2     4.3 9.3E-05   30.9   2.8   22  125-146    37-58  (271)
389 cd05721 IgV_CTLA-4 Immunoglobu  71.6      11 0.00023   25.0   4.3   29  172-200     7-38  (115)
390 PF06328 Lep_receptor_Ig:  Ig-l  71.1      23 0.00049   22.2   7.0   20   24-43     10-29  (89)
391 PHA03112 IL-18 binding protein  67.9      28 0.00061   23.9   5.8   28   30-62     36-63  (141)
392 PHA02865 MHC-like TNF binding   67.7      17 0.00038   28.9   5.4   23   34-61    216-238 (338)
393 PF06328 Lep_receptor_Ig:  Ig-l  65.8      21 0.00045   22.4   4.6   33  172-205    12-49  (89)
394 PF06832 BiPBP_C:  Penicillin-B  64.9      30 0.00066   21.3   5.6   25  180-206    31-55  (89)
395 PHA03269 envelope glycoprotein  63.3      92   0.002   26.3  12.5   42   16-63    328-369 (566)
396 PF02440 Adeno_E3_CR1:  Adenovi  58.6      34 0.00075   19.9   4.8   21   29-60      2-22  (63)
397 PF05790 C2-set:  Immunoglobuli  58.2      41 0.00088   20.6   6.5   23   91-113    44-67  (80)
398 PHA03273 envelope glycoprotein  54.8 1.3E+02  0.0028   25.3  12.1   42   16-63    236-277 (486)
399 PHA02865 MHC-like TNF binding   54.3      25 0.00053   28.1   4.2   21  180-200   216-238 (338)
400 PHA03271 envelope glycoprotein  46.5 1.7E+02  0.0037   24.3  13.3   41   16-62    246-286 (490)
401 cd05890 Ig2_Nectin-1_like Seco  40.8      82  0.0018   20.1   4.2   17  106-122    26-43  (98)
402 PHA02982 hypothetical protein;  40.1 1.6E+02  0.0034   22.0   7.7   27  122-148    97-123 (251)
403 PF10572 UPF0556:  Uncharacteri  37.2 1.5E+02  0.0032   20.9   6.5   14  134-147    69-82  (158)
404 KOG4597|consensus               34.3      69  0.0015   26.9   3.9   55  103-157   214-290 (560)
405 PF15096 G6B:  G6B family        33.8      49  0.0011   23.9   2.7   15   30-44      9-23  (224)
406 PHA02935 Hypothetical protein;  32.7      94   0.002   22.8   4.1   64  127-190   104-167 (349)
407 KOG0613|consensus               31.5 2.8E+02  0.0061   26.6   7.6  108   91-200   246-372 (1205)
408 TIGR00864 PCC polycystin catio  27.7 7.9E+02   0.017   26.4  16.2   99  107-206  1807-1910(2740)
409 PHA03282 envelope glycoprotein  27.4 1.3E+02  0.0028   25.4   4.4   23  124-146   123-145 (540)
410 PHA03282 envelope glycoprotein  27.2 1.3E+02  0.0028   25.4   4.3   22  125-146   333-354 (540)
411 PF01688 Herpes_gI:  Alphaherpe  25.1 2.3E+02   0.005   20.1   4.8   26  122-147   121-146 (161)
412 PF06214 SLAM:  Signaling lymph  24.8 1.2E+02  0.0026   19.9   3.1   17   27-43     35-51  (126)
413 PHA03286 envelope glycoprotein  24.1 1.1E+02  0.0025   25.5   3.5   44  105-148   287-330 (492)
414 PF02480 Herpes_gE:  Alphaherpe  21.0      81  0.0018   26.4   2.3   21  126-146   270-290 (439)
415 PF03921 ICAM_N:  Intercellular  20.5 2.4E+02  0.0051   17.8   8.5   22   21-42      7-28  (91)

No 1  
>KOG3513|consensus
Probab=99.87  E-value=7.6e-21  Score=161.53  Aligned_cols=176  Identities=24%  Similarity=0.415  Sum_probs=140.6

Q ss_pred             cccCCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEE
Q psy5838          13 SESLMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFL   92 (215)
Q Consensus        13 ~~~~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l   92 (215)
                      .....|.++..+++..+..|++++|.|.+.+.|.+.       +.|++ ++.++...     ..+.++.+.     .+.|
T Consensus       327 ~v~a~P~w~~~~~d~~~~~gs~v~~eC~a~g~P~p~-------v~Wlk-Ng~pl~~~-----~r~~~~~i~-----~g~L  388 (1051)
T KOG3513|consen  327 TVYAPPYWLQKPQDTEADTGSNVTLECKASGKPNPT-------VKWLK-NGEPLEPA-----ERDPRYKID-----DGTL  388 (1051)
T ss_pred             EEecCchhhcccceeEecCCCCeEEEEEecCCCCCc-------eEEee-CCeecCcc-----CCCcceEEe-----CCEE
Confidence            345689999999999999999999999999999998       99999 56555311     122334442     3489


Q ss_pred             EEccceecCCEEEEEEccC---------------------------------------------CCceEEEEccC-----
Q psy5838          93 NIKNVQESDRGWYMCQVNT---------------------------------------------NPRISLTYNDH-----  122 (215)
Q Consensus        93 ~i~~~~~~d~G~Y~C~~~~---------------------------------------------~~~~~~~~~~~-----  122 (215)
                      .|.+++.+|+|+|+|.|.|                                             .|.+.+.|.+.     
T Consensus       389 ~is~v~~~dsg~YQC~A~Nk~G~i~anA~L~V~a~~P~f~~~p~~~~~~a~~g~~v~i~C~~~asP~p~~~W~k~~~~~~  468 (1051)
T KOG3513|consen  389 IISNVQESDSGVYQCIAENKYGTIYANAELKVLASAPVFPLNPVERKVMAVVGGTVTIDCKPFASPKPKVSWLKGGEKLL  468 (1051)
T ss_pred             EEEecccccCeEEEeeeecccceEeeeeEEEEEccCCCCCCCccceEEEEEeCCeEEEeeccCCCCcceEEEEcCCcccc
Confidence            9999999999999999884                                             46677777432     


Q ss_pred             --------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcCCeEEecCCCcceeeecCCcEEEEEEecccCC-
Q psy5838         123 --------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQGYPE-  192 (215)
Q Consensus       123 --------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~~p~-  192 (215)
                              .+..|.|.+++.+|+|.|+|.|.+ .++......|.|..++.+..  .+....+..|+++.|.|.+...|. 
T Consensus       469 ~~~r~~i~edGtL~I~n~t~~DaG~YtC~A~N~~G~a~~~~~L~Vkd~tri~~--~P~~~~v~~g~~v~l~Ce~shD~~l  546 (1051)
T KOG3513|consen  469 QSGRIRILEDGTLEISNVTRSDAGKYTCVAENKLGKAESTGNLIVKDATRITL--APSNTDVKVGESVTLTCEASHDPSL  546 (1051)
T ss_pred             cCceEEECCCCcEEecccCcccCcEEEEEEEcccCccceEEEEEEecCceEEe--ccchhhhccCceEEEEeecccCCCc
Confidence                    245699999999999999999976 57778888999999999887  344556889999999999976554 


Q ss_pred             -CeEEEEeCCCccccccC
Q psy5838         193 -PYVMWRREDGANLSYNG  209 (215)
Q Consensus       193 -~~i~W~~~~~~~~~~~~  209 (215)
                       ..+.|.+ ||..++...
T Consensus       547 d~~f~W~~-nG~~id~~~  563 (1051)
T KOG3513|consen  547 DITFTWKK-NGRPIDFNP  563 (1051)
T ss_pred             ceEEEEEE-CCEEhhccC
Confidence             4689999 888877643


No 2  
>KOG3513|consensus
Probab=99.85  E-value=4.2e-20  Score=157.07  Aligned_cols=179  Identities=25%  Similarity=0.387  Sum_probs=137.1

Q ss_pred             ccCCCcccCC-CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEE
Q psy5838          14 ESLMPHFAEP-IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFL   92 (215)
Q Consensus        14 ~~~~p~~~~~-~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l   92 (215)
                      ....|+|... +.+..+..|+.|.|+|.+.|.|.|+       +.|.|.++.++          ..|.....   ....|
T Consensus       237 ~~~~P~i~~~~p~~~~a~~G~~v~LECfA~G~P~P~-------i~W~k~~g~~~----------~~r~~~~~---~~~vL  296 (1051)
T KOG3513|consen  237 REYAPKILVPFPETETALKGQSVKLECFALGNPTPQ-------IKWRKVDGKPP----------PRRATYSN---YGKVL  296 (1051)
T ss_pred             cccCCccccCCCCcccccCCCeEEEEEEecCCCCCc-------EEEEeCCCCCC----------Ccceeeec---cccEE
Confidence            3446777766 5578888999999999999999998       99999887643          22222222   23489


Q ss_pred             EEccceecCCEEEEEEccC------------------------------------------CCceEEEEccC--------
Q psy5838          93 NIKNVQESDRGWYMCQVNT------------------------------------------NPRISLTYNDH--------  122 (215)
Q Consensus        93 ~i~~~~~~d~G~Y~C~~~~------------------------------------------~~~~~~~~~~~--------  122 (215)
                      .|.|++.+|+|.|.|.|.|                                          .|.++++|...        
T Consensus       297 ~I~nv~~~D~G~Y~C~AeN~~G~~~~~~~v~v~a~P~w~~~~~d~~~~~gs~v~~eC~a~g~P~p~v~WlkNg~pl~~~~  376 (1051)
T KOG3513|consen  297 KIPNVQYEDAGEYECIAENSRGSATHSGHVTVYAPPYWLQKPQDTEADTGSNVTLECKASGKPNPTVKWLKNGEPLEPAE  376 (1051)
T ss_pred             EecccCcCCCeEEEEEEecccccceeeEEEEEecCchhhcccceeEecCCCCeEEEEEecCCCCCceEEeeCCeecCccC
Confidence            9999999999999999874                                          57777777321        


Q ss_pred             -------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcC-CeEEecCCCcceeeecCCcEEEEEEecccCCC
Q psy5838         123 -------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVP-PSIIDKDTSTDLVVREQANVTLNCKAQGYPEP  193 (215)
Q Consensus       123 -------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~-p~~~~~~~~~~~~~~~g~~~~l~C~~~~~p~~  193 (215)
                             ....|+|.+++.+|+|.|+|.|.+ .+.....+.|.|... |.+........+.+..|..+.+.|...+.|.|
T Consensus       377 r~~~~~i~~g~L~is~v~~~dsg~YQC~A~Nk~G~i~anA~L~V~a~~P~f~~~p~~~~~~a~~g~~v~i~C~~~asP~p  456 (1051)
T KOG3513|consen  377 RDPRYKIDDGTLIISNVQESDSGVYQCIAENKYGTIYANAELKVLASAPVFPLNPVERKVMAVVGGTVTIDCKPFASPKP  456 (1051)
T ss_pred             CCcceEEeCCEEEEEecccccCeEEEeeeecccceEeeeeEEEEEccCCCCCCCccceEEEEEeCCeEEEeeccCCCCcc
Confidence                   235699999999999999999977 456677788998854 65554333344567899999999999999999


Q ss_pred             eEEEEeCCCccccccCCccc
Q psy5838         194 YVMWRREDGANLSYNGDTEL  213 (215)
Q Consensus       194 ~i~W~~~~~~~~~~~~~~~~  213 (215)
                      .+.|.+ ++..+..++++++
T Consensus       457 ~~~W~k-~~~~~~~~~r~~i  475 (1051)
T KOG3513|consen  457 KVSWLK-GGEKLLQSGRIRI  475 (1051)
T ss_pred             eEEEEc-CCcccccCceEEE
Confidence            999999 5555555666654


No 3  
>KOG4221|consensus
Probab=99.77  E-value=1.4e-17  Score=142.07  Aligned_cols=171  Identities=26%  Similarity=0.456  Sum_probs=131.2

Q ss_pred             cCCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEE
Q psy5838          15 SLMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNI   94 (215)
Q Consensus        15 ~~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i   94 (215)
                      .-.+.|...+.+.++..|+++.|.|.+.+.+.+.       +.|.+++ .++.        .++|+....    ++.|.|
T Consensus       138 a~~~~f~~~~~~~t~~~g~ta~f~c~vn~e~~p~-------i~w~kn~-~pl~--------~~~r~i~lp----sG~L~I  197 (1381)
T KOG4221|consen  138 AGLADFALQPESTTLLYGQTALFSCEVNAEPVPT-------IMWLKND-QPLP--------LDSRVIVLP----SGALEI  197 (1381)
T ss_pred             cccCccccCccceeEecCCcEEEEEEEcCccCce-------eEEeccc-cccc--------CCCcEEEcC----CCcEEe
Confidence            3457788888899999999999999999877776       9999954 4332        233554443    458999


Q ss_pred             ccceecCCEEEEEEccC-------------------------------------------------CCceEEEEccC---
Q psy5838          95 KNVQESDRGWYMCQVNT-------------------------------------------------NPRISLTYNDH---  122 (215)
Q Consensus        95 ~~~~~~d~G~Y~C~~~~-------------------------------------------------~~~~~~~~~~~---  122 (215)
                      .+++..|.|.|.|.+.+                                                 .|.+.+.|...   
T Consensus       198 ~~~qp~d~g~yrc~vt~g~~~r~S~~a~ltv~s~~~~~~~~~fl~~p~~~~v~~g~~v~leCvvs~~p~p~v~Wlrng~~  277 (1381)
T KOG4221|consen  198 SGLQPSDTGEYRCVVTGGASQRTSNEAELTVLSDPGALNKLVFLDEPSNAVVVEGDDVVLECVVSGVPKPSVKWLRNGEK  277 (1381)
T ss_pred             cccccCCCceEEEEEecCCcCCccceeEEEecCCcccccceeeecCCCccccccCCcEEEEEEecCCCCCceEEeeCCee
Confidence            99999999999999874                                                 34455555211   


Q ss_pred             -----------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEEEEcCCeEEecCCCcceeeecCCcEEEEEEeccc
Q psy5838         123 -----------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQGY  190 (215)
Q Consensus       123 -----------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~~  190 (215)
                                 ....|.|.+++..|+|.|+|+|.+. ......+.+.|..+|.+..  .+......++.++.|.|.+.|.
T Consensus       278 i~~ds~rivl~g~~slliS~a~~~dSg~YtC~Atn~~D~idasaev~V~a~P~~~~--~p~~l~A~e~~die~ec~~~g~  355 (1381)
T KOG4221|consen  278 ISVDSYRIVLVGGSSLLISNATDDDSGKYTCRATNTNDSIDASAEVTVLAPPGFTK--APTTLVAHESMDIEFECPVSGK  355 (1381)
T ss_pred             eeecceEEEEecccceEEeccccccCceEEEEecCCCcccccceEEEEEcCCCCCC--CCcceeeeeccceeEeCCCCCC
Confidence                       1234889999999999999999763 4456667788998988774  3455567789999999999999


Q ss_pred             CCCeEEEEeCCCcccccc
Q psy5838         191 PEPYVMWRREDGANLSYN  208 (215)
Q Consensus       191 p~~~i~W~~~~~~~~~~~  208 (215)
                      |.|.+.|+| ||..+..+
T Consensus       356 p~p~v~w~k-Ngd~~ips  372 (1381)
T KOG4221|consen  356 PIPTVRWYK-NGDRIIPS  372 (1381)
T ss_pred             CcceEEEEe-cCcccCcc
Confidence            999999999 77665543


No 4  
>KOG4194|consensus
Probab=99.77  E-value=4.2e-18  Score=136.73  Aligned_cols=190  Identities=21%  Similarity=0.345  Sum_probs=134.9

Q ss_pred             cccccccCCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEee--ec-eeeeCCceEEEE-
Q psy5838           9 VSSVSESLMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIH--HN-VITQNPRISLTY-   84 (215)
Q Consensus         9 ~~~~~~~~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~--~~-~~~~~~~~~~~~-   84 (215)
                      ......+.+|++...|+.+.+..|+.++|+|.+.++.... .    .+.|.+.+. ......  +. ......|-.... 
T Consensus       495 ~lvC~DspkpqI~~qPe~~~al~g~nirftC~a~sssasp-l----si~WR~dne-vq~rv~ved~a~~~~q~r~~~~~e  568 (873)
T KOG4194|consen  495 NLVCDDSPKPQIVTQPETVSALIGENIRFTCNAYSSSASP-L----SIEWRKDNE-VQPRVDVEDFATFLSQNRNGTFGE  568 (873)
T ss_pred             hceecCCCCcceecCchHhhhhhccceEEEEEeccCCCCC-c----eeEeeeccc-cCcccchhcchhhhhhhccCccch
Confidence            3456688899999999999999999999999998742221 1    289988543 211100  00 001111111111 


Q ss_pred             cCCceEEEEEccceecCCEEEEEEcc-------------------------------------------CCCceEEEEcc
Q psy5838          85 NDHRSWFLNIKNVQESDRGWYMCQVN-------------------------------------------TNPRISLTYND  121 (215)
Q Consensus        85 ~~~~~~~l~i~~~~~~d~G~Y~C~~~-------------------------------------------~~~~~~~~~~~  121 (215)
                      ...-.+.|.+.|++..|+|+|+|.+.                                           |.|.+.+.|..
T Consensus       569 ~~~~~~~L~L~nVt~td~grYQCVvtN~FGStysqk~KltV~~~PsFtktP~dltl~tg~mArl~CaAtG~P~PeIawqk  648 (873)
T KOG4194|consen  569 REEYTAILHLDNVTFTDEGRYQCVVTNHFGSTYSQKAKLTVNQAPSFTKTPEDLTLRTGQMARLECAATGHPRPEIAWQK  648 (873)
T ss_pred             hhhhhheeeeeeeecccCceEEEEEecccCcchhheeEEEeeccCccccCcccceeecccceeeeeeccCCCCcceeehh
Confidence            11134579999999999999999876                                           35777777733


Q ss_pred             C-----------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcCCeEEecCCCcceeeecCCcEEE
Q psy5838         122 H-----------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTL  183 (215)
Q Consensus       122 ~-----------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l  183 (215)
                      .                 .+-.+.|.+++.+|+|.|+|.|.+ .+..+..+++.|...|.+..+  -.+..+..|++..|
T Consensus       649 dggtdFPAA~eRRl~Vmpedd~f~Itnvk~eD~GiYtC~A~n~AG~isanAtL~V~e~p~f~~P--L~~~~V~~get~vl  726 (873)
T KOG4194|consen  649 DGGTDFPAARERRLHVMPEDDVFFITNVKIEDQGIYTCTAQNVAGQISANATLTVLETPSFSIP--LEDQLVVVGETLVL  726 (873)
T ss_pred             cCCCCCchhhhheeeecCCCCEEEEecccccccceeEEeeeccccceeeceEEEEecCCccccc--ccceEEEecceEEE
Confidence            1                 123477999999999999999976 567788889999999887764  33456788999999


Q ss_pred             EEEecccCC-CeEEEEeCCCccccc
Q psy5838         184 NCKAQGYPE-PYVMWRREDGANLSY  207 (215)
Q Consensus       184 ~C~~~~~p~-~~i~W~~~~~~~~~~  207 (215)
                      .|.+.+.|. |.+.|++ +.+++-.
T Consensus       727 qC~a~~~~a~pr~~W~k-~d~pil~  750 (873)
T KOG4194|consen  727 QCLAEGAPADPRLEWFK-EDKPILI  750 (873)
T ss_pred             EEecCCCCCCccccccC-CCCceEE
Confidence            999999877 8999999 5555543


No 5  
>PHA02785 IL-beta-binding protein; Provisional
Probab=99.76  E-value=4.9e-17  Score=127.16  Aligned_cols=155  Identities=22%  Similarity=0.438  Sum_probs=104.4

Q ss_pred             ceEEEeCCcEEEEEEe-----eccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceec
Q psy5838          26 NVTVTVGRDALLACVV-----DNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQES  100 (215)
Q Consensus        26 ~~~~~~G~~v~L~C~~-----~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~  100 (215)
                      ...+.+|+.+.|.|.+     .+.+.+.       +.|+|+++..            .+. ....  ....|.|.++..+
T Consensus        35 ~~~~~~ge~~~l~C~~~~~~~~g~p~~~-------i~W~K~g~~~------------~~~-~~~~--~g~~l~i~~~~~~   92 (326)
T PHA02785         35 SFMELENEPVILPCPQINTLSSGYNILD-------ILWEKRGADN------------DRI-IPID--NGSNMLILNPTQS   92 (326)
T ss_pred             hhhhhcCCCEEEECCCccccccCCCCce-------EEEEECCCcc------------ceE-EEcc--CCceEEEcccCcc
Confidence            4455689999999997     4666666       9999964320            011 1111  1124778999999


Q ss_pred             CCEEEEEEccC-------------------------------------------------CCceEEEEccCC--------
Q psy5838         101 DRGWYMCQVNT-------------------------------------------------NPRISLTYNDHR--------  123 (215)
Q Consensus       101 d~G~Y~C~~~~-------------------------------------------------~~~~~~~~~~~~--------  123 (215)
                      |+|.|+|.+.|                                                 .+.+.+.|....        
T Consensus        93 DsG~Y~C~a~N~~g~~~~s~~L~V~~~~~~~~~~~~~~~~~~~g~~~~i~C~~~~~~~~~~~~~~i~W~k~~~~~~~r~~  172 (326)
T PHA02785         93 DSGIYICITKNETYCDMMSLNLTIVSVSESNIDLISYPQIVNERSTGEMVCPNINAFIASNVNADIIWSGHRRLRNKRLK  172 (326)
T ss_pred             cCeEEEEEEECCCcceEEEEEEEEEecCCCccceeeccceecccCcEEEECCChhhcccCCCCceEEEccCCccCCcceE
Confidence            99999998764                                                 234456663211        


Q ss_pred             ---eEEEEEcccCCCCCeEEEEEeecC-CCcc----eeeEEEEEc---CCeEEecCCCcceeeecCCcEEEEEEecccCC
Q psy5838         124 ---SWFLNIKNVQESDRGWYMCQVNTD-PMRS----RQGYLQVVV---PPSIIDKDTSTDLVVREQANVTLNCKAQGYPE  192 (215)
Q Consensus       124 ---~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~----~~~~l~v~~---~p~~~~~~~~~~~~~~~g~~~~l~C~~~~~p~  192 (215)
                         ...|.|.+++.+|.|.|+|.+.+. +...    ..+.+.|..   ||.+.   .+....+..|+.+.|.|.+.+.|.
T Consensus       173 ~~~~~~L~i~~v~~~d~G~Y~C~~~n~~g~~~~~~t~~v~l~V~~~~~pp~~~---~p~~~~~~~G~~v~L~C~a~g~P~  249 (326)
T PHA02785        173 QRTPGIITIEDVRKNDAGYYTCVLKYIYGDKTYNVTRIVKLEVRDRIIPPTMQ---LPEGVVTSIGSNLTIACRVSLRPP  249 (326)
T ss_pred             ecCCCeEEEeecChhhCeEEEEEEEeccCCEEEeEEEEEEEEEeccCCCceec---CCCcEEecCCCcEEEEEEEECCCC
Confidence               246999999999999999999763 2222    223344432   33332   334556778999999999999876


Q ss_pred             C---eEEEEeCCCcccc
Q psy5838         193 P---YVMWRREDGANLS  206 (215)
Q Consensus       193 ~---~i~W~~~~~~~~~  206 (215)
                      +   .+.|++ ||..+.
T Consensus       250 ~~~~~v~W~k-ng~~i~  265 (326)
T PHA02785        250 TTDADVFWIS-NGMYYE  265 (326)
T ss_pred             CCCceEEEEE-CCEECC
Confidence            4   799999 787664


No 6  
>KOG4222|consensus
Probab=99.63  E-value=2.8e-15  Score=127.60  Aligned_cols=169  Identities=29%  Similarity=0.473  Sum_probs=129.2

Q ss_pred             CCcccCCCCceEEEeCCcEEEEEEee-ccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEc
Q psy5838          17 MPHFAEPIPNVTVTVGRDALLACVVD-NLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIK   95 (215)
Q Consensus        17 ~p~~~~~~~~~~~~~G~~v~L~C~~~-~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~   95 (215)
                      +..|...+..+.+..|+.++|+|.-. +++.+.       +.|.| ++..+..      ....++.+.    ..|.|.|.
T Consensus       131 rddfrv~prd~~~a~ge~avlEcgpP~ghpept-------vSw~K-dg~pl~~------~~~~~~~li----sgG~LlIs  192 (1281)
T KOG4222|consen  131 RDDFRVSPRDVQAAVGEEAVLECGPPRGHPEPT-------VSWVK-DGKPLDH------YDVPIIALI----SGGNLLIS  192 (1281)
T ss_pred             chhcccCcccccccccceeEEeccCCCCCCCCc-------ceeec-CCCcccc------ccceeEEEe----cCCcEEEe
Confidence            44577778889999999999999854 677787       99999 6665531      112233333    34589999


Q ss_pred             cceecCCEEEEEEccC-------------------------------------------CCceEEEEcc-----------
Q psy5838          96 NVQESDRGWYMCQVNT-------------------------------------------NPRISLTYND-----------  121 (215)
Q Consensus        96 ~~~~~d~G~Y~C~~~~-------------------------------------------~~~~~~~~~~-----------  121 (215)
                      |+..+|+|.|.|.+.+                                           +|.+.+.|..           
T Consensus       193 nvrksD~GtY~CVatNmvG~ReS~~A~lsv~e~P~f~~rp~~~~v~~g~~~~f~c~v~GdP~P~Vrwkk~~~~~P~~ry~  272 (1281)
T KOG4222|consen  193 NVRKSDEGTYACVATNMVGERESIPARLSVQEKPWFWKRPKDLAVLVGAAAEFDCRVGGDPQPTVRWKKDDPSLPRSRYS  272 (1281)
T ss_pred             ccccCCCceeeeeecccccccccccceeeeccCCccccccccceeecccccccccccCCCCCCceeeeccCCCCCcccee
Confidence            9999999999999873                                           5566666632           


Q ss_pred             --CCeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcCCeEEecCCCcceeeecCCcEEEEEEecccCCCeEEEE
Q psy5838         122 --HRSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQGYPEPYVMWR  198 (215)
Q Consensus       122 --~~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~~p~~~i~W~  198 (215)
                        ..+.+|+|.+++..|.|.|.|.+.+ .+.......+.|+.+|.+...  +.+..+..|..++|.|.+.++|.|.++|.
T Consensus       273 i~~d~qtl~i~r~tp~deg~y~C~a~n~vG~l~asa~ltV~apP~f~kk--p~dq~v~lg~~vt~pc~~~gnP~PavfW~  350 (1281)
T KOG4222|consen  273 ILDDTQTLRIDRVTPTDEGTYVCPAENLVGGLEASATLTVQAPPSFGKK--PRDQKVALGGTVTFPCETLGNPPPAVFWL  350 (1281)
T ss_pred             eeeccccccccccCCCcccceeeeccccccccccccceEEecCcccccc--cCccccccCceEEeeeecCCCCCcceEEe
Confidence              1235688999999999999999966 566777788999999988764  33445778999999999999999999999


Q ss_pred             eCCCccc
Q psy5838         199 REDGANL  205 (215)
Q Consensus       199 ~~~~~~~  205 (215)
                      +++++.+
T Consensus       351 keg~q~l  357 (1281)
T KOG4222|consen  351 KEGSQDL  357 (1281)
T ss_pred             ccCccee
Confidence            9655544


No 7  
>KOG4221|consensus
Probab=99.60  E-value=1.4e-14  Score=124.09  Aligned_cols=177  Identities=27%  Similarity=0.438  Sum_probs=121.4

Q ss_pred             ccCCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEE
Q psy5838          14 ESLMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLN   93 (215)
Q Consensus        14 ~~~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~   93 (215)
                      ..-.-.|...|.+.  .+|..+.|.|....... ..+.    ++|.| ++..+..      ..+.|.+..    .+++|.
T Consensus        38 ~~~~~~f~~ep~d~--~~~~svlLecs~~~~~~-~~~~----i~wkk-Dg~~l~e------~~d~~~~~L----sNgSl~   99 (1381)
T KOG4221|consen   38 ANTPLQFLLEPSDA--MEGSSVLLECSAYAAGG-TSVK----IEWKK-DGSQLNE------VYDDRRQLL----SNGSLY   99 (1381)
T ss_pred             ccCcceEEeccccc--ccccceEEeccccccCC-CCee----EEEcc-Cchhhhh------hhhhHHhhc----cCCcee
Confidence            33345566666544  78999999999875443 1222    89987 6554422      122333333    345888


Q ss_pred             Ecccee-----cCCEEEEEEccC--------------------------------------------CCceEEEEccC--
Q psy5838          94 IKNVQE-----SDRGWYMCQVNT--------------------------------------------NPRISLTYNDH--  122 (215)
Q Consensus        94 i~~~~~-----~d~G~Y~C~~~~--------------------------------------------~~~~~~~~~~~--  122 (215)
                      |.++..     .|+|.|+|.|..                                            .+-+.+.|...  
T Consensus       100 i~~v~~~kh~~~~eg~Yqc~atv~~~gsi~Sr~a~v~~a~~~~f~~~~~~~t~~~g~ta~f~c~vn~e~~p~i~w~kn~~  179 (1381)
T KOG4221|consen  100 ISSVLASKHNKVDEGVYQCLATVEDVGSILSRTAKVALAGLADFALQPESTTLLYGQTALFSCEVNAEPVPTIMWLKNDQ  179 (1381)
T ss_pred             EeeecccccccccCceEEEEEEccccceeecceEEEEecccCccccCccceeEecCCcEEEEEEEcCccCceeEEecccc
Confidence            888776     899999999772                                            33445555221  


Q ss_pred             -----------CeEEEEEcccCCCCCeEEEEEeecCC--CcceeeEEEEEcCCeE----EecCCCcceeeecCCcEEEEE
Q psy5838         123 -----------RSWFLNIKNVQESDRGWYMCQVNTDP--MRSRQGYLQVVVPPSI----IDKDTSTDLVVREQANVTLNC  185 (215)
Q Consensus       123 -----------~~~~l~i~~~~~~d~G~Y~C~~~~~~--~~~~~~~l~v~~~p~~----~~~~~~~~~~~~~g~~~~l~C  185 (215)
                                 -+..|.|.+++..|.|.|.|.+.+..  ..+..+.++|...|.+    .....+....+.+|+.+.|+|
T Consensus       180 pl~~~~r~i~lpsG~L~I~~~qp~d~g~yrc~vt~g~~~r~S~~a~ltv~s~~~~~~~~~fl~~p~~~~v~~g~~v~leC  259 (1381)
T KOG4221|consen  180 PLPLDSRVIVLPSGALEISGLQPSDTGEYRCVVTGGASQRTSNEAELTVLSDPGALNKLVFLDEPSNAVVVEGDDVVLEC  259 (1381)
T ss_pred             cccCCCcEEEcCCCcEEecccccCCCceEEEEEecCCcCCccceeEEEecCCcccccceeeecCCCccccccCCcEEEEE
Confidence                       13459999999999999999997643  2355666777643322    112245556688999999999


Q ss_pred             EecccCCCeEEEEeCCCccccccC
Q psy5838         186 KAQGYPEPYVMWRREDGANLSYNG  209 (215)
Q Consensus       186 ~~~~~p~~~i~W~~~~~~~~~~~~  209 (215)
                      .+.+.|.|++.|.+ ||..|..++
T Consensus       260 vvs~~p~p~v~Wlr-ng~~i~~ds  282 (1381)
T KOG4221|consen  260 VVSGVPKPSVKWLR-NGEKISVDS  282 (1381)
T ss_pred             EecCCCCCceEEee-CCeeeeecc
Confidence            99999999999999 898888765


No 8  
>KOG4222|consensus
Probab=99.56  E-value=2.1e-14  Score=122.38  Aligned_cols=173  Identities=23%  Similarity=0.393  Sum_probs=122.1

Q ss_pred             cccCCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEE
Q psy5838          13 SESLMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFL   92 (215)
Q Consensus        13 ~~~~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l   92 (215)
                      .....|.++.-+....+..|+.++|.|...+.+.++       +.|+|+ |...+.      ..-...++...+..-+.|
T Consensus        27 ~qd~~p~iiehp~d~vvs~~~patlnc~asG~ppPt-------i~w~k~-G~~~~~------~e~~shR~~lp~gsLf~l   92 (1281)
T KOG4222|consen   27 AQDQPPRIIEHPHDLVVSKGEPATLNCKASGDPPPT-------IEWYKD-GENVFK------GEPGSHRFLLPDGSLFLL   92 (1281)
T ss_pred             cccCCCceEecchhhhccCCCCceeecCCCCCCCCc-------eecccC-CcccCC------CCCCCcceecCCccEEEE
Confidence            345578999999999999999999999999998888       999994 432110      001111222222222233


Q ss_pred             EEccc--eecCCEEEEEEccC---------------------------------------------CCceEEEEcc----
Q psy5838          93 NIKNV--QESDRGWYMCQVNT---------------------------------------------NPRISLTYND----  121 (215)
Q Consensus        93 ~i~~~--~~~d~G~Y~C~~~~---------------------------------------------~~~~~~~~~~----  121 (215)
                      .+..-  ...|.|.|+|.+.|                                             .|.+.+.|.+    
T Consensus        93 ~~ahg~~a~~d~G~y~cvasn~~g~avSr~a~L~vavlrddfrv~prd~~~a~ge~avlEcgpP~ghpeptvSw~Kdg~p  172 (1281)
T KOG4222|consen   93 RLAHGKKAGHDHGVYSCVASNRLGEAVSRGASLIVAVLRDDFRVSPRDVQAAVGEEAVLECGPPRGHPEPTVSWVKDGKP  172 (1281)
T ss_pred             ecccCCcccCCCceeEeeecCccceeeecCceEEEEEechhcccCcccccccccceeEEeccCCCCCCCCcceeecCCCc
Confidence            32221  12388999999874                                             2344455521    


Q ss_pred             -----------CCeEEEEEcccCCCCCeEEEEEeecCC--CcceeeEEEEEcCCeEEecCCCcceeeecCCcEEEEEEec
Q psy5838         122 -----------HRSWFLNIKNVQESDRGWYMCQVNTDP--MRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQ  188 (215)
Q Consensus       122 -----------~~~~~l~i~~~~~~d~G~Y~C~~~~~~--~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~  188 (215)
                                 -....|.|.+++++|.|.|.|++++..  ..+....++|+.+|.+..  .+.+..+..|..+.+.|.+.
T Consensus       173 l~~~~~~~~~lisgG~LlIsnvrksD~GtY~CVatNmvG~ReS~~A~lsv~e~P~f~~--rp~~~~v~~g~~~~f~c~v~  250 (1281)
T KOG4222|consen  173 LDHYDVPIIALISGGNLLISNVRKSDEGTYACVATNMVGERESIPARLSVQEKPWFWK--RPKDLAVLVGAAAEFDCRVG  250 (1281)
T ss_pred             cccccceeEEEecCCcEEEeccccCCCceeeeeecccccccccccceeeeccCCcccc--ccccceeecccccccccccC
Confidence                       123458999999999999999997732  345556799999998775  34566788999999999999


Q ss_pred             ccCCCeEEEEeCC
Q psy5838         189 GYPEPYVMWRRED  201 (215)
Q Consensus       189 ~~p~~~i~W~~~~  201 (215)
                      |.|.|.+.|.+.+
T Consensus       251 GdP~P~Vrwkk~~  263 (1281)
T KOG4222|consen  251 GDPQPTVRWKKDD  263 (1281)
T ss_pred             CCCCCceeeeccC
Confidence            9999999999943


No 9  
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=99.54  E-value=2e-13  Score=88.17  Aligned_cols=93  Identities=24%  Similarity=0.328  Sum_probs=67.6

Q ss_pred             CcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccc
Q psy5838          18 PHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNV   97 (215)
Q Consensus        18 p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~   97 (215)
                      |.|...+..+.+..|+++.|.|.+.|.+.+.       +.|+| ++..+.        ...++.+...+           
T Consensus         1 p~~~~~p~~~~v~~G~~v~l~C~~~G~p~p~-------v~W~k-dg~~l~--------~~~~~~~~~~~-----------   53 (98)
T cd05762           1 PQIIQFPEDMKVRAGESVELFCKVTGTQPIT-------CTWMK-FRKQIQ--------EGEGIKIENTE-----------   53 (98)
T ss_pred             CceEECCcCEEEECCCEEEEEEEEcccCCCc-------eEEEE-CCEEec--------CCCcEEEEecC-----------
Confidence            6788888999999999999999999998888       99999 555441        22233333221           


Q ss_pred             eecCCEEEEEEccCCCceEEEEccCCeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcCC
Q psy5838          98 QESDRGWYMCQVNTNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVPP  162 (215)
Q Consensus        98 ~~~d~G~Y~C~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p  162 (215)
                                               ....|.|.++..+|+|.|+|.+.+ .+.....+.|.|..+|
T Consensus        54 -------------------------~~s~L~I~~~~~~D~G~Ytc~a~N~~G~~~~~~~l~V~~~P   94 (98)
T cd05762          54 -------------------------NSSKLTITEGQQEHCGCYTLEVENKLGSRQAQVNLTVVDKP   94 (98)
T ss_pred             -------------------------CeeEEEECCCChhhCEEEEEEEEcCCCceeEEEEEEEecCC
Confidence                                     112467888888888888898866 4556667778887665


No 10 
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=99.53  E-value=3.7e-13  Score=99.71  Aligned_cols=75  Identities=19%  Similarity=0.368  Sum_probs=50.6

Q ss_pred             EEEEcccCCCCCeEEEEEeecCC-CcceeeEEEEEcCCeEEecCCCcceeeecCCcEEEEEEecc-----cCCCeEEEEe
Q psy5838         126 FLNIKNVQESDRGWYMCQVNTDP-MRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQG-----YPEPYVMWRR  199 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~~~~-~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~-----~p~~~i~W~~  199 (215)
                      .|.|.+++.+|+|.|+|.+.+.. .....+.+.|..+        ..+..+.+|+++.|.|.+.+     .|.|.+.|++
T Consensus        99 ~L~I~~v~~~DsG~Y~C~a~N~~~~~~~~i~L~V~~~--------~~~~~~~~G~~v~L~C~~~~~~~~~~p~p~I~WyK  170 (227)
T PHA02826         99 NLWIGNVINIDEGIYICTISSGNICEESTIRLTFDSG--------TINYQFNSGKDSKLHCYGTDGISSTFKDYTLTWYK  170 (227)
T ss_pred             eEEECCCChHHCEEEEEEEEECCcceEEEEEEEEecC--------CccceEecCCCEEEEeeCCCCccccCCCceEEEEE
Confidence            47788888888888888886532 2233344444221        12345678999999999853     4578999999


Q ss_pred             CCCccccccC
Q psy5838         200 EDGANLSYNG  209 (215)
Q Consensus       200 ~~~~~~~~~~  209 (215)
                       ||+.+..+.
T Consensus       171 -ng~~l~~~~  179 (227)
T PHA02826        171 -NGNIVLYTD  179 (227)
T ss_pred             -CCEECCCCC
Confidence             888776443


No 11 
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=99.48  E-value=8.6e-13  Score=84.50  Aligned_cols=78  Identities=28%  Similarity=0.440  Sum_probs=48.4

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCE
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRG  103 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G  103 (215)
                      ..++.+.+|+++.|+|.+.+.+.+.       +.|++.++. ++.........+.|+.+.......+.|.|.+++.+|+|
T Consensus         4 ~~~~tv~~G~tv~L~C~v~g~~~~~-------v~W~k~~~~-~~~~~~~~~~~~~r~~~~~~~~~~~~L~I~nV~~~D~G   75 (95)
T cd05882           4 TQDETVAVGGTVTLKCGVKEHDNSS-------LQWSNTAQQ-TLYFGEKRALRDNRIQLVKSTPTELIISISNVQLSDEG   75 (95)
T ss_pred             cccEEEecCCcEEEEEEEeCCCCCe-------EEEeccCcc-EEEeCCeEEEeCCeEEEEeCCCceEEEEECCCCcccCE
Confidence            3578899999999999999988777       999996543 33322223334455554444333445555555555444


Q ss_pred             EEEEEc
Q psy5838         104 WYMCQV  109 (215)
Q Consensus       104 ~Y~C~~  109 (215)
                      .|+|.+
T Consensus        76 ~YtC~~   81 (95)
T cd05882          76 EYTCSI   81 (95)
T ss_pred             EEEEEE
Confidence            444443


No 12 
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=99.46  E-value=8.9e-13  Score=84.31  Aligned_cols=79  Identities=29%  Similarity=0.381  Sum_probs=54.1

Q ss_pred             CCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEc
Q psy5838          16 LMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIK   95 (215)
Q Consensus        16 ~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~   95 (215)
                      .+|.|...|....+.+|+++.|.|.+.+.|.+.       +.|+++ +..+        ..+.++.+.... ..+.|.|.
T Consensus         2 ~~~~~~~~p~~~~~~~G~~~~L~C~~~g~P~p~-------v~W~k~-g~~l--------~~~~~~~~~~~~-~~~~L~i~   64 (92)
T cd05747           2 LPATILTKPRSLTVSEGESARFSCDVDGEPAPT-------VTWMRE-GQII--------VSSQRHQITSTE-YKSTFEIS   64 (92)
T ss_pred             CCCcccccCccEEEeCCCcEEEEEEEeecCCCE-------EEEEEC-CEEC--------CCCCcEEEEEcC-CeeEEEEC
Confidence            368888889999999999999999999999887       999995 4332        123344443322 23456666


Q ss_pred             cceecCCEEEEEEccC
Q psy5838          96 NVQESDRGWYMCQVNT  111 (215)
Q Consensus        96 ~~~~~d~G~Y~C~~~~  111 (215)
                      +++.+|+|.|+|.+.|
T Consensus        65 ~~~~~D~G~Y~C~a~N   80 (92)
T cd05747          65 KVQMSDEGNYTVVVEN   80 (92)
T ss_pred             CCCcccCEeEEEEEEc
Confidence            5555555555555544


No 13 
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=99.41  E-value=4.1e-12  Score=81.55  Aligned_cols=79  Identities=29%  Similarity=0.432  Sum_probs=46.2

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCE
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRG  103 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G  103 (215)
                      +.++.+.+|++++|.|.+.+.+.+.       +.|++.++..+ .........++|+.........++|.|.+++.+|+|
T Consensus         4 ~~~v~v~eG~~v~L~C~~~~~p~~~-------v~W~~~~~~~l-~~~~~~~~~~~r~~~~~~~~~~~sL~I~~v~~~DsG   75 (95)
T cd07701           4 TQNVTVVEGGTANLTCRVDQNDNTS-------LQWSNPAQQTL-YFDDKKALRDNRIELVRASWHELSISISDVSLSDEG   75 (95)
T ss_pred             cceEEEecCCcEEEEEEEecCCceE-------EEEeCCCCeEE-EEcCcccccCCCEEEEECCCCcEEEEECcCCcccCE
Confidence            4578999999999999999887776       99998544333 222222223445544332223344555554444444


Q ss_pred             EEEEEcc
Q psy5838         104 WYMCQVN  110 (215)
Q Consensus       104 ~Y~C~~~  110 (215)
                      .|+|.+.
T Consensus        76 ~Y~C~~~   82 (95)
T cd07701          76 QYTCSLF   82 (95)
T ss_pred             EEEEEeE
Confidence            4444443


No 14 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=99.39  E-value=2.9e-12  Score=81.93  Aligned_cols=32  Identities=28%  Similarity=0.419  Sum_probs=28.5

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |+.+.+.+|+++.|.|.+.+.|.|.       +.|+|++
T Consensus         8 p~~v~v~~G~~v~L~C~v~G~P~p~-------v~W~k~g   39 (92)
T cd05737           8 PDVVTIMEGKTLNLTCTVFGDPDPE-------VSWLKND   39 (92)
T ss_pred             CceEEEeCCCcEEEEEEEEecCCCe-------EEEEECC
Confidence            5678899999999999999998887       9999943


No 15 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=99.39  E-value=2.9e-12  Score=82.31  Aligned_cols=37  Identities=14%  Similarity=0.360  Sum_probs=29.4

Q ss_pred             CCCceEEEeCCcEEEEEEeeccCC-ccceeeeEEEEEEecCCccE
Q psy5838          23 PIPNVTVTVGRDALLACVVDNLKG-FKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~~~~~-~~~~~~~~~v~W~~~~~~~~   66 (215)
                      .|....+..|++++|.|.+.+.|. +.       +.|++.++..+
T Consensus         6 ~p~~~~v~~G~~v~l~C~v~G~P~~p~-------i~W~~~~g~~l   43 (96)
T cd05865           6 VPSQGEISVGESKFFLCQVAGEAKDKD-------ISWFSPNGEKL   43 (96)
T ss_pred             eCCccEECCCCeEEEEEEEeCCCCCCE-------EEEECCCCcCc
Confidence            456678889999999999999874 56       99998555543


No 16 
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.39  E-value=4.6e-12  Score=80.25  Aligned_cols=39  Identities=10%  Similarity=0.169  Sum_probs=35.0

Q ss_pred             CCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          17 MPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        17 ~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +|.|...+.+..+.+|+++.|.|.+.|.|.|.       +.|+|++
T Consensus         1 ~p~i~~~~~~~~~~~G~~v~l~C~~~G~P~P~-------v~W~k~~   39 (88)
T cd05851           1 PADINVKFKDTYALKGQNVTLECFALGNPVPV-------IRWRKIL   39 (88)
T ss_pred             CCceEEccccEEEeCCCcEEEEEEecccCCCE-------EEEEECC
Confidence            47788888899999999999999999999887       9999954


No 17 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=99.38  E-value=3e-12  Score=81.49  Aligned_cols=76  Identities=30%  Similarity=0.471  Sum_probs=52.1

Q ss_pred             CcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccc
Q psy5838          18 PHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNV   97 (215)
Q Consensus        18 p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~   97 (215)
                      |.|...+..+.+.+|+++.|.|.+.+.+.+.       +.|+++ +..+        ..+.++.....+ ....|.|.++
T Consensus         1 P~~~~~~~~~~v~~G~~~~l~c~~~~~p~~~-------v~W~~~-~~~l--------~~~~~~~~~~~~-~~~~L~I~~v   63 (90)
T PF07679_consen    1 PVFTKKPKDVTVKEGESVTLECEVSGNPPPT-------VTWYKN-GRPL--------TSSQRYQIESDG-GSSSLTIKNV   63 (90)
T ss_dssp             EEEEEESSEEEEETTSEEEEEEEEEESSSSE-------EEEEET-TEEE--------ESSSSEEEEEET-TEEEEEESSE
T ss_pred             CEEEEecCCEEEeCCCEEEEEEEEEeCCCCc-------cccccc-ccce--------eeeeeeeeeccc-ceeEEccCCC
Confidence            6788888999999999999999999987777       999995 5544        234555555443 4445555555


Q ss_pred             eecCCEEEEEEcc
Q psy5838          98 QESDRGWYMCQVN  110 (215)
Q Consensus        98 ~~~d~G~Y~C~~~  110 (215)
                      ..+|+|.|+|.+.
T Consensus        64 ~~~D~G~Y~C~~~   76 (90)
T PF07679_consen   64 TREDAGTYTCVAS   76 (90)
T ss_dssp             SGGGSEEEEEEEE
T ss_pred             ChhhCEEEEEEEE
Confidence            4444444444443


No 18 
>KOG4194|consensus
Probab=99.38  E-value=7.4e-12  Score=101.43  Aligned_cols=136  Identities=20%  Similarity=0.299  Sum_probs=98.5

Q ss_pred             ccCCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEE
Q psy5838          14 ESLMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLN   93 (215)
Q Consensus        14 ~~~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~   93 (215)
                      ....|+|+..|+++++..|+.+.|.|.+.|.|.|.       +.|.|..+...-.      ....|..+..++   -.+.
T Consensus       609 V~~~PsFtktP~dltl~tg~mArl~CaAtG~P~Pe-------IawqkdggtdFPA------A~eRRl~Vmped---d~f~  672 (873)
T KOG4194|consen  609 VNQAPSFTKTPEDLTLRTGQMARLECAATGHPRPE-------IAWQKDGGTDFPA------ARERRLHVMPED---DVFF  672 (873)
T ss_pred             eeccCccccCcccceeecccceeeeeeccCCCCcc-------eeehhcCCCCCch------hhhheeeecCCC---CEEE
Confidence            34589999999999999999999999999999998       9999955442221      223455555543   2899


Q ss_pred             EccceecCCEEEEEEccC-------------------------------------------CCceEEEEccC--------
Q psy5838          94 IKNVQESDRGWYMCQVNT-------------------------------------------NPRISLTYNDH--------  122 (215)
Q Consensus        94 i~~~~~~d~G~Y~C~~~~-------------------------------------------~~~~~~~~~~~--------  122 (215)
                      |.|++.+|+|.|+|.|.+                                           .+.+.+.|.+.        
T Consensus       673 Itnvk~eD~GiYtC~A~n~AG~isanAtL~V~e~p~f~~PL~~~~V~~get~vlqC~a~~~~a~pr~~W~k~d~pil~t~  752 (873)
T KOG4194|consen  673 ITNVKIEDQGIYTCTAQNVAGQISANATLTVLETPSFSIPLEDQLVVVGETLVLQCLAEGAPADPRLEWFKEDKPILITE  752 (873)
T ss_pred             EecccccccceeEEeeeccccceeeceEEEEecCCcccccccceEEEecceEEEEEecCCCCCCccccccCCCCceEEee
Confidence            999999999999999873                                           11244444221        


Q ss_pred             ------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcCCeEE
Q psy5838         123 ------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVPPSII  165 (215)
Q Consensus       123 ------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p~~~  165 (215)
                            .+--|.+.+...+|+|.|+|++.+ .+.....+.+.+...+...
T Consensus       753 rh~f~d~dQllvv~~~~~~daG~yTcem~~~~~~~~~~i~l~~~~~~~~~  802 (873)
T KOG4194|consen  753 RHTFPDGDQLLVVKENLVEDAGIYTCEMSNTLGTERIHICLLVYQKKKCR  802 (873)
T ss_pred             cccCCCCCeEEEEEehhhhhcceEEEEEEeeccceeeEEEEEEeecCCcc
Confidence                  233377888889999999999965 3555666666666555433


No 19 
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=99.38  E-value=1.4e-11  Score=78.49  Aligned_cols=83  Identities=28%  Similarity=0.418  Sum_probs=56.3

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCE
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRG  103 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G  103 (215)
                      .+++++.+|++++|.|.+.+.....       +.|++.+...+. ........+.|+.......+.++|.|.+++.+|+|
T Consensus         4 ~~nvtv~~G~ta~L~C~v~~~~~~~-------v~w~~~~~~~i~-~~~~~~~~d~Rf~~~~~~~~~~tL~I~~vq~~D~G   75 (95)
T cd05881           4 TEDVTVVEGEVAIISCRVKNNDDSV-------IQLLNPNRQTIY-FRDVRPLKDSRFQLVNFSSNELRVSLSNVSLSDEG   75 (95)
T ss_pred             cCceEEcCCCcEEEEEEEccCCccE-------EEEEecCCcEEE-ecCccccCCcCEEEEeCCCCEEEEEECcCCcccCE
Confidence            3578999999999999999876555       899985543333 33334446778877654445666777766666666


Q ss_pred             EEEEEccCCCc
Q psy5838         104 WYMCQVNTNPR  114 (215)
Q Consensus       104 ~Y~C~~~~~~~  114 (215)
                      .|+|++...|.
T Consensus        76 ~Y~Cqv~t~p~   86 (95)
T cd05881          76 RYFCQLYTDPP   86 (95)
T ss_pred             EEEEEEEcccC
Confidence            66666655443


No 20 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=99.36  E-value=7.7e-12  Score=80.93  Aligned_cols=38  Identities=24%  Similarity=0.427  Sum_probs=32.1

Q ss_pred             CCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          17 MPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        17 ~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +|++.. +.+..+.+|++++|.|.+.+.|.|.       +.|++..
T Consensus         2 ~p~i~~-~~~~~~~~G~~v~l~C~~~G~P~p~-------i~W~k~~   39 (98)
T cd05870           2 QPHIIQ-LKNETTVENGAATLSCKAEGEPIPE-------ITWKRAS   39 (98)
T ss_pred             CCEEEe-eccEEEcCCCcEEEEEecccCCCCe-------EEEEECC
Confidence            466654 5689999999999999999998887       9999953


No 21 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=99.36  E-value=4.5e-12  Score=80.67  Aligned_cols=37  Identities=16%  Similarity=0.429  Sum_probs=30.0

Q ss_pred             CCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccE
Q psy5838          22 EPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        22 ~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      ..+..+.+.+|+++.|.|.+.|.|. .       +.|++.++..+
T Consensus         5 ~~~~~~~v~~G~~v~l~C~~~G~P~-~-------v~W~k~~g~~~   41 (92)
T cd05866           5 ISLSKVELSVGESKFFTCTAIGEPE-S-------IDWYNPQGEKI   41 (92)
T ss_pred             EEecceEEcCCCeEEEEEEEEEeCC-e-------EEEEeCCCeEe
Confidence            4467788999999999999999876 5       99998655543


No 22 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=99.33  E-value=1.2e-11  Score=78.97  Aligned_cols=37  Identities=14%  Similarity=0.312  Sum_probs=29.3

Q ss_pred             CCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccE
Q psy5838          22 EPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        22 ~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      ..|....+..|+++.|.|.+.+.| +.       +.|++.++..+
T Consensus         5 v~p~~~~v~~G~~~~l~C~~~G~p-~~-------i~W~~~~~~~~   41 (92)
T cd04977           5 IVPSQGEISVGESKFFLCQVIGEP-KD-------ISWFSPNGEKL   41 (92)
T ss_pred             EecCcEEECCCCeEEEEEEeEeeC-Ce-------EEEECCCCCEe
Confidence            346678899999999999999875 35       99998655543


No 23 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=99.31  E-value=2.1e-11  Score=76.78  Aligned_cols=31  Identities=23%  Similarity=0.354  Sum_probs=27.4

Q ss_pred             CceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          25 PNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      ..+.+..|+++.|.|.+.|.|.|.       +.|+|++
T Consensus         3 ~~~~v~~G~~v~l~c~~~G~P~P~-------v~W~k~~   33 (86)
T cd05894           3 NTIVVVAGNKLRLDVPISGEPAPT-------VTWSRGD   33 (86)
T ss_pred             CEEEEEcCCEEEEEeeEeecCCCe-------EEEEECC
Confidence            357889999999999999999998       9999943


No 24 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=99.30  E-value=2.4e-11  Score=77.63  Aligned_cols=33  Identities=27%  Similarity=0.357  Sum_probs=28.7

Q ss_pred             CCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          23 PIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      .|..+.+.+|+++.|.|.+.+.|.+.       +.|++++
T Consensus         7 ~p~~v~v~eG~~v~L~C~v~g~P~p~-------i~W~k~~   39 (92)
T cd05891           7 LPDVVTIMEGKTLNLTCTVFGNPDPE-------VIWFKND   39 (92)
T ss_pred             CCCcEEEcCCCEEEEEEEEEEeCCCe-------EEEEECC
Confidence            36688999999999999999888777       9999954


No 25 
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=99.28  E-value=1.7e-11  Score=75.01  Aligned_cols=62  Identities=29%  Similarity=0.487  Sum_probs=37.1

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEccC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      |.|.|.+.+.|.|.       +.|+|+ +..+.       ....|+.+..++....+|.|.+++.+|+|.|+|.|.|
T Consensus         1 v~l~C~v~G~P~P~-------i~W~k~-~~~i~-------~~~~r~~~~~~~~g~~~L~I~~~~~~D~G~Y~C~A~N   62 (75)
T cd05892           1 VKLECQISAIPPPK-------IFWKRN-NEMVQ-------YNTDRISLYQDNSGRVTLLIKNVNKKDAGWYTVSAVN   62 (75)
T ss_pred             CEEEEEEEecCCCe-------EEEEEC-CEECc-------CCCCeEEEEEcCCCcEEEEECCCChhhCEEEEEEEEc
Confidence            57999999999998       999994 44331       1123555444332233555555555555555555444


No 26 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=99.27  E-value=3.4e-11  Score=75.75  Aligned_cols=36  Identities=11%  Similarity=0.290  Sum_probs=31.6

Q ss_pred             ccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          20 FAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        20 ~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |...|.+..+..|+++.|.|.+.+.|.+.       +.|+|++
T Consensus         2 ~~~~p~~~~~~~G~~~~l~C~~~g~p~p~-------v~W~k~g   37 (85)
T cd05728           2 WLKVISDTEADIGSSLRWECKASGNPRPA-------YRWLKNG   37 (85)
T ss_pred             ccccCCccEEcCCCcEEEEEEeeEeCCCE-------EEEEECC
Confidence            56677889999999999999999998887       9999943


No 27 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=99.27  E-value=5.2e-11  Score=76.86  Aligned_cols=38  Identities=11%  Similarity=0.181  Sum_probs=32.0

Q ss_pred             CCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          17 MPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        17 ~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      .|+|...+....+..|++++|.|.+.|.|.|.       +.|+++
T Consensus         2 ~p~i~~~~~~~~~~~g~~v~l~C~~~G~P~P~-------v~W~~~   39 (97)
T cd05869           2 KPKITYVENQTAMELEEQITLTCEASGDPIPS-------ITWRTS   39 (97)
T ss_pred             CceEEEccCceEEEcCCCEEEEEEeeEeCCCE-------EEEEEC
Confidence            57777777777777799999999999988887       999994


No 28 
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=99.27  E-value=7.3e-11  Score=75.89  Aligned_cols=34  Identities=32%  Similarity=0.488  Sum_probs=26.8

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      ++.+.+.+|++++|.|.+.+.+.+.       +.|++..+.
T Consensus         4 ~~~~~v~~G~~v~L~C~~~~~~~~~-------v~W~~p~~~   37 (95)
T cd05717           4 TQDVTVVEGGTATLKCRVKNNDNSS-------LQWSNPNQQ   37 (95)
T ss_pred             CCcEEEcCCCCEEEEEEECCCCCce-------EEEeCCCCc
Confidence            3578899999999999998766555       999875443


No 29 
>PHA03376 BARF1; Provisional
Probab=99.26  E-value=2e-10  Score=80.16  Aligned_cols=142  Identities=20%  Similarity=0.410  Sum_probs=77.4

Q ss_pred             CceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC---CccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecC
Q psy5838          25 PNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD---TQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESD  101 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d  101 (215)
                      ..+.+..|+++.|.|.........+++    |.|+|..   .+.+++....     +..-...+. + +...+    .+|
T Consensus        19 ~pVta~VGEda~LsC~lnp~ssa~~Mr----IrWqKs~p~~~~VvL~~~gg-----dVv~~QmEy-R-GrtD~----~~~   83 (221)
T PHA03376         19 QAVTAFLGERVTLTSYWRRVSLGPEIE----VSWFKLGPGEEQVLIGRMHH-----DVIFIEWPF-R-GFFDI----HRS   83 (221)
T ss_pred             cchhheeCCcEEEEecccCccCCCceE----EEEEecCCCCCCEEEEEcCC-----eeeeeeecc-c-cEEEE----Eec
Confidence            468889999999999998554445565    9999942   2223322110     000000000 0 01111    011


Q ss_pred             CEEEEEEccCCCceEEEEccCCeEEEEEcccCCCCCeEEEEEeecCCCcceee-EEEEEcCCeEEecCCCcceeeecCCc
Q psy5838         102 RGWYMCQVNTNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTDPMRSRQG-YLQVVVPPSIIDKDTSTDLVVREQAN  180 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~~~-~l~v~~~p~~~~~~~~~~~~~~~g~~  180 (215)
                      +                    .+.+|.|.+++.+|.|.|+|.++.......+. .+.+..|....+.....+  ......
T Consensus        84 ~--------------------gnvsLvI~~l~lSDdGtY~C~fQkge~~~~k~ehLt~V~~~~Lsv~a~~~d--Fp~~~~  141 (221)
T PHA03376         84 A--------------------NTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQ--FPDFSV  141 (221)
T ss_pred             C--------------------CeEEEEEEeeeecCCceEEEEEEcCCCceeeeeeeeeeecceEEEEecccc--CCCCCe
Confidence            1                    23457788888888888888885433222221 233322222222211111  112567


Q ss_pred             EEEEEEecccCCCeEEEEeCCCc
Q psy5838         181 VTLNCKAQGYPEPYVMWRREDGA  203 (215)
Q Consensus       181 ~~l~C~~~~~p~~~i~W~~~~~~  203 (215)
                      ..+.|.+.|+|.|.+.|.-+.|.
T Consensus       142 ~~i~C~sggfP~P~~~Wle~~~~  164 (221)
T PHA03376        142 LTVTCTVNAFPHPHVQWLMPEGV  164 (221)
T ss_pred             eEEEEecCCcCCchheeccccCC
Confidence            78899988899999999986554


No 30 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.26  E-value=1.8e-11  Score=74.57  Aligned_cols=60  Identities=27%  Similarity=0.465  Sum_probs=37.1

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEccC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      |+++.|.|.+.+.|.+.       +.|+|+ +..+.        .+.|+.+..+    ++|.|.+++.+|+|.|+|.|.|
T Consensus         1 G~~~~l~C~~~g~P~p~-------v~W~k~-~~~l~--------~~~r~~~~~~----g~L~I~~v~~~D~G~Y~C~A~N   60 (73)
T cd05852           1 GGRVIIECKPKAAPKPK-------FSWSKG-TELLV--------NNSRISIWDD----GSLEILNITKLDEGSYTCFAEN   60 (73)
T ss_pred             CCeEEEEEecceeCCCE-------EEEEeC-CEecc--------cCCCEEEcCC----CEEEECcCChhHCEEEEEEEEC
Confidence            78999999999998887       999994 44331        2334443222    2555555555555555554443


No 31 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=99.26  E-value=1.7e-10  Score=74.80  Aligned_cols=35  Identities=20%  Similarity=0.353  Sum_probs=29.7

Q ss_pred             CCceEEEeCCcEEEEEEeec-cCCccceeeeEEEEEEecCCccE
Q psy5838          24 IPNVTVTVGRDALLACVVDN-LKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~-~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      ...+.+.+|+++.|.|.+.+ +|.|.       +.|+| ++.++
T Consensus        10 ~~~~~v~~G~~v~L~c~v~g~~P~p~-------v~W~K-dg~~i   45 (101)
T cd04975          10 NTTIFVNLGENLNLVVEVEAYPPPPH-------INWTY-DNRTL   45 (101)
T ss_pred             CceEEEECCCCEEEEEEEEecCCCCc-------cEEEe-CCeeC
Confidence            35788999999999999999 88887       99999 55544


No 32 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=99.25  E-value=7.5e-11  Score=75.04  Aligned_cols=35  Identities=20%  Similarity=0.301  Sum_probs=30.0

Q ss_pred             cCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          21 AEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        21 ~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      ..++....+.+|+++.|.|.+.|.|.|.       +.|++++
T Consensus         4 v~~p~~~~v~~G~~v~l~C~~~G~P~p~-------v~W~~~g   38 (90)
T cd04972           4 VDGPNATVVYEGGTATIRCTAEGSPLPK-------VEWIIAG   38 (90)
T ss_pred             ccCCcCEEEcCCCcEEEEEEEEEcCCCe-------EEEEECC
Confidence            4456677799999999999999999888       9999954


No 33 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=99.25  E-value=1.6e-10  Score=73.16  Aligned_cols=85  Identities=20%  Similarity=0.282  Sum_probs=55.2

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEccC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      |+.+.|.|.+.+.+.+.       +.|++++ ..+.       ....|+.+.......  +                   
T Consensus         1 g~~~~l~C~~~g~p~~~-------i~W~k~~-~~i~-------~~~~r~~~~~~~~~~--~-------------------   44 (88)
T cd05735           1 GQKKEMSCTAHGEKPII-------VRWEKED-RIIN-------PEMSRYLVSTKEVGD--E-------------------   44 (88)
T ss_pred             CCeEEEEEEEECCCCCE-------EEEeeCC-EECC-------CCCCcEEEEEecCCC--c-------------------
Confidence            78999999999988777       9999943 3221       111233322110000  0                   


Q ss_pred             CCceEEEEccCCeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcCCe
Q psy5838         112 NPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVPPS  163 (215)
Q Consensus       112 ~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p~  163 (215)
                                 ....|.|.++..+|+|.|+|.|.+ .+.....+.|.|..+|.
T Consensus        45 -----------~~s~L~I~~~~~~D~G~YtC~A~N~~G~~~~~~~L~V~~~P~   86 (88)
T cd05735          45 -----------VISTLQILPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPPD   86 (88)
T ss_pred             -----------EEEEEEECCCCcccCEEEEEEEEcCCCcceEEEEEEEeCCCC
Confidence                       112477888889999999999966 46666777788876653


No 34 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=99.24  E-value=8.1e-11  Score=75.80  Aligned_cols=38  Identities=18%  Similarity=0.284  Sum_probs=31.4

Q ss_pred             CCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          17 MPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        17 ~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      .|+|. .+.+..+.+|+++.|.|.+.+.|.+.       +.|++++
T Consensus         2 ~P~i~-~~~~~~~~~g~~v~l~C~~~g~p~p~-------v~W~~~~   39 (96)
T cd05732           2 QPKIT-YLENQTAVELEQITLTCEAEGDPIPE-------ITWRRAT   39 (96)
T ss_pred             Cccce-ecCceeEecCCcEEEEEEEeEcCCCc-------EEEEECC
Confidence            46665 34578889999999999999988887       9999954


No 35 
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=99.23  E-value=6.2e-11  Score=73.09  Aligned_cols=66  Identities=20%  Similarity=0.252  Sum_probs=45.7

Q ss_pred             CcccCCCCceEEEeCCcEEEEEEeeccCC-ccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEcc
Q psy5838          18 PHFAEPIPNVTVTVGRDALLACVVDNLKG-FKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKN   96 (215)
Q Consensus        18 p~~~~~~~~~~~~~G~~v~L~C~~~~~~~-~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~   96 (215)
                      |.+...|+...+.+|++|+|.|.+.+.+. ..       +.|+|+ +..+.        .           ....|.|.+
T Consensus         1 ~vv~~~P~~~~v~~G~~V~L~C~~~~~p~~~~-------~~W~kn-g~~l~--------~-----------~~~~l~i~~   53 (78)
T cd05752           1 AVVSLDPPWTTIFQGEKVTLTCNGFNSPEQNS-------TQWYHN-GKLLE--------T-----------TTNSYRIRA   53 (78)
T ss_pred             CeEEeCCCCeEeeCCCCEEEEEeCCCCCCCcc-------EEEEEC-CEEee--------c-----------cCCeEEEee
Confidence            45666788899999999999999988654 34       899994 44321        0           122566666


Q ss_pred             ceecCCEEEEEEccC
Q psy5838          97 VQESDRGWYMCQVNT  111 (215)
Q Consensus        97 ~~~~d~G~Y~C~~~~  111 (215)
                      + .+|+|.|+|.|.+
T Consensus        54 ~-~~dsG~Y~C~a~~   67 (78)
T cd05752          54 A-NNDSGEYRCQTQG   67 (78)
T ss_pred             c-ccCCEEeEEECCC
Confidence            6 6676777776654


No 36 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.22  E-value=1.1e-10  Score=73.86  Aligned_cols=39  Identities=15%  Similarity=0.210  Sum_probs=32.3

Q ss_pred             CcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          18 PHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        18 p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      |.+...+....+.+|+++.|.|.+.+.|.+.       +.|++++.
T Consensus         2 ~~~~~~p~~~~~~~g~~v~l~C~~~g~P~p~-------v~W~k~~~   40 (88)
T cd04968           2 SIIVVFPKDTYALKGQNVTLECFALGNPVPQ-------IKWRKVDG   40 (88)
T ss_pred             CcEEECCCceEEeCCCcEEEEEEeeEeCCCE-------EEEEECCC
Confidence            3445557788899999999999999988887       99999544


No 37 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.22  E-value=3e-11  Score=73.96  Aligned_cols=25  Identities=16%  Similarity=0.351  Sum_probs=22.3

Q ss_pred             eCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          31 VGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +|+++.|.|.+.+.|.|.       +.|+|++
T Consensus         1 eG~~v~l~C~~~g~P~p~-------i~W~k~g   25 (74)
T cd05745           1 EGQTVDFLCEAQGYPQPV-------IAWTKGG   25 (74)
T ss_pred             CCCeEEEEeECCEecCCE-------EEEEECC
Confidence            589999999999999988       9999943


No 38 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=99.21  E-value=5.6e-11  Score=72.79  Aligned_cols=62  Identities=19%  Similarity=0.457  Sum_probs=35.0

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEccC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      |.|.|.+.|.|.|.       +.|+|++ ..+.       ....|+.+...+.....|.|.++..+|+|.|+|.|.|
T Consensus         1 v~l~C~v~G~P~P~-------v~W~k~~-~~l~-------~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~A~N   62 (75)
T cd05893           1 VRLECRVSGVPHPQ-------IFWKKEN-ESLT-------HNTDRVSMHQDNCGYICLLIQGATKEDAGWYTVSAKN   62 (75)
T ss_pred             CEEEEEEeEecCCE-------EEEEECC-EECC-------CCCCeEEEEEcCCCEEEEEECCCCHHHCEEEEEEEEc
Confidence            57999999999998       9999954 3321       1123444433321222455555555555555544443


No 39 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=99.21  E-value=9.7e-11  Score=72.60  Aligned_cols=66  Identities=21%  Similarity=0.353  Sum_probs=40.9

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCE
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRG  103 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G  103 (215)
                      |....+.+|+.+.|.|.+.+. .+.       +.|+| ++..+.        .+.++.+..     ..|.|.+++.+|+|
T Consensus         1 ~~~~~~~~G~~v~l~C~~~~~-~~~-------v~W~k-~g~~l~--------~~~~~~~~~-----~~L~I~~~~~~DsG   58 (79)
T cd04973           1 VESYSAHPGDLLQLRCRLRDD-VQS-------INWTK-DGVQLG--------ENNRTRITG-----EEVQIKDAVPRDSG   58 (79)
T ss_pred             CCcEEecCCCCEEEEEEecCC-Cce-------EEEee-CCcCCC--------CCceEEEeC-----CEEEECCCChhhCE
Confidence            356788899999999999986 344       99999 455441        222333321     14565555555555


Q ss_pred             EEEEEccC
Q psy5838         104 WYMCQVNT  111 (215)
Q Consensus       104 ~Y~C~~~~  111 (215)
                      .|+|.+.+
T Consensus        59 ~Y~C~a~n   66 (79)
T cd04973          59 LYACVTSS   66 (79)
T ss_pred             EEEEEEeC
Confidence            55555543


No 40 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=99.20  E-value=3.3e-10  Score=72.83  Aligned_cols=30  Identities=27%  Similarity=0.531  Sum_probs=26.3

Q ss_pred             CceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          25 PNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      ....+..|+++.|.|.+.+.|.+.       +.|+++
T Consensus        11 ~~~~~~~G~~v~L~C~~~g~P~p~-------v~W~k~   40 (95)
T cd05730          11 VNATANLGQSVTLACDADGFPEPT-------MTWTKD   40 (95)
T ss_pred             cceEEeCCCCEEEEEeccEeCCCE-------EEEEEC
Confidence            356788999999999999988887       999994


No 41 
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=99.19  E-value=4.4e-10  Score=72.73  Aligned_cols=41  Identities=22%  Similarity=0.413  Sum_probs=35.5

Q ss_pred             CCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          17 MPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        17 ~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      +|.|...+..+.+.+|+++.|.|.+.+.|.+.       +.|+|+ +..
T Consensus         1 ~P~i~~~p~~~~v~~G~~~~l~C~~~g~P~p~-------i~W~k~-g~~   41 (100)
T cd07693           1 PPRIVEHPSDLIVSKGDPATLNCKAEGRPTPT-------IQWLKN-GQP   41 (100)
T ss_pred             CCeEEecCceeEEcCCCeEEEEeeCCcCCCCE-------EEEEEC-CEE
Confidence            47888888999999999999999999988887       999994 443


No 42 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=99.19  E-value=1.2e-10  Score=74.18  Aligned_cols=31  Identities=16%  Similarity=0.286  Sum_probs=26.2

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +.+..+.+|++++|.|.+.+. .+.       +.|++++
T Consensus        10 ~~~~~v~~g~~v~l~C~a~g~-~p~-------i~W~kng   40 (91)
T cd05740          10 VGNQPPEDNQPVTLTCEAEGQ-ATY-------IWWVNNG   40 (91)
T ss_pred             cCccccccCCcEEEEEEeCCC-CCE-------EEEEECC
Confidence            346788999999999999988 776       9999943


No 43 
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=99.18  E-value=1.1e-10  Score=73.50  Aligned_cols=32  Identities=25%  Similarity=0.391  Sum_probs=26.9

Q ss_pred             CCCceEEEeCCcEEEEEEe-eccCCccceeeeEEEEEEec
Q psy5838          23 PIPNVTVTVGRDALLACVV-DNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~-~~~~~~~~~~~~~~v~W~~~   61 (215)
                      .|....+.+|+++.|.|.+ .+.+.+.       +.|+|+
T Consensus         2 ~p~~~~~~~G~~v~l~C~~~~g~p~p~-------i~W~k~   34 (86)
T cd05724           2 EPSDTQVAVGEMAVLECSPPRGHPEPT-------VSWRKD   34 (86)
T ss_pred             CCccEEEeCCCCEEEEEECCCCCCCCE-------EEEEEC
Confidence            3567888999999999998 6777777       999994


No 44 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=99.18  E-value=1.7e-10  Score=73.98  Aligned_cols=40  Identities=15%  Similarity=0.280  Sum_probs=32.3

Q ss_pred             CcccCCCCceEEE---eCCcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          18 PHFAEPIPNVTVT---VGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        18 p~~~~~~~~~~~~---~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      |.|+..|.++.+.   .|+++.|.|.+.+.|.+.       +.|+|+ +..
T Consensus         2 P~f~~~p~~~~~~~~~~g~~v~l~C~~~G~P~P~-------i~W~k~-g~~   44 (94)
T cd05848           2 PVFVQEPDDAIFPTDSDEKKVILNCEARGNPVPT-------YRWLRN-GTE   44 (94)
T ss_pred             CeeEECCCcEEccCCCCCCEEEEEEEeeecCCCE-------EEEEEC-CeE
Confidence            6777777777664   478999999999999888       999994 443


No 45 
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=99.18  E-value=1.6e-10  Score=73.70  Aligned_cols=29  Identities=24%  Similarity=0.432  Sum_probs=24.0

Q ss_pred             eEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          27 VTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        27 ~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +.+.+|++|+|+|.+.+.+.+.       +.|++.+
T Consensus         2 v~~~~G~~VtL~C~~s~~~~~~-------i~W~~~~   30 (94)
T cd07690           2 VLGKKGDTAELPCTASQKKSIQ-------FHWKNSN   30 (94)
T ss_pred             eEeeCCCCEEEEEEeCCCCCcE-------EEEEECC
Confidence            5678999999999998776665       9999743


No 46 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=99.17  E-value=1.5e-10  Score=71.62  Aligned_cols=63  Identities=25%  Similarity=0.446  Sum_probs=39.4

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEccC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      |+++.|.|.+.+.|.|.       +.|+++++. +        ....++.+.... ..+.|.|.+++.+|+|.|+|.|.+
T Consensus         1 G~~v~l~C~~~g~P~p~-------v~W~~~~~~-~--------~~~~~~~~~~~~-~~~~L~I~~v~~~D~G~Y~C~a~N   63 (78)
T cd05743           1 GETVEFTCVATGVPTPI-------INWRLNWGH-V--------PDSARVSITSEG-GYGTLTIRDVKESDQGAYTCEAIN   63 (78)
T ss_pred             CCEEEEEEEEEEecCCE-------EEEEECCeE-C--------CCCCCEEEEECC-CEEEEEECCCChHHCEEEEEEEEe
Confidence            78999999999988887       999995432 2        122344333222 334566666666666666665544


No 47 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.16  E-value=1.3e-10  Score=70.90  Aligned_cols=60  Identities=28%  Similarity=0.491  Sum_probs=36.7

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEccC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      |+++.|.|.+.+.|.+.       +.|+++ +..+        ....++.+...    +.|.|.+++.+|+|.|+|.+.+
T Consensus         1 G~~v~L~C~~~g~P~p~-------v~W~k~-~~~~--------~~~~~~~~~~~----~~L~i~~v~~~D~G~Y~C~a~N   60 (73)
T cd04969           1 GGDVIIECKPKAAPKPT-------ISWSKG-TELL--------TNSSRICIWPD----GSLEILNVTKSDEGKYTCFAEN   60 (73)
T ss_pred             CCeEEEEEeeeEcCCCE-------EEEEEC-CEEc--------ccCCCEEECCC----CeEEEccCChhHCEEEEEEEEC
Confidence            78999999999988887       999994 4433        12334433221    2455555555555555554443


No 48 
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=99.15  E-value=4.7e-10  Score=71.35  Aligned_cols=82  Identities=27%  Similarity=0.396  Sum_probs=49.4

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEccC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      |+++.|.|.+.+.|.+.       +.|+|++...++... .......|+.+..                           
T Consensus         1 G~~v~L~C~~~g~P~p~-------v~W~k~g~~~~~~~~-~~~~~~~r~~v~~---------------------------   45 (90)
T cd05726           1 GRTVTFQCEATGNPQPA-------IFWQKEGSQNLLFSY-QPPQSSSRFSVSQ---------------------------   45 (90)
T ss_pred             CCEEEEEEECCccCCCE-------EEEEeCCCcceeecc-cCCCCCCeEEECC---------------------------
Confidence            78999999999988887       999995443221110 0001112222211                           


Q ss_pred             CCceEEEEccCCeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEc
Q psy5838         112 NPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVV  160 (215)
Q Consensus       112 ~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~  160 (215)
                                  ...|.|.+++.+|+|.|+|.+.+ .+.....+.|.|..
T Consensus        46 ------------~~~L~I~~v~~~D~G~Y~C~a~N~~G~~~~~~~l~V~~   83 (90)
T cd05726          46 ------------TGDLTITNVQRSDVGYYICQTLNVAGSILTKAYLEVTD   83 (90)
T ss_pred             ------------CCeEEEeeCChhhCEEEEEEEEcCCCceEEEEEEEEee
Confidence                        11366777777888888888865 45555566666654


No 49 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=99.15  E-value=2.1e-10  Score=70.31  Aligned_cols=23  Identities=17%  Similarity=0.417  Sum_probs=19.3

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      |.|.|.+.+.|.|.       +.|+|+ +..
T Consensus         1 v~L~C~v~G~P~P~-------v~W~k~-~~~   23 (75)
T cd05744           1 VRLECRVSAIPPPQ-------IFWKKN-NEM   23 (75)
T ss_pred             CEEEEEEeecCCCe-------EEEEEC-CEE
Confidence            57999999999998       999994 443


No 50 
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.13  E-value=1.9e-10  Score=73.54  Aligned_cols=38  Identities=13%  Similarity=0.144  Sum_probs=30.5

Q ss_pred             CcccCCCCceEEEeCC---cEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          18 PHFAEPIPNVTVTVGR---DALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        18 p~~~~~~~~~~~~~G~---~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |.|...|..+.+.+|.   .+.|.|.+.|.|.+.       +.|+|++
T Consensus         2 P~f~~~P~~~~~~~~~~~~~v~l~C~a~G~P~P~-------i~W~k~~   42 (93)
T cd05849           2 PVFEEQPIDTIYPEESTEGKVSVNCRARANPFPI-------YKWRKNN   42 (93)
T ss_pred             CEEEECCCCEEecCCccCCeEEEeCcCccCCCCE-------EEEEECC
Confidence            6777777777665544   799999999999888       9999954


No 51 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=99.13  E-value=2.7e-10  Score=71.63  Aligned_cols=29  Identities=10%  Similarity=0.249  Sum_probs=24.8

Q ss_pred             eEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          27 VTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        27 ~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      ..+..|+++.|.|.+.+.|.+.       +.|+|++
T Consensus         4 ~~v~~G~~~~L~C~~~g~P~p~-------i~W~k~g   32 (85)
T cd05857           4 HAVPAANTVKFRCPAAGNPTPT-------MRWLKNG   32 (85)
T ss_pred             EEcCCCCEEEEEEEcCCCCCCE-------EEEEECC
Confidence            4577899999999999988877       9999943


No 52 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=99.12  E-value=1.9e-09  Score=71.01  Aligned_cols=100  Identities=20%  Similarity=0.256  Sum_probs=61.3

Q ss_pred             CCCcccCCCCceEE-E---eCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEE
Q psy5838          16 LMPHFAEPIPNVTV-T---VGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWF   91 (215)
Q Consensus        16 ~~p~~~~~~~~~~~-~---~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   91 (215)
                      ++|.|..++....+ .   .|.++.|.|.+.+.|.+.       +.|++ ++..+.       ..+.++........   
T Consensus         3 ~~P~~~~~~~~~~~~~~~~~g~~v~L~C~a~G~P~p~-------i~W~k-~g~~l~-------~~~~r~~~~~~~~~---   64 (109)
T cd05773           3 FAPDLQKGPQLRKVASRGDGSSDANLVCQAQGVPRVQ-------FRWAK-NGVPLD-------LGNPRYEETTEHTG---   64 (109)
T ss_pred             cccccccCCceEEEEEecCCCCEEEEEEECcccCCCE-------EEEEE-CCEECC-------CCCCeEEEEeeccC---
Confidence            46777777652222 2   467899999999988887       99999 444331       11223322211000   


Q ss_pred             EEEccceecCCEEEEEEccCCCceEEEEccCCeEEEEEcccC-CCCCeEEEEEeec-CCCcceeeEEEEEcCC
Q psy5838          92 LNIKNVQESDRGWYMCQVNTNPRISLTYNDHRSWFLNIKNVQ-ESDRGWYMCQVNT-DPMRSRQGYLQVVVPP  162 (215)
Q Consensus        92 l~i~~~~~~d~G~Y~C~~~~~~~~~~~~~~~~~~~l~i~~~~-~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p  162 (215)
                                                   ......|.|.++. .+|.|.|+|.|.+ .+.....+.|.+..+|
T Consensus        65 -----------------------------~~~~s~L~I~~v~~~~D~G~Y~C~A~N~~G~~~~~i~L~~~~~p  108 (109)
T cd05773          65 -----------------------------TVHTSILTIINVSAALDYALFTCTAHNSLGEDSLDIQLVSTSRP  108 (109)
T ss_pred             -----------------------------ccceeEEEECcCCccCCCEEEEEEEEeCCccCcEEEEEEecCCC
Confidence                                         0011347788876 5889999999866 4556667777776655


No 53 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=99.11  E-value=9.1e-10  Score=71.38  Aligned_cols=33  Identities=12%  Similarity=0.233  Sum_probs=28.6

Q ss_pred             ceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccE
Q psy5838          26 NVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        26 ~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      ...+..|+.+.|.|.+.+.|.|.       +.|+| ++.++
T Consensus        12 ~~~~~~~~~~~l~~~v~g~P~P~-------v~W~k-dg~~l   44 (101)
T cd05859          12 LEFANLHEVKEFVVEVEAYPPPQ-------IRWLK-DNRTL   44 (101)
T ss_pred             eEEEecCCcEEEEEEEEEeCCCc-------eEEEE-CCEEC
Confidence            67788899999999999999998       99999 55554


No 54 
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=99.11  E-value=1.1e-09  Score=72.28  Aligned_cols=34  Identities=18%  Similarity=0.342  Sum_probs=27.7

Q ss_pred             CCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          22 EPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        22 ~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      .++..+.+.+|++|+|.|.+.+.....       +.|++..
T Consensus         3 q~~~~v~~~~G~~v~L~C~~~~~~~~~-------v~W~k~~   36 (109)
T cd04983           3 QSPQSLSVQEGENVTLNCNYSTSTFYY-------LFWYRQY   36 (109)
T ss_pred             ecCCceEEcCCCCEEEEEEECCCCccE-------EEEEEEC
Confidence            456789999999999999998764444       9999853


No 55 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=99.10  E-value=4.5e-10  Score=68.07  Aligned_cols=22  Identities=27%  Similarity=0.557  Sum_probs=19.3

Q ss_pred             cEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          34 DALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        34 ~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +|.|.|.+.|.|.|.       +.|+|++
T Consensus         1 ~v~l~C~~~G~P~p~-------v~W~k~g   22 (71)
T cd05723           1 DVIFECEVTGKPTPT-------VKWVKNG   22 (71)
T ss_pred             CEEEEEEEEEeCCCE-------EEEEECC
Confidence            589999999999888       9999954


No 56 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.10  E-value=2.3e-09  Score=67.35  Aligned_cols=37  Identities=38%  Similarity=0.372  Sum_probs=27.1

Q ss_pred             EEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcCC
Q psy5838         126 FLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVPP  162 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p  162 (215)
                      .|.|.+++..|+|.|+|.|.+ .+...+.+.|.|..+|
T Consensus        48 ~L~I~~v~~~D~G~YtC~A~n~~g~~~~~~~L~V~~~P   85 (85)
T cd05854          48 DLVIVNAQLSHAGTYTCTAQTVVDSASASATLVVRGPP   85 (85)
T ss_pred             EEEEccCChhhCeEEEEEEecCCCCEEEEEEEEEECCC
Confidence            366778888888888888865 4556667778777665


No 57 
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=99.09  E-value=1.2e-09  Score=72.20  Aligned_cols=33  Identities=18%  Similarity=0.290  Sum_probs=26.9

Q ss_pred             CCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          22 EPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        22 ~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      ..|..+.+.+|++|+|.|.+.+ ..+.       +.|||..
T Consensus         3 Q~p~~~~v~~G~~v~l~C~~~~-~~~~-------v~Wykq~   35 (110)
T cd05899           3 QSPRYLIKGRGQSVTLRCSQTS-GHDN-------MYWYRQD   35 (110)
T ss_pred             ECCCceEEcCCCcEEEEEEECC-CCCE-------EEEEEEC
Confidence            4567889999999999999987 4444       9999974


No 58 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=99.09  E-value=7.9e-10  Score=67.58  Aligned_cols=22  Identities=14%  Similarity=0.215  Sum_probs=19.1

Q ss_pred             cEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          34 DALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        34 ~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      ++.|.|.+.|.|.|.       +.|+|++
T Consensus         1 ~~~l~c~~~G~P~p~-------v~W~k~g   22 (74)
T cd05748           1 SVRLEVPISGRPTPT-------VTWSKDG   22 (74)
T ss_pred             CEEEEeeEeeeCCCe-------EEEEECC
Confidence            478999999999998       9999943


No 59 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=99.09  E-value=8.6e-10  Score=67.77  Aligned_cols=26  Identities=23%  Similarity=0.526  Sum_probs=22.3

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      |+++.|.|.+.+.|.|.       +.|++ ++..
T Consensus         1 G~~v~l~C~~~G~P~p~-------i~W~k-~g~~   26 (76)
T cd05867           1 GETARLDCQVEGIPTPN-------ITWSI-NGAP   26 (76)
T ss_pred             CCeEEEEEEeeEeCCCe-------EEEEE-CCEE
Confidence            78999999999998887       99999 4443


No 60 
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.09  E-value=6e-10  Score=71.39  Aligned_cols=40  Identities=18%  Similarity=0.272  Sum_probs=32.1

Q ss_pred             CcccCCCCceEEEeC---CcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          18 PHFAEPIPNVTVTVG---RDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        18 p~~~~~~~~~~~~~G---~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      |.|...|..+.+.+|   ++++|.|.+.+.|.+.       +.|+++ +..
T Consensus         2 P~f~~~P~~~~~~~~~~g~~v~l~C~a~g~P~p~-------i~W~~~-g~~   44 (94)
T cd05850           2 PVFEEQPSSLLFPEGSPEEKVTLGCRARASPPAT-------YRWKMN-GTE   44 (94)
T ss_pred             CeeEECCCCEEecCCCCCCeEEEEeEceeCCCCE-------EEEEEC-CEE
Confidence            667777888877666   5799999999988887       999994 443


No 61 
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=99.07  E-value=5.3e-10  Score=71.04  Aligned_cols=76  Identities=28%  Similarity=0.480  Sum_probs=50.6

Q ss_pred             CCcccCC-CCceEEEeCCcEEEEEE-eeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEE
Q psy5838          17 MPHFAEP-IPNVTVTVGRDALLACV-VDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNI   94 (215)
Q Consensus        17 ~p~~~~~-~~~~~~~~G~~v~L~C~-~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i   94 (215)
                      .|.|... ...+.+.+|+.+.|.|. ..+.|.+.       +.|+++....+        ..+.|+....    +|+|.|
T Consensus         2 ~~~~~~~~~~~v~V~eG~~~~L~C~pP~g~P~P~-------i~W~~~~~~~i--------~~~~Ri~~~~----~GnL~f   62 (95)
T cd05845           2 TPKWPKEKIRPVEVEEGDSVVLPCNPPKSAVPLR-------IYWMNSDLLHI--------TQDERVSMGQ----NGNLYF   62 (95)
T ss_pred             CCcCCccccceeEEecCCCEEEEecCCCCCCCCE-------EEEECCCCccc--------cccccEEECC----CceEEE
Confidence            3556555 46889999999999997 57788887       99998433222        2345554433    247777


Q ss_pred             ccceecCCE-EEEEEccC
Q psy5838          95 KNVQESDRG-WYMCQVNT  111 (215)
Q Consensus        95 ~~~~~~d~G-~Y~C~~~~  111 (215)
                      .+++.+|+| .|.|.|.+
T Consensus        63 s~v~~~D~g~~Y~C~a~~   80 (95)
T cd05845          63 ANVEEQDSHPDYICHAHF   80 (95)
T ss_pred             EEEehhhCCCCeEEEEEc
Confidence            777776666 56666554


No 62 
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=99.07  E-value=8e-10  Score=69.28  Aligned_cols=69  Identities=25%  Similarity=0.321  Sum_probs=45.4

Q ss_pred             CCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCC
Q psy5838          23 PIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDR  102 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~  102 (215)
                      .|....+..|+++.|.|...+ +.+.       +.|++ ++..+..       ...++.+.     .+.|.|.+++.+|+
T Consensus         2 ~P~~~~v~~G~~v~L~C~~~~-~~~~-------i~W~~-ng~~i~~-------~~~r~~~~-----~~~L~I~nv~~~Ds   60 (87)
T cd05873           2 DPRQRTFKLGNNAELKCSPKS-NLAR-------VVWKF-DGKVLTP-------ESAKYLLY-----RDGLLIFNASEADA   60 (87)
T ss_pred             CcceEEEECCCCEEEEEECCC-CCCe-------EEEEE-CCEECCC-------CCceEEEE-----CCcEEEeCCCHHHC
Confidence            456788999999999999764 3445       99999 4554321       11233321     12577777777777


Q ss_pred             EEEEEEccCC
Q psy5838         103 GWYMCQVNTN  112 (215)
Q Consensus       103 G~Y~C~~~~~  112 (215)
                      |.|+|.+.+.
T Consensus        61 G~Y~C~a~e~   70 (87)
T cd05873          61 GRYQCLSVEK   70 (87)
T ss_pred             EEEEEEEEec
Confidence            7777766654


No 63 
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=99.06  E-value=8.2e-10  Score=70.94  Aligned_cols=39  Identities=18%  Similarity=0.405  Sum_probs=32.1

Q ss_pred             ccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccE
Q psy5838          20 FAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        20 ~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      |...|....+.+|+++.|.|.+.+.|.+.       +.|+| ++..+
T Consensus         2 f~~~P~~~~~~~g~~v~l~C~v~g~P~p~-------i~W~k-~g~~l   40 (95)
T cd05722           2 FLSEPSDIVAVRGGPVVLNCSAEGEPPPK-------IEWKK-DGVLL   40 (95)
T ss_pred             cEECCCCeEEcCCCCEEEeeecccCCCCE-------EEEEE-CCeEC
Confidence            45567788889999999999999988887       99999 55443


No 64 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=99.06  E-value=4.3e-10  Score=71.49  Aligned_cols=23  Identities=22%  Similarity=0.463  Sum_probs=21.1

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      |++++|.|.+.+.|.|.       +.|+|.
T Consensus         1 G~~v~l~C~v~g~P~P~-------i~W~k~   23 (90)
T cd04974           1 GSDVEFHCKVYSDAQPH-------IQWLKH   23 (90)
T ss_pred             CCcEEEEEEEeCCCCCe-------EEEEEe
Confidence            78999999999999988       999995


No 65 
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=99.06  E-value=1.6e-09  Score=70.02  Aligned_cols=37  Identities=11%  Similarity=0.298  Sum_probs=29.1

Q ss_pred             CcccCCCCceEEEeCCcEEEEEEeeccCCc-cceeeeEEEEEEecC
Q psy5838          18 PHFAEPIPNVTVTVGRDALLACVVDNLKGF-KGLRIGWQVAWVRVD   62 (215)
Q Consensus        18 p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~-~~~~~~~~v~W~~~~   62 (215)
                      |.+ ..+....+.+|+++.|.|.+.+.|.| .       +.|++++
T Consensus         3 p~i-~~~~~~~~~~G~~v~L~C~~~g~P~P~~-------v~W~~~~   40 (98)
T cd05758           3 PII-TSEATQYAILGDKGRVECFIFSTPPPDR-------IVWTWKE   40 (98)
T ss_pred             CeE-cCCCcEEEeCCCcEEEEEEEcccCCCCE-------eEEEECC
Confidence            344 34567788999999999999998777 5       8999943


No 66 
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=99.05  E-value=1.9e-09  Score=67.28  Aligned_cols=36  Identities=36%  Similarity=0.457  Sum_probs=26.5

Q ss_pred             EEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcCC
Q psy5838         127 LNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVPP  162 (215)
Q Consensus       127 l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p  162 (215)
                      |.|.+++.+|+|.|+|.|.+ .......+.|.|..||
T Consensus        49 L~I~nv~~~dsG~YtC~a~n~~~~~~a~a~L~V~~pP   85 (85)
T cd05853          49 LMIRSIQLKHAGKYVCMVQTSVDKLSAAADLIVRGPP   85 (85)
T ss_pred             EEEecCCHHHCEEEEEEEEcccCceEEEEEEEEecCC
Confidence            66777777888888888865 3455666778887776


No 67 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=99.05  E-value=8.7e-10  Score=67.38  Aligned_cols=27  Identities=22%  Similarity=0.422  Sum_probs=22.7

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      |+++.|.|.+.+.|.+.       +.|++.++..
T Consensus         1 G~~~~l~C~~~g~P~p~-------v~W~~~~~~~   27 (74)
T cd05764           1 GQRATLRCKARGDPEPA-------IHWISPDGKL   27 (74)
T ss_pred             CCeEEEEEEccCcCCCE-------EEEEeCCCEE
Confidence            78999999999988887       9999855543


No 68 
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=99.05  E-value=2.3e-09  Score=73.85  Aligned_cols=75  Identities=29%  Similarity=0.434  Sum_probs=56.8

Q ss_pred             EEEEcccCCCCCeEEEEEeecC-CCcceeeEEEEEcCCeEEecCCCcceeeecCCcEEEEEEeccc-CC-CeEEEEeCCC
Q psy5838         126 FLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQGY-PE-PYVMWRREDG  202 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~~-p~-~~i~W~~~~~  202 (215)
                      +|.|.+++..|+|.|.|.+.+. +.....+.|.|..+|.+....  .......|+.+.|.|.+.|+ |+ +.+.|++ +|
T Consensus         2 sL~i~~v~~~D~G~Y~C~~~~~~~~~~~~~~l~v~~~P~v~~~~--~~~~~~~~~~~~L~C~a~g~~P~~~~i~W~~-~g   78 (139)
T cd05771           2 SLTLPGLTVHDEGTYICSVSTPPHQAQQIIQLSVSEPPRVRLSL--EKLVSMIEEPQTLICHIAGYYPLDVQVEWTR-EP   78 (139)
T ss_pred             eEEECCCCHHHCEEEEEEEEccCcceeeEEEEEEecCCceEEeC--CCceeecCCcEEEEEEECCCCCCCeEEEEEE-CC
Confidence            4788999999999999998653 455666788898899876542  22334478999999999985 65 3899999 55


Q ss_pred             c
Q psy5838         203 A  203 (215)
Q Consensus       203 ~  203 (215)
                      .
T Consensus        79 ~   79 (139)
T cd05771          79 P   79 (139)
T ss_pred             C
Confidence            3


No 69 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.04  E-value=3.7e-09  Score=66.40  Aligned_cols=37  Identities=35%  Similarity=0.366  Sum_probs=25.4

Q ss_pred             EEEEcccCCCCCeEEEEEeec-CCCcceeeEEEEEcCC
Q psy5838         126 FLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQVVVPP  162 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v~~~p  162 (215)
                      .|.|.+++..|+|.|+|.+.+ .+.....+.|.|..||
T Consensus        48 ~L~I~~v~~~D~G~Y~C~a~n~~g~~~~~~~l~V~~pP   85 (85)
T cd04970          48 DLMIRNAQLKHAGKYTCTAQTVVDSLSASADLIVRGPP   85 (85)
T ss_pred             eEEEccCCHHhCeeeEEEEecCCCcEEEEEEEEEECCC
Confidence            366777777788888888765 3445566677777665


No 70 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.04  E-value=4.4e-10  Score=67.73  Aligned_cols=57  Identities=18%  Similarity=0.444  Sum_probs=34.1

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEccC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      |.|.|.+.+.|.|.       +.|+| ++..+.        ...++.+..    .+.|.|.+++.+|+|.|+|.|.+
T Consensus         1 v~L~C~~~g~P~p~-------i~W~k-~g~~~~--------~~~~~~~~~----~~~L~I~~~~~~D~G~Y~C~a~N   57 (69)
T cd05746           1 VQIPCSAQGDPEPT-------ITWNK-DGVQVT--------ESGKFHISP----EGYLAIRDVGVADQGRYECVARN   57 (69)
T ss_pred             CEeEecceEeCCCE-------EEEEE-CCEECC--------CCCCEEECC----CCEEEECcCChhhCEEEEEEEEC
Confidence            57999999999887       99999 444331        122333221    22566655555555555555544


No 71 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=99.04  E-value=7.5e-10  Score=70.38  Aligned_cols=23  Identities=17%  Similarity=0.408  Sum_probs=20.8

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      |+++.|.|.+.+.|.|.       +.|+|.
T Consensus         1 G~~v~L~C~~~g~P~P~-------i~W~k~   23 (90)
T cd05858           1 GSTVEFVCKVYSDAQPH-------IQWLKH   23 (90)
T ss_pred             CCeEEEEEEEecCCCCE-------EEEEEe
Confidence            78999999999998887       999984


No 72 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=99.04  E-value=8.5e-10  Score=66.47  Aligned_cols=22  Identities=23%  Similarity=0.302  Sum_probs=18.5

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      ++|.|.+.+.|.+.       +.|+|+++
T Consensus         1 v~l~C~~~g~P~p~-------v~W~k~~~   22 (69)
T cd05725           1 VEFQCEVGGDPVPT-------VLWRKEDG   22 (69)
T ss_pred             CEEEEECccCCCCE-------EEEEECCc
Confidence            57999999988887       99999643


No 73 
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=99.04  E-value=1e-09  Score=68.12  Aligned_cols=37  Identities=16%  Similarity=0.223  Sum_probs=32.0

Q ss_pred             ccCCCCceEEEeCCcEEEEEEeeccCCc-cceeeeEEEEEEecCCc
Q psy5838          20 FAEPIPNVTVTVGRDALLACVVDNLKGF-KGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        20 ~~~~~~~~~~~~G~~v~L~C~~~~~~~~-~~~~~~~~v~W~~~~~~   64 (215)
                      |...|.++.+..|+++.|.|.+.|.|.| .       +.|+|+ +.
T Consensus         1 f~~~P~~~~v~~G~~v~l~C~a~G~P~P~~-------I~W~k~-g~   38 (81)
T cd05749           1 FTVEPEDLSVTANTPFNLTCQAVGPPEPVE-------ILWWQG-GS   38 (81)
T ss_pred             CcCCCCceEEcCCCCEEEEEEeeeecCCeE-------EEEEEC-CE
Confidence            4566788999999999999999999988 7       999994 44


No 74 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=99.00  E-value=2.2e-09  Score=64.02  Aligned_cols=24  Identities=21%  Similarity=0.308  Sum_probs=19.7

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCCccE
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      +.|.|.+.+.|.|.       +.|+| ++..+
T Consensus         1 ~~l~c~v~g~P~P~-------v~W~k-dg~~l   24 (67)
T cd05863           1 VKLPVKVAAYPPPE-------FQWYK-DGKLI   24 (67)
T ss_pred             CEEEEEEEEeCCCE-------EEEEE-CCEEC
Confidence            47999999999998       99999 55543


No 75 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=99.00  E-value=1.9e-09  Score=68.96  Aligned_cols=32  Identities=19%  Similarity=0.430  Sum_probs=25.9

Q ss_pred             CceEEEeCCcEEEEEEeec-----cCCccceeeeEEEEEEecCC
Q psy5838          25 PNVTVTVGRDALLACVVDN-----LKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~~-----~~~~~~~~~~~~v~W~~~~~   63 (215)
                      ....+.+|+++.|.|.+.+     .+.+.       +.|+|++.
T Consensus         7 ~~~~v~~G~~~~L~C~~~g~~~~~~p~~~-------v~Wyk~~~   43 (94)
T cd05756           7 KKSYVLEGEPVVIKCPLFYSYIAQSPGLN-------LTWYKSDG   43 (94)
T ss_pred             eEEEEecCCCeEEECCCCCcccccCCCce-------EEEEEcCC
Confidence            4567789999999999998     46666       99999653


No 76 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=99.00  E-value=2.1e-09  Score=66.02  Aligned_cols=27  Identities=22%  Similarity=0.514  Sum_probs=23.0

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCccE
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      |+++.|.|.+.+.|.|.       +.|+| ++..+
T Consensus         1 g~~~~l~C~a~G~P~P~-------i~W~k-~g~~i   27 (76)
T cd05868           1 GEDGTLICRANGNPKPS-------ISWLT-NGVPI   27 (76)
T ss_pred             CCCEEEEEEeeEeCCCe-------EEEEE-CCEEc
Confidence            78999999999999998       99999 55443


No 77 
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=98.99  E-value=5.4e-09  Score=68.55  Aligned_cols=82  Identities=18%  Similarity=0.295  Sum_probs=46.2

Q ss_pred             cCCCCceEEEeCCcEEEEEEeeccC-CccceeeeEEEEEEecCC--cc--EEEeeec-eeeeCCceEEEEcCCceEEEEE
Q psy5838          21 AEPIPNVTVTVGRDALLACVVDNLK-GFKGLRIGWQVAWVRVDT--QT--ILSIHHN-VITQNPRISLTYNDHRSWFLNI   94 (215)
Q Consensus        21 ~~~~~~~~~~~G~~v~L~C~~~~~~-~~~~~~~~~~v~W~~~~~--~~--~~~~~~~-~~~~~~~~~~~~~~~~~~~l~i   94 (215)
                      ...|..+.+.+|++|+|.|.+.+.. ...       +.|||...  .+  ++..... ......|+..... .....|.|
T Consensus         4 ~Q~p~~~~v~~G~~v~L~C~~~~~~~~~~-------~~Wyrq~~g~~~~~l~~~~~~~~~~~~~r~~~~~~-~~~~~L~I   75 (106)
T cd04980           4 TQSPATLSVSPGESATISCKASQSVSSNY-------LAWYQQKPGQAPKLLIYGASTLASGTPSRFSGSGS-GTDFTLTI   75 (106)
T ss_pred             EECCCcEEECCCCCEEEEEEECCCCCCCc-------EEEEEECCCCCcEEEEECccccCCCCCCCEEEecc-CCEEEEEE
Confidence            4456778999999999999987543 333       89998642  11  1111110 0011234443322 24455666


Q ss_pred             ccceecCCEEEEEEcc
Q psy5838          95 KNVQESDRGWYMCQVN  110 (215)
Q Consensus        95 ~~~~~~d~G~Y~C~~~  110 (215)
                      .+++.+|+|.|.|.+.
T Consensus        76 ~~~~~~Dsg~Y~Ca~~   91 (106)
T cd04980          76 SRVEPEDAAVYYCQQY   91 (106)
T ss_pred             CCCChHHCEEEEEEEe
Confidence            6666666666666554


No 78 
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=98.99  E-value=1.5e-08  Score=65.69  Aligned_cols=30  Identities=27%  Similarity=0.489  Sum_probs=20.2

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      |++|+|+|.+..........    +.|++.....
T Consensus         1 G~~v~L~C~~~~~~~~~~~~----v~W~k~~~~~   30 (100)
T cd05713           1 GEDAELPCHLSPKMSAEHME----VRWFRSQFSP   30 (100)
T ss_pred             CCcEEEEeEEcCCCCCCeeE----EEEEECCCce
Confidence            78999999997443333222    8899965443


No 79 
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=98.99  E-value=1.5e-09  Score=66.33  Aligned_cols=21  Identities=14%  Similarity=0.358  Sum_probs=18.1

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      ++|.|.+.|.|.|.       +.|+|++
T Consensus         1 a~l~C~~~G~P~p~-------v~W~k~~   21 (74)
T cd05738           1 ATMLCAASGNPDPE-------ITWFKDF   21 (74)
T ss_pred             CEEEEEEeEecCCE-------EEEEECC
Confidence            47999999999888       9999943


No 80 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=98.99  E-value=2.3e-09  Score=66.75  Aligned_cols=29  Identities=21%  Similarity=0.499  Sum_probs=24.6

Q ss_pred             eEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          27 VTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        27 ~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +.+..|+++.|.|.+.+.|.+.       +.|++++
T Consensus         4 ~~~~~G~~v~L~C~~~g~p~p~-------i~W~k~~   32 (82)
T cd05856           4 IARPVGSSVRLKCVASGNPRPD-------ITWLKDN   32 (82)
T ss_pred             eeccCCCeEEEEEEeeEeCCCc-------EEEEECC
Confidence            4567899999999999888887       9999954


No 81 
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.99  E-value=5.1e-09  Score=68.43  Aligned_cols=29  Identities=21%  Similarity=0.552  Sum_probs=22.7

Q ss_pred             eEEEeCCcEEEEEEeecc-CCccceeeeEEEEEEecC
Q psy5838          27 VTVTVGRDALLACVVDNL-KGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        27 ~~~~~G~~v~L~C~~~~~-~~~~~~~~~~~v~W~~~~   62 (215)
                      +.+.+|++|+|.|.+... ....       +.|++..
T Consensus         1 ~~v~~G~~v~L~C~~~~~~~~~~-------v~W~k~~   30 (105)
T cd00099           1 LSVSEGESVTLSCTYSGSFSSYY-------IFWYRQK   30 (105)
T ss_pred             CeecCCCCEEEEEEEeCCcCcce-------EEEEEEC
Confidence            357799999999999976 3333       8999964


No 82 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.98  E-value=2.1e-09  Score=66.82  Aligned_cols=23  Identities=22%  Similarity=0.452  Sum_probs=21.1

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      |+++.|.|.+.+.|.+.       +.|+|+
T Consensus         1 G~~v~l~C~~~g~P~p~-------v~W~k~   23 (81)
T cd05765           1 GETASFHCDVTGRPPPE-------ITWEKQ   23 (81)
T ss_pred             CCcEEEEeeccccCCCc-------EEEEec
Confidence            78999999999998887       999995


No 83 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.97  E-value=1.4e-09  Score=66.77  Aligned_cols=26  Identities=15%  Similarity=0.420  Sum_probs=22.1

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      |+++.|.|.+.+.|.|.       +.|++ ++..
T Consensus         1 G~~~~l~C~~~g~P~p~-------i~W~~-~g~~   26 (76)
T cd04978           1 GETGRLDCEAEGIPQPT-------ITWRL-NGVP   26 (76)
T ss_pred             CCeEEEEEEceeeCCCE-------EEEEE-CCEE
Confidence            78999999999998887       99999 4443


No 84 
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=98.97  E-value=7.3e-09  Score=61.29  Aligned_cols=62  Identities=27%  Similarity=0.363  Sum_probs=39.3

Q ss_pred             CCcEEEEEEe-eccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceE-EEEEccceecCCEEEEEEc
Q psy5838          32 GRDALLACVV-DNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSW-FLNIKNVQESDRGWYMCQV  109 (215)
Q Consensus        32 G~~v~L~C~~-~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~l~i~~~~~~d~G~Y~C~~  109 (215)
                      |++++|.|.+ .+.+...       +.|++++.......         ............ .|.|.+++.+|+|.|+|.|
T Consensus         1 G~~v~L~C~~~~~~~~~~-------~~W~~~~~~~~~~~---------~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~v   64 (64)
T PF00047_consen    1 GSSVTLTCSVSSGPPPTT-------VTWSKNGQSLPEGS---------TTNRSTNSVSSTSRLTISNVTPEDSGTYTCVV   64 (64)
T ss_dssp             TSEEEEEEEEEESSSTSE-------EEEEETTTTTSEEE---------EEEEEETTTEEEEEEEESSCTGGGTEEEEEEE
T ss_pred             CCeEEEEeecCCCCCCcE-------EEEEECCccccCcc---------eeEeecccceeeeEEEEccCCHHHCEEEEEEC
Confidence            7899999999 5555555       99999655432211         111111111111 3899999999999999975


No 85 
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=98.97  E-value=8.9e-09  Score=68.66  Aligned_cols=33  Identities=18%  Similarity=0.438  Sum_probs=26.2

Q ss_pred             CCCCceEEEeCCcEEEEEEeec--cCCccceeeeEEEEEEec
Q psy5838          22 EPIPNVTVTVGRDALLACVVDN--LKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        22 ~~~~~~~~~~G~~v~L~C~~~~--~~~~~~~~~~~~v~W~~~   61 (215)
                      ..|..+.+.+|++|+|.|.+.+  .+.+.       +.|+|.
T Consensus         3 Q~p~~~~~~~G~~v~l~C~~~~~~~~~~~-------v~Wyrq   37 (116)
T cd04982           3 QPQLSITREESKSVTISCKVSGIDFSTTY-------IHWYRQ   37 (116)
T ss_pred             CcCCeEEeCCCCCEEEEEEEeCCCccccE-------EEEEEE
Confidence            4567888999999999999976  33343       999996


No 86 
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=98.96  E-value=2.7e-09  Score=68.74  Aligned_cols=26  Identities=12%  Similarity=0.187  Sum_probs=18.8

Q ss_pred             EeCCcEEEEEEeec-cCCccceeeeEEEEEEecC
Q psy5838          30 TVGRDALLACVVDN-LKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        30 ~~G~~v~L~C~~~~-~~~~~~~~~~~~v~W~~~~   62 (215)
                      ..|++|+|+|.+.. .....       +.|+++.
T Consensus         2 ~~G~sVtL~c~~~~~~~~~~-------v~W~~~~   28 (97)
T cd05775           2 ILGGSVTLPLNIPDGTEIES-------ITWSFNT   28 (97)
T ss_pred             ccCCeEEEeCCCCCCcEEEE-------EEEecCC
Confidence            36999999999864 22222       9999963


No 87 
>PHA02785 IL-beta-binding protein; Provisional
Probab=98.96  E-value=1.3e-08  Score=79.92  Aligned_cols=64  Identities=17%  Similarity=0.399  Sum_probs=43.8

Q ss_pred             CceEEEeCCcEEEEEEe-----eccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEcccee
Q psy5838          25 PNVTVTVGRDALLACVV-----DNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQE   99 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~-----~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~   99 (215)
                      .+..+.+|..+.|.|..     .+.+.+.       +.|++ +.. +         .+.|+...    .++.|.|.+++.
T Consensus       129 ~~~~~~~g~~~~i~C~~~~~~~~~~~~~~-------i~W~k-~~~-~---------~~~r~~~~----~~~~L~i~~v~~  186 (326)
T PHA02785        129 YPQIVNERSTGEMVCPNINAFIASNVNAD-------IIWSG-HRR-L---------RNKRLKQR----TPGIITIEDVRK  186 (326)
T ss_pred             ccceecccCcEEEECCChhhcccCCCCce-------EEEcc-CCc-c---------CCcceEec----CCCeEEEeecCh
Confidence            34456789999999972     2345555       99987 322 1         22343332    234899999999


Q ss_pred             cCCEEEEEEcc
Q psy5838         100 SDRGWYMCQVN  110 (215)
Q Consensus       100 ~d~G~Y~C~~~  110 (215)
                      +|+|.|+|.+.
T Consensus       187 ~d~G~Y~C~~~  197 (326)
T PHA02785        187 NDAGYYTCVLK  197 (326)
T ss_pred             hhCeEEEEEEE
Confidence            99999999876


No 88 
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=98.96  E-value=8.6e-09  Score=65.33  Aligned_cols=33  Identities=24%  Similarity=0.335  Sum_probs=26.2

Q ss_pred             CCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          23 PIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      .+..+.+.+|+++.|.|...+ +.+.       +.|++++.
T Consensus         2 ~~~~~~v~~g~~v~L~C~~~~-p~~~-------i~W~k~~~   34 (89)
T cd04979           2 EEKVVTVVEGNSVFLECSPKS-NLAS-------VVWLFQGG   34 (89)
T ss_pred             cceEEEEECCCcEEEEEeCCC-CCce-------EEEEECCc
Confidence            356788899999999999876 4455       99999643


No 89 
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=98.95  E-value=3.2e-08  Score=66.23  Aligned_cols=83  Identities=19%  Similarity=0.263  Sum_probs=45.2

Q ss_pred             CCCceEEEeCCcEEEEEEeeccCC---ccceeeeEEEEEEecCCc----cEEE-eeece---eeeCCceEEEEc-CCceE
Q psy5838          23 PIPNVTVTVGRDALLACVVDNLKG---FKGLRIGWQVAWVRVDTQ----TILS-IHHNV---ITQNPRISLTYN-DHRSW   90 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~~~~~---~~~~~~~~~v~W~~~~~~----~~~~-~~~~~---~~~~~~~~~~~~-~~~~~   90 (215)
                      .|..+.+.+|++|+|+|.+..+..   ..+..    +.|+++...    .+.. ..+..   ....+|+.+..+ ...+.
T Consensus         5 ~P~~v~~~~G~~VtL~C~f~~~~~~~~~~~~~----~~Wykq~~g~~~~~~~~~~~~~~~~~~~f~gR~~~~~~~~~~~~   80 (119)
T cd05712           5 MPKSVSVQEGLCVLIPCSFSYPADWPVSNGVH----GIWYKGHPYPKNRPPVATNNRSRLVHESTRGRFRLLGDLGKKNC   80 (119)
T ss_pred             CCCEEEEeccccEEEEEEeeCcccccCCCceE----EEEEeCCCCCCCCCcEEEcCCCccccccccccEEEecCCCCCEE
Confidence            366789999999999999874431   11121    899997532    1111 11110   112245554422 33445


Q ss_pred             EEEEccceecCCEEEEEEc
Q psy5838          91 FLNIKNVQESDRGWYMCQV  109 (215)
Q Consensus        91 ~l~i~~~~~~d~G~Y~C~~  109 (215)
                      +|.|.+++.+|+|.|.|.+
T Consensus        81 sL~I~~l~~~Dsg~Y~C~~   99 (119)
T cd05712          81 SLLISDAQPEDSGKYFFRV   99 (119)
T ss_pred             EEEEccCChhhCeEEEEEE
Confidence            5666666666666666644


No 90 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=98.94  E-value=3e-09  Score=65.48  Aligned_cols=21  Identities=24%  Similarity=0.439  Sum_probs=18.1

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |+|.|.+.+.|.|.       +.|+|++
T Consensus         1 v~L~C~~~g~P~p~-------v~W~k~g   21 (77)
T cd05760           1 VTLRCHIDGHPRPT-------YQWFRDG   21 (77)
T ss_pred             CEEEEEeeecCCCc-------EEEEECC
Confidence            57999999998888       9999943


No 91 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=98.94  E-value=6.1e-09  Score=66.31  Aligned_cols=38  Identities=16%  Similarity=0.223  Sum_probs=29.5

Q ss_pred             CcccCCCCceEEEeC---CcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          18 PHFAEPIPNVTVTVG---RDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        18 p~~~~~~~~~~~~~G---~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |.|...|..+.+..|   +++.|.|.+.+.+.+.       +.|+++.
T Consensus         2 P~f~~~p~~~~~~~~~~~~~~~l~C~~~g~p~p~-------i~W~k~~   42 (91)
T cd04967           2 PVFEEQPDDTIFPEESDEGKVSLNCRARGSPPPT-------YRWLMNG   42 (91)
T ss_pred             CeeEeCCCCEEccCCCCCCEEEEEEeeeEcCCCE-------EEEEECC
Confidence            667777777765544   5799999999888887       9999943


No 92 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=98.94  E-value=4.6e-09  Score=63.59  Aligned_cols=23  Identities=13%  Similarity=0.281  Sum_probs=19.1

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      +.|.|.+.+.|.+.       +.|+| ++..
T Consensus         1 ~~l~c~v~g~P~p~-------v~W~k-~g~~   23 (71)
T cd04976           1 VRLPVKVKAYPPPE-------IQWYK-NGKL   23 (71)
T ss_pred             CEEEeEEEEeCCCE-------EEEEE-CCEE
Confidence            46899999999888       99999 5544


No 93 
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=98.94  E-value=2.1e-08  Score=66.49  Aligned_cols=21  Identities=33%  Similarity=0.311  Sum_probs=18.3

Q ss_pred             CCceEEEeCCcEEEEEEeecc
Q psy5838          24 IPNVTVTVGRDALLACVVDNL   44 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~   44 (215)
                      +..+.+..|+++.|.|.+...
T Consensus         5 ~~ev~a~~G~~v~L~C~f~~~   25 (116)
T cd05879           5 DREVYGTVGSDVTLSCSFWSS   25 (116)
T ss_pred             cceEEEEcCCcEEEEEEEecC
Confidence            457889999999999999864


No 94 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.94  E-value=9.1e-09  Score=62.29  Aligned_cols=22  Identities=32%  Similarity=0.718  Sum_probs=18.9

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      +.|.|.+.|.|.|.       +.|+|+++
T Consensus         1 ~~L~C~~~G~P~P~-------v~W~k~~~   22 (71)
T cd05876           1 LVLECIAEGLPTPE-------VHWDRIDG   22 (71)
T ss_pred             CEEEEEeeEecCCe-------EEEEECCc
Confidence            47999999999998       99999544


No 95 
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=98.93  E-value=1.1e-08  Score=68.24  Aligned_cols=35  Identities=23%  Similarity=0.558  Sum_probs=26.7

Q ss_pred             cCCCCceEEEeCCcEEEEEEeecc-CCccceeeeEEEEEEecC
Q psy5838          21 AEPIPNVTVTVGRDALLACVVDNL-KGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        21 ~~~~~~~~~~~G~~v~L~C~~~~~-~~~~~~~~~~~v~W~~~~   62 (215)
                      ...+..+.+..|++|+|+|.+... ....       +.|+|..
T Consensus         3 ~q~~~~v~~~~G~~v~L~C~~~~~~~~~~-------v~Wyrq~   38 (116)
T cd07706           3 TQAQPDVSVQVGEEVTLNCRYETSWTNYY-------IFWYKQL   38 (116)
T ss_pred             EEeCCceEEcCCCCEEEEEEEeCCCCceE-------EEEEEEC
Confidence            445678899999999999998753 2233       8999964


No 96 
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=98.92  E-value=1.1e-08  Score=67.43  Aligned_cols=14  Identities=21%  Similarity=0.617  Sum_probs=12.1

Q ss_pred             eCCcEEEEEEeecc
Q psy5838          31 VGRDALLACVVDNL   44 (215)
Q Consensus        31 ~G~~v~L~C~~~~~   44 (215)
                      .|++|+|+|.+...
T Consensus         1 ~G~~VtLpC~~~~~   14 (112)
T cd05900           1 LGSSLLIPCYFQDP   14 (112)
T ss_pred             CCCcEEEeeEEeCC
Confidence            48999999999854


No 97 
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=98.92  E-value=1.6e-08  Score=67.22  Aligned_cols=33  Identities=21%  Similarity=0.304  Sum_probs=23.6

Q ss_pred             CCceEEEeCCcEEEEEEeeccCC-ccceeeeEEEEEEe
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKG-FKGLRIGWQVAWVR   60 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~-~~~~~~~~~v~W~~   60 (215)
                      +..+.+.+|++++|.|.+..... .....    +.|++
T Consensus         5 ~~~v~~~~G~~v~L~C~~s~~~~~~~~~~----i~W~~   38 (115)
T cd05880           5 SKEVEAVNGTDVRLKCTFSSSAPIGDTLV----ITWNF   38 (115)
T ss_pred             CceEEEEcCCCEEEEEEEEeCCCCCCcEE----EEEEE
Confidence            56889999999999999875432 11222    78865


No 98 
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=98.92  E-value=2.1e-08  Score=66.86  Aligned_cols=34  Identities=21%  Similarity=0.323  Sum_probs=24.2

Q ss_pred             CCceEEEeCCcEEEEEEeeccCC-ccceeeeEEEEEEec
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKG-FKGLRIGWQVAWVRV   61 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~-~~~~~~~~~v~W~~~   61 (215)
                      |..+.+.+|++|+|.|.+..... .....    +.|++.
T Consensus         5 p~~v~v~~G~~vtL~C~~s~~~~~~~~~~----v~W~~~   39 (116)
T cd05715           5 PREVYAVNGSDVRLKCTFSSSEPISDDIS----VTWSFQ   39 (116)
T ss_pred             CCeEEEEcCCCeEEEeEEeCCCCcCCceE----EEEEEe
Confidence            56788999999999999975422 12222    889764


No 99 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=98.92  E-value=4.7e-09  Score=63.14  Aligned_cols=24  Identities=25%  Similarity=0.382  Sum_probs=21.7

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |++++|.|.+.|.|.|.       +.|+|++
T Consensus         1 G~~v~L~C~a~G~P~P~-------v~W~k~g   24 (69)
T cd05739           1 GGSVNLTCVAVGAPMPY-------VKWMKGG   24 (69)
T ss_pred             CCeEEEEEEeeecCCCE-------EEEEECC
Confidence            78999999999999998       9999954


No 100
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.91  E-value=4.8e-09  Score=64.93  Aligned_cols=22  Identities=14%  Similarity=0.380  Sum_probs=18.7

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      |+|.|.+.+.|.|.       +.|++.++
T Consensus         1 v~l~C~~~G~P~P~-------v~W~~~~~   22 (79)
T cd05734           1 VTLNCSAEGYPPPT-------IVWKHSKG   22 (79)
T ss_pred             CEeEeeCeEeCCCE-------EEEEECCC
Confidence            57999999998887       99999644


No 101
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.90  E-value=3.1e-09  Score=66.41  Aligned_cols=61  Identities=25%  Similarity=0.247  Sum_probs=37.5

Q ss_pred             ceEEEeCCcEEEEEEeec-cCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEE
Q psy5838          26 NVTVTVGRDALLACVVDN-LKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGW  104 (215)
Q Consensus        26 ~~~~~~G~~v~L~C~~~~-~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~  104 (215)
                      ...+.+|++|+|.|.... .+.+.       +.|+|+ +..+..                 ......|.|.+++.+|+|.
T Consensus         8 ~~~V~~G~~vtL~C~~~~~~~~~~-------~~w~k~-g~~~~~-----------------~~~~~~l~I~~~~~~dsG~   62 (83)
T cd05753           8 SRVVFEGEPLVLRCHGWKNKPVYK-------VTYYRD-GKAKKY-----------------SHSNSNLSIPQATLSDSGS   62 (83)
T ss_pred             cceecCCCCEEEEeeCCCCCcceE-------EEEEEC-CeEccc-----------------cCCCceEEECccCHHHCEE
Confidence            446889999999999853 33344       899994 332210                 0012356666666666666


Q ss_pred             EEEEccC
Q psy5838         105 YMCQVNT  111 (215)
Q Consensus       105 Y~C~~~~  111 (215)
                      |+|.+.+
T Consensus        63 Y~C~~~~   69 (83)
T cd05753          63 YHCSGII   69 (83)
T ss_pred             EEEEEEe
Confidence            6665554


No 102
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.90  E-value=5.1e-09  Score=66.69  Aligned_cols=71  Identities=24%  Similarity=0.344  Sum_probs=43.3

Q ss_pred             CCceEEEeCCcEEEEEEee-ccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCC
Q psy5838          24 IPNVTVTVGRDALLACVVD-NLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDR  102 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~-~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~  102 (215)
                      ...+.+.+|+.+.|.|.-. +.|.+.       +.|++++ ..+..      ..+.|..+..   .+|+|.+.+++.+|+
T Consensus        10 ~~~~~v~eG~~~~L~C~pP~g~P~p~-------~~W~k~~-~~~~~------~~d~r~~~~~---~~G~L~fs~v~~~D~   72 (96)
T cd05727          10 RDEVKVKEGWGVVLFCDPPPHYPDLS-------YRWLLNE-FPNFI------PEDGRRFVSQ---TNGNLYIAKVEASDR   72 (96)
T ss_pred             cCceeeeeCCcEEEeeCCCCCCCCCE-------EEEEECC-ccccc------ccCCCeEEeC---CCCcEEEeecCHhhC
Confidence            4467789999999999765 445565       9999954 32211      1122322222   245677666666666


Q ss_pred             EEEEEEccC
Q psy5838         103 GWYMCQVNT  111 (215)
Q Consensus       103 G~Y~C~~~~  111 (215)
                      |.|+|.|.+
T Consensus        73 g~Y~C~A~n   81 (96)
T cd05727          73 GNYSCFVSS   81 (96)
T ss_pred             ceeEEEEEe
Confidence            666665554


No 103
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=98.90  E-value=2e-08  Score=64.89  Aligned_cols=75  Identities=21%  Similarity=0.293  Sum_probs=42.9

Q ss_pred             EEEeCCcEEEEEEeecc--CCccceeeeEEEEEEecCC--cc--EEEeeec-eeeeCCceEEEEcCCceEEEEEccceec
Q psy5838          28 TVTVGRDALLACVVDNL--KGFKGLRIGWQVAWVRVDT--QT--ILSIHHN-VITQNPRISLTYNDHRSWFLNIKNVQES  100 (215)
Q Consensus        28 ~~~~G~~v~L~C~~~~~--~~~~~~~~~~~v~W~~~~~--~~--~~~~~~~-~~~~~~~~~~~~~~~~~~~l~i~~~~~~  100 (215)
                      .+.+|++|+|.|.+...  ....       +.||+...  .+  ++..... ......|+....+. ....|.|.+++.+
T Consensus         2 ~v~~G~~v~l~C~~~~~~~~~~~-------i~Wy~q~~g~~~~~l~~~~~~~~~~~~~rf~~~~~~-~~~~L~I~~~~~~   73 (98)
T cd04984           2 SVSPGETVTITCTGSSGNISGNY-------VNWYQQKPGSAPRYLIYEDSDRPSGIPDRFSGSKSG-NTASLTISGAQTE   73 (98)
T ss_pred             ccCCCCCEEEEEEEcCCCcCCCC-------EEEEEECCCCCccEEEEeccccCCCCCCCEEEEccC-CEEEEEECCCChh
Confidence            46789999999998764  3334       89999753  21  2221111 00112355444333 4556666666666


Q ss_pred             CCEEEEEEcc
Q psy5838         101 DRGWYMCQVN  110 (215)
Q Consensus       101 d~G~Y~C~~~  110 (215)
                      |+|.|.|.+.
T Consensus        74 Dsg~Y~C~~~   83 (98)
T cd04984          74 DEADYYCQVW   83 (98)
T ss_pred             hCEEEEEEEc
Confidence            6666666554


No 104
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.89  E-value=3.2e-09  Score=64.21  Aligned_cols=57  Identities=23%  Similarity=0.325  Sum_probs=34.4

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEccC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      +.|.|.+.|.|.|.       +.|+|+ +.++..       ...++..  .   ..+|.|.+++.+|+|.|+|.+.+
T Consensus         1 ~~l~c~v~g~P~P~-------v~W~kd-g~~l~~-------~~~~~~~--~---~~~L~I~~v~~~D~G~YtC~a~~   57 (72)
T cd07702           1 YRLTPKVKAFPAPE-------VIWLKD-GLPAAE-------KCSRYHV--D---GYSLVIKDVTEEDAGIYTILLGI   57 (72)
T ss_pred             CeEEeeEEEcCCCe-------EEEEEC-CEECCC-------CCcEEEe--C---CCEEEECcCCHHHCEEEEEEEEc
Confidence            46899999999998       999994 443311       1112211  1   12566666666666666665554


No 105
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=98.89  E-value=8.1e-09  Score=63.54  Aligned_cols=22  Identities=9%  Similarity=0.279  Sum_probs=18.3

Q ss_pred             EEEEeeccCCccceeeeEEEEEEecCCccE
Q psy5838          37 LACVVDNLKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        37 L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      ++|.+.|.|.|.       +.|+| ++..+
T Consensus         3 i~~~v~G~P~Pt-------i~W~k-ng~~l   24 (79)
T cd05855           3 IPFTVKGNPKPT-------LQWFH-EGAIL   24 (79)
T ss_pred             EEEEEeEeCCCc-------eEEEE-CCEEC
Confidence            679999999998       99999 55543


No 106
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=98.89  E-value=3.8e-09  Score=68.74  Aligned_cols=32  Identities=19%  Similarity=0.168  Sum_probs=23.3

Q ss_pred             CCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          23 PIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      .+.+..+.+|++|+|.|.........       +.|+|+
T Consensus         4 e~~p~~~~~G~~V~L~v~~~p~~~~~-------~~W~kg   35 (105)
T cd05774           4 ELVPPQVAEGENVLLLVHNLPENLLA-------YAWYKG   35 (105)
T ss_pred             eccCCcccCCCCEEEEecCCCCCceE-------EEEEcC
Confidence            44566788999999999875433223       899996


No 107
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=98.89  E-value=8.4e-09  Score=64.07  Aligned_cols=22  Identities=9%  Similarity=0.262  Sum_probs=18.2

Q ss_pred             EEEEeeccCCccceeeeEEEEEEecCCccE
Q psy5838          37 LACVVDNLKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        37 L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      |.|.+.+.|.|.       +.|+| ++..+
T Consensus         3 i~~~v~G~P~P~-------v~W~k-~g~~i   24 (81)
T cd04971           3 IPFTVRGNPKPT-------LTWYH-NGAVL   24 (81)
T ss_pred             EEEEeEeeCCCc-------EEEEE-CCEEC
Confidence            689999999998       99999 55544


No 108
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.88  E-value=6.4e-09  Score=63.67  Aligned_cols=22  Identities=23%  Similarity=0.416  Sum_probs=18.6

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      +.|.|.+.+.|.|.       +.|+|++.
T Consensus         1 a~l~C~~~G~P~P~-------v~W~k~~~   22 (75)
T cd05763           1 ARLECAATGHPTPQ-------IAWQKDGG   22 (75)
T ss_pred             CEeEeecccccCCE-------EEEEeCCC
Confidence            47899999999998       99999543


No 109
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.88  E-value=4.1e-09  Score=63.52  Aligned_cols=24  Identities=17%  Similarity=0.230  Sum_probs=19.6

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCCccE
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      +.|.|.+.|.|.|.       +.|+| ++..+
T Consensus         1 ~~~~c~v~G~P~P~-------v~W~k-~g~~l   24 (70)
T cd05864           1 VKIPVKYYGYPPPE-------VKWYK-NGQLI   24 (70)
T ss_pred             CEEEeEEEEeCCCE-------EEEEE-CCEEC
Confidence            46899999999998       99999 55443


No 110
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=98.87  E-value=6.7e-09  Score=65.09  Aligned_cols=24  Identities=25%  Similarity=0.541  Sum_probs=19.9

Q ss_pred             CCcEEEEEEeecc--CCccceeeeEEEEEEecC
Q psy5838          32 GRDALLACVVDNL--KGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        32 G~~v~L~C~~~~~--~~~~~~~~~~~v~W~~~~   62 (215)
                      |+++.|.|.+.+.  +.+.       +.|.+.+
T Consensus         1 Ge~~~L~C~~~g~~~~~~~-------i~W~~~~   26 (84)
T cd05742           1 GETLVLNCTVLTELNEGVD-------FQWTYPG   26 (84)
T ss_pred             CCeEEEEEEEEeCCCccEE-------EEEecCC
Confidence            7899999999988  5555       9998844


No 111
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=98.86  E-value=8.9e-09  Score=64.65  Aligned_cols=67  Identities=28%  Similarity=0.461  Sum_probs=43.7

Q ss_pred             CCCCceEEEeCCcEEEEEEeec-cCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceec
Q psy5838          22 EPIPNVTVTVGRDALLACVVDN-LKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQES  100 (215)
Q Consensus        22 ~~~~~~~~~~G~~v~L~C~~~~-~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~  100 (215)
                      ..|....+.+|++++|.|.+.+ .+.+.       +.|++++.. +.          .+.  .   ...+.|.|.+++.+
T Consensus         6 ~~p~~~~v~~G~~v~L~C~~~~~~~~~~-------i~W~~~~~~-~~----------~~~--~---~~~~~L~I~~v~~~   62 (85)
T cd05754           6 EEPRSQEVRPGADVSFICRAKSKSPAYT-------LVWTRVGGG-LP----------SRA--M---DFNGILTIRNVQLS   62 (85)
T ss_pred             cCCCceEEcCCCCEEEEEEcCCCCCCcE-------EEEEECCCc-CC----------Ccc--c---ccCCEEEECCCCHH
Confidence            4467888999999999999874 45555       999995432 10          010  0   01236777777777


Q ss_pred             CCEEEEEEccC
Q psy5838         101 DRGWYMCQVNT  111 (215)
Q Consensus       101 d~G~Y~C~~~~  111 (215)
                      |+|.|+|.+.+
T Consensus        63 DsG~Y~C~a~n   73 (85)
T cd05754          63 DAGTYVCTGSN   73 (85)
T ss_pred             HCEEEEEEEec
Confidence            77777776654


No 112
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=98.85  E-value=2.2e-08  Score=62.69  Aligned_cols=24  Identities=17%  Similarity=0.461  Sum_probs=20.1

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |++++|.|.+.+.+.+.       +.|++..
T Consensus         1 Ge~~~l~C~~~~~~~~~-------~~W~~~~   24 (84)
T cd05861           1 GETITVNCIVQGNEVVD-------FSWTYPG   24 (84)
T ss_pred             CCcEEEEEEEECCCccE-------EEEEECC
Confidence            78999999999877666       8998743


No 113
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=98.85  E-value=2.1e-08  Score=64.56  Aligned_cols=25  Identities=28%  Similarity=0.642  Sum_probs=17.6

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |++|+|.|.+......  .    ++.|+|..
T Consensus         1 G~~vtL~C~~~~~~~~--~----~v~W~k~~   25 (97)
T cd05846           1 GGNVTLSCNLTLPEEV--L----QVTWQKIQ   25 (97)
T ss_pred             CCcEEEEEEeCCCCee--E----EEEEEEcC
Confidence            7899999998754221  1    28998854


No 114
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=98.84  E-value=2.6e-08  Score=62.29  Aligned_cols=30  Identities=17%  Similarity=0.325  Sum_probs=24.7

Q ss_pred             ceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          26 NVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        26 ~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      .+.+..|+++.|.|.+.+.+.+.       +.|++++
T Consensus         3 ~~~~~~G~~~~l~C~~~~~p~~~-------v~W~k~~   32 (85)
T cd05729           3 LHAVPAGSTVRLKCPASGNPRPT-------ITWLKDG   32 (85)
T ss_pred             eeEecCCCcEEEEEEcCCCCCCe-------EEEEECC
Confidence            35667899999999999877776       9999943


No 115
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=98.84  E-value=9.2e-09  Score=65.55  Aligned_cols=26  Identities=12%  Similarity=0.167  Sum_probs=19.4

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      |++|+|.|.+.......       +.|+++...
T Consensus         1 G~~VtL~c~~~~~~~~~-------i~W~~~~~~   26 (92)
T cd05741           1 GESVTLPVSNLPENLQE-------ITWYKGKDK   26 (92)
T ss_pred             CCcEEEEcccCCCCCEE-------EEEECCCCC
Confidence            89999999987643333       999996533


No 116
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=98.83  E-value=9.7e-09  Score=62.09  Aligned_cols=22  Identities=23%  Similarity=0.767  Sum_probs=18.6

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      |.|.|.+.+.|.|.       +.|+|.++
T Consensus         1 v~l~C~~~g~P~p~-------v~W~k~~~   22 (71)
T cd05731           1 LLLECIAEGLPTPE-------ISWIKIGG   22 (71)
T ss_pred             CEEEEEeeEecCCe-------EEEEECCe
Confidence            57999999999887       99999543


No 117
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=98.83  E-value=1.4e-08  Score=62.10  Aligned_cols=24  Identities=13%  Similarity=0.504  Sum_probs=18.6

Q ss_pred             EEEEEEeec-cCCccceeeeEEEEEEecCCccE
Q psy5838          35 ALLACVVDN-LKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        35 v~L~C~~~~-~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      ++|.|.+.+ .|.+.       +.|+|+ +..+
T Consensus         1 ~~l~C~~~g~~P~p~-------~~W~k~-g~~l   25 (75)
T cd05750           1 LVLKCEATSEYPSLR-------FKWFKD-GKEL   25 (75)
T ss_pred             CEEEEEccCCCCCce-------EEEEcC-Ceec
Confidence            479999998 77777       999994 4443


No 118
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=98.82  E-value=1.2e-08  Score=62.80  Aligned_cols=22  Identities=14%  Similarity=0.400  Sum_probs=18.6

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      |.|.|.+.|.|.|.       +.|+| ++.
T Consensus         1 i~l~C~~~G~P~P~-------v~W~k-~g~   22 (77)
T cd05733           1 IVIKCEAKGNPPPT-------FSWTR-NGT   22 (77)
T ss_pred             CEEEeeCcccCCCe-------EEEEE-CCe
Confidence            57999999999888       99999 444


No 119
>smart00409 IG Immunoglobulin.
Probab=98.81  E-value=1e-07  Score=59.12  Aligned_cols=30  Identities=33%  Similarity=0.586  Sum_probs=25.1

Q ss_pred             CceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          25 PNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      ..+.+..|+++.|.|.+.+.+...       +.|+++
T Consensus         2 ~~~~~~~g~~~~l~C~~~~~~~~~-------~~W~~~   31 (86)
T smart00409        2 PSVTVKEGESVTLSCEVSGSPPPE-------VTWYKQ   31 (86)
T ss_pred             CcEEEeCCCeEEEEEEEccCCCCe-------EEEEEC
Confidence            467788999999999999875555       999995


No 120
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=98.81  E-value=1e-07  Score=59.12  Aligned_cols=30  Identities=33%  Similarity=0.586  Sum_probs=25.1

Q ss_pred             CceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          25 PNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      ..+.+..|+++.|.|.+.+.+...       +.|+++
T Consensus         2 ~~~~~~~g~~~~l~C~~~~~~~~~-------~~W~~~   31 (86)
T smart00410        2 PSVTVKEGESVTLSCEVSGSPPPE-------VTWYKQ   31 (86)
T ss_pred             CcEEEeCCCeEEEEEEEccCCCCe-------EEEEEC
Confidence            467788999999999999875555       999995


No 121
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=98.81  E-value=2.6e-08  Score=65.78  Aligned_cols=33  Identities=30%  Similarity=0.469  Sum_probs=25.3

Q ss_pred             CCCceEEEeCCcEEEEEEee-ccCCccceeeeEEEEEEecC
Q psy5838          23 PIPNVTVTVGRDALLACVVD-NLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~-~~~~~~~~~~~~~v~W~~~~   62 (215)
                      ++..+.+.+|+++.|.|.+. ......       +.|++..
T Consensus         7 ~~~~v~~~~G~~v~L~C~~~~~~~~~~-------v~W~~~~   40 (114)
T PF07686_consen    7 PPSPVTVQEGESVTLPCSYSSSSNQSS-------VYWYRQS   40 (114)
T ss_dssp             EESEEEEETTSEEEEEEEEESSSSGSE-------EEEEEEE
T ss_pred             eCCeEEEecCCCEEEEEEEeCCCCcce-------EEEEEEC
Confidence            46788999999999999998 223333       8999853


No 122
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=98.81  E-value=3.6e-08  Score=63.60  Aligned_cols=29  Identities=17%  Similarity=0.428  Sum_probs=22.1

Q ss_pred             eEEEeCCcEEEEEEeecc-CCccceeeeEEEEEEecC
Q psy5838          27 VTVTVGRDALLACVVDNL-KGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        27 ~~~~~G~~v~L~C~~~~~-~~~~~~~~~~~v~W~~~~   62 (215)
                      +.+.+|++|+|.|.+... ....       +.|+|..
T Consensus         2 v~~~~G~~vtl~C~~~~~~~~~~-------~~W~r~~   31 (98)
T cd05716           2 VTGELGGSVTIPCPYPPKNRSYE-------KYWCKWG   31 (98)
T ss_pred             EEEEeCCeEEEEeeCCCCCCCcE-------eEeECCC
Confidence            568899999999998753 2223       8999974


No 123
>KOG3515|consensus
Probab=98.80  E-value=1.7e-08  Score=85.02  Aligned_cols=80  Identities=25%  Similarity=0.365  Sum_probs=51.6

Q ss_pred             EEEEEcccCCCCCeEEEEEeecC--CCcceeeE--EEEEcCCeEEecCCCcc-eeeecCCcEEEEEEecc-cCCCeEEEE
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNTD--PMRSRQGY--LQVVVPPSIIDKDTSTD-LVVREQANVTLNCKAQG-YPEPYVMWR  198 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~~--~~~~~~~~--l~v~~~p~~~~~~~~~~-~~~~~g~~~~l~C~~~~-~p~~~i~W~  198 (215)
                      ..+.+...+..+.|.|+|.+.+.  ........  +.+..+...+....... ....+|..+.|.|.+.+ +|.+++.|+
T Consensus       163 s~l~~~v~Rka~~g~~tC~A~nr~s~~l~~~~~~~i~v~~~~~~~~~~~~~~~qsF~~g~~inlvc~~~gg~P~~~~~w~  242 (741)
T KOG3515|consen  163 SLLKQTVSRKADNGNYTCPANNRNSPGLSFAKQLTIIVEAPCKGIGITGAQEQQSFTEGQTINLVCNAQGGNPSQQQTWY  242 (741)
T ss_pred             cceeeEEEEecCCceeEcccccccCccccccceeEeecccccccceecchhhcCcccccceEEEEehhhcCCcchhhhhc
Confidence            44777888889999999999652  23333333  33333322222212222 34789999999998765 799999999


Q ss_pred             eCCCccc
Q psy5838         199 REDGANL  205 (215)
Q Consensus       199 ~~~~~~~  205 (215)
                      + +....
T Consensus       243 ~-~s~~~  248 (741)
T KOG3515|consen  243 K-DSRPQ  248 (741)
T ss_pred             c-ccccc
Confidence            9 54443


No 124
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=98.79  E-value=5.3e-08  Score=64.17  Aligned_cols=36  Identities=28%  Similarity=0.348  Sum_probs=23.0

Q ss_pred             eEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEEEE
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQVV  159 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v~  159 (215)
                      ...|+|.+++.+|+|.|.|.+... ......+.|+|.
T Consensus        71 ~asL~I~~l~~sD~G~Y~C~v~~~~~~~~~~v~l~V~  107 (110)
T cd05878          71 DASLEISRLRSSDSGVYRCEVMHGIEDEQDTVPLEVT  107 (110)
T ss_pred             cEEEEECCCChhhCEEEEEEEEeCCCcceEEEEEEEE
Confidence            345778888888888888887542 334444555553


No 125
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=98.78  E-value=5e-08  Score=63.92  Aligned_cols=37  Identities=24%  Similarity=0.266  Sum_probs=24.9

Q ss_pred             CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEEEE
Q psy5838         123 RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQVV  159 (215)
Q Consensus       123 ~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v~  159 (215)
                      ...+|+|.+++.+|+|.|.|.+.+. ......+.|.|.
T Consensus        66 ~~~sL~I~~v~~sD~G~Y~C~v~~~~~~~~~~v~L~V~  103 (106)
T cd05714          66 GDASLVITDLRLEDSGRYRCEVIDGIEDEQDTVELEVR  103 (106)
T ss_pred             CcceEEECCCCHHHCEEEEEEEEcCCCceEEEEEEEEE
Confidence            4456888888889999999988653 223444445543


No 126
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=98.77  E-value=4.2e-08  Score=62.35  Aligned_cols=29  Identities=17%  Similarity=0.255  Sum_probs=22.7

Q ss_pred             ceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          26 NVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        26 ~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      .+++.+|++++|.|... .+.+.       +.|+++.
T Consensus         5 ~~~~~eG~~v~L~C~~~-~p~p~-------v~Wykq~   33 (91)
T cd05871           5 VVYGVENNSTFLECLPK-SPQAS-------VKWLFQR   33 (91)
T ss_pred             EEEEecCCcEEEEEECC-CCCce-------EEEEEEC
Confidence            46788999999999964 55555       9999853


No 127
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=98.77  E-value=1.2e-07  Score=61.79  Aligned_cols=75  Identities=24%  Similarity=0.457  Sum_probs=42.0

Q ss_pred             EEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCc----c--EEEeeec-ee--e----eCCceEEEEcCCceEEEEE
Q psy5838          28 TVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ----T--ILSIHHN-VI--T----QNPRISLTYNDHRSWFLNI   94 (215)
Q Consensus        28 ~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~----~--~~~~~~~-~~--~----~~~~~~~~~~~~~~~~l~i   94 (215)
                      .+.+|++|+|.|.+.......       +.|+|+...    +  ++..... ..  .    ...|+...... ....|.|
T Consensus         2 ~v~~G~~vtL~C~~~~~~~~~-------v~Wyrq~~g~~~~~~~l~~~~~~~~~~~~~~~~~~~rf~~~~~~-~~~~L~I   73 (104)
T cd05720           2 DAELGQKVELKCEVLNSSPTG-------CSWLFQPPGSAPQPTFLVYLSGSSKITWDEEELSSKRFSGSRSS-NSFVLTL   73 (104)
T ss_pred             cccCCCeEEEEEEecCCCCCc-------EEEEEeCCCCCCCCEEEEEEeCCCCeeeccccCCCceEEEEecC-CEEEEEE
Confidence            356899999999986543344       899997532    2  2222110 00  0    12344433322 4556666


Q ss_pred             ccceecCCEEEEEEcc
Q psy5838          95 KNVQESDRGWYMCQVN  110 (215)
Q Consensus        95 ~~~~~~d~G~Y~C~~~  110 (215)
                      .+++.+|+|.|.|.+.
T Consensus        74 ~~~~~sDsgtY~Ca~~   89 (104)
T cd05720          74 KNFQKENEGYYFCSVA   89 (104)
T ss_pred             CCCCHHHCEEEEEEEc
Confidence            6666666666666554


No 128
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=98.75  E-value=7.9e-08  Score=62.95  Aligned_cols=35  Identities=26%  Similarity=0.270  Sum_probs=22.8

Q ss_pred             eEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEEE
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQV  158 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v  158 (215)
                      ..+|+|.+++.+|+|.|.|.+.+. ......+.|+|
T Consensus        67 ~~sL~I~~v~~~DsG~Y~C~v~~~~~~~~~~~~l~v  102 (106)
T cd05877          67 DASLVITDLRLEDYGRYRCEVIDGLEDESVVVALRL  102 (106)
T ss_pred             cEEEEEccCChHHCEEEEEEEEecccceEEEEEEEE
Confidence            456888888888888888888542 22333344444


No 129
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=98.75  E-value=4.8e-08  Score=59.91  Aligned_cols=24  Identities=17%  Similarity=0.486  Sum_probs=16.7

Q ss_pred             EEEEEEeec-cCCccceeeeEEEEEEecCCccE
Q psy5838          35 ALLACVVDN-LKGFKGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        35 v~L~C~~~~-~~~~~~~~~~~~v~W~~~~~~~~   66 (215)
                      +.|.|.+.+ .|.+.       +.|+++ +..+
T Consensus         1 ~~L~C~a~~~~p~~~-------~~W~~~-g~~i   25 (76)
T cd05895           1 LVLRCETVSEYPSLR-------FKWFKN-GKEI   25 (76)
T ss_pred             CEEEEecccCCCCCc-------eEEEEC-Cccc
Confidence            479999864 45565       999995 4443


No 130
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=98.73  E-value=9.2e-08  Score=67.27  Aligned_cols=32  Identities=13%  Similarity=0.396  Sum_probs=24.6

Q ss_pred             CceEEEeCCcEEEEEEee-ccCCccceeeeEEEEEEecCC
Q psy5838          25 PNVTVTVGRDALLACVVD-NLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~-~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      ..+.+.+|++|+|.|... +...+.       +.|+|.++
T Consensus        23 ~~v~V~ege~VtLsCs~t~s~~~~q-------VtWkK~~~   55 (189)
T PHA02987         23 VKITVSEHVNVKISCNKTSSFNSIL-------ITWKKNNK   55 (189)
T ss_pred             EEEEEcCCCCEEEEEecCCCCccce-------EEEEEcCC
Confidence            467889999999999986 333444       99999644


No 131
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=98.73  E-value=1.8e-07  Score=60.23  Aligned_cols=23  Identities=30%  Similarity=0.593  Sum_probs=16.7

Q ss_pred             eEEEEEcccCCCCCeEEEEEeec
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ...|.|.+++.+|+|.|.|.+..
T Consensus        61 ~~sL~I~~v~~~D~G~Y~C~v~~   83 (98)
T cd05718          61 DATISISNLRLEDEGNYICEFAT   83 (98)
T ss_pred             ceEEEEccCCcccCEEEEEEEEe
Confidence            34577788888888888887753


No 132
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=98.73  E-value=3.2e-08  Score=61.63  Aligned_cols=64  Identities=20%  Similarity=0.284  Sum_probs=39.9

Q ss_pred             CceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEE
Q psy5838          25 PNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGW  104 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~  104 (215)
                      ..+++..|++++|+|....... .       +.|+.++ ..+        ..+.++.....     .|.|..++.+|+|.
T Consensus         4 ~~~tv~~g~~v~L~C~~~s~~A-~-------v~W~~ng-~~l--------~~~~r~~~~~~-----GLlI~~~~~~dsG~   61 (85)
T cd05872           4 KNRTVAPGADVVLPCQLRSNLA-S-------PVWLFNG-TPL--------NAQFSYRVGTD-----GLLILVTSPEHSGT   61 (85)
T ss_pred             eEEEEecCCCEEEECCCCCCCc-c-------EEEEECC-ccc--------CCCcceEEeCC-----CCEEEECCHhhCEE
Confidence            4688999999999999987644 4       9999954 332        12234333322     25555555555555


Q ss_pred             EEEEcc
Q psy5838         105 YMCQVN  110 (215)
Q Consensus       105 Y~C~~~  110 (215)
                      |.|.+.
T Consensus        62 Y~C~s~   67 (85)
T cd05872          62 YRCYSE   67 (85)
T ss_pred             EEEEEe
Confidence            555544


No 133
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=98.73  E-value=1.8e-07  Score=62.36  Aligned_cols=33  Identities=24%  Similarity=0.442  Sum_probs=24.9

Q ss_pred             CCCceEEEeCCcEEEEEEeeccC--CccceeeeEEEEEEecC
Q psy5838          23 PIPNVTVTVGRDALLACVVDNLK--GFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~~~~--~~~~~~~~~~v~W~~~~   62 (215)
                      .|....+.+|++|+|.|.+....  ...       +.|||+.
T Consensus         3 ~~~~~~v~~G~~vtL~C~~~~~~~~~~~-------~~WYkQ~   37 (117)
T cd04981           3 ESGPGLVKPGQSLKLSCKASGFTFTSYG-------VNWVRQA   37 (117)
T ss_pred             cCCCeEEcCCCCEEEEEEEeCCCcccce-------EEEEEEC
Confidence            35678899999999999976432  223       8999974


No 134
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=98.72  E-value=4.1e-08  Score=60.20  Aligned_cols=21  Identities=19%  Similarity=0.510  Sum_probs=17.6

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +.|.|.+.+.|.+.       +.|+|++
T Consensus         1 ~~L~C~v~g~P~p~-------v~W~k~~   21 (76)
T cd05736           1 ASLRCHAEGIPLPR-------LTWLKNG   21 (76)
T ss_pred             CEeEeEeeecCCCE-------EEEEECC
Confidence            46899999988887       9999953


No 135
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=98.72  E-value=1e-07  Score=61.70  Aligned_cols=25  Identities=32%  Similarity=0.570  Sum_probs=16.4

Q ss_pred             cEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          34 DALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        34 ~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +|+|+|.+.........    ++.|+|..
T Consensus         2 ~v~L~C~~~~~~~~~~~----~v~W~k~~   26 (100)
T cd05888           2 DTRLPCRYNVSDGETVV----QVLWIREN   26 (100)
T ss_pred             CEEEEeEEecCCCCcEE----EEEEEEcc
Confidence            68999999754322211    28999853


No 136
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.72  E-value=4.1e-08  Score=60.40  Aligned_cols=21  Identities=14%  Similarity=0.385  Sum_probs=18.3

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |.|.|.+.|.|.|.       +.|+|++
T Consensus         1 ~~l~C~a~G~P~P~-------i~W~k~g   21 (77)
T cd05874           1 IVIQCEAKGKPPPS-------FSWTRNG   21 (77)
T ss_pred             CEEEeeCcccCCCe-------EEEEECC
Confidence            57999999999998       9999953


No 137
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=98.71  E-value=2.1e-07  Score=59.71  Aligned_cols=34  Identities=12%  Similarity=0.209  Sum_probs=25.8

Q ss_pred             CCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          22 EPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        22 ~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      .......+.+|+++.|.|.+.+.|.|.+      +.|...
T Consensus         6 ~~~~s~~~~~G~~~~L~C~~~s~P~P~~------i~W~w~   39 (98)
T cd05898           6 SSEQVQYAVRGERGKVKCFIGSTPPPDR------IAWAWK   39 (98)
T ss_pred             ecCceEEEeCCCcEEEEEEEccCCCCcE------EEEEEc
Confidence            5566788999999999999976666542      567663


No 138
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=98.69  E-value=2.2e-07  Score=60.95  Aligned_cols=29  Identities=17%  Similarity=0.449  Sum_probs=21.9

Q ss_pred             EEEeCCcEEEEEEeeccC-CccceeeeEEEEEEecCC
Q psy5838          28 TVTVGRDALLACVVDNLK-GFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        28 ~~~~G~~v~L~C~~~~~~-~~~~~~~~~~v~W~~~~~   63 (215)
                      .+.+|++|+|.|.+.... ...       +.|||...
T Consensus         2 ~v~~G~~vtL~C~~~~~~~~~~-------~~Wyrq~~   31 (107)
T cd07700           2 LVQTNNTVKLSCEAKGISENTR-------IYWLRWRQ   31 (107)
T ss_pred             EEcCCCCEEEEEEEecCCCCCe-------EEEEEECC
Confidence            578999999999987532 233       99999753


No 139
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=98.68  E-value=2.6e-07  Score=59.52  Aligned_cols=22  Identities=23%  Similarity=0.554  Sum_probs=14.0

Q ss_pred             EEEEEcccCCCCCeEEEEEeec
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .+|.|.+++.+|.|.|.|.+.+
T Consensus        63 aSi~i~nl~~~D~G~Y~C~v~t   84 (99)
T cd05886          63 GTISLSRLELEDEGVYICEFAT   84 (99)
T ss_pred             ceEEEcCCccccCEEEEEEEEe
Confidence            3456666666666666666655


No 140
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=98.68  E-value=5.3e-07  Score=57.60  Aligned_cols=29  Identities=31%  Similarity=0.454  Sum_probs=19.1

Q ss_pred             eEEEEEcccCCCCCeEEEEEeecCCCcce
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNTDPMRSR  152 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~  152 (215)
                      +.+|.|.+++.+|.|.|+|.+...+..+.
T Consensus        59 d~sl~i~nv~~~D~G~Y~C~v~tfP~G~~   87 (96)
T cd05887          59 DATIMLENVGFSDIGVYICKAVTFPLGNT   87 (96)
T ss_pred             ccEEEEeCCCccccEEEEEEEEeCCCCCe
Confidence            34577777777777888887765444433


No 141
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=98.67  E-value=1e-07  Score=55.58  Aligned_cols=60  Identities=22%  Similarity=0.375  Sum_probs=37.5

Q ss_pred             eCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEcc
Q psy5838          31 VGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVN  110 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~  110 (215)
                      +|++++|.|.+.+.+.+.       +.|++++ ..+.          .......   ....|.|.+++..|+|.|+|.+.
T Consensus         1 ~g~~~~l~C~~~~~~~~~-------v~W~~~~-~~~~----------~~~~~~~---~~~~L~i~~~~~~d~G~Y~C~~~   59 (63)
T smart00408        1 EGQSVTLTCPAEGDPVPN-------ITWLKDG-KPLP----------ESNRLSA---SGSTLTIKSVSLEDSGEYTCVAE   59 (63)
T ss_pred             CCceEEEEeeCccCCCCe-------EEEEECC-EECC----------CCCEEec---CCcEEEEeeCCcccCEEEEEEEe
Confidence            488999999987666666       9999943 3221          1111111   23367777777777777777664


Q ss_pred             C
Q psy5838         111 T  111 (215)
Q Consensus       111 ~  111 (215)
                      +
T Consensus        60 n   60 (63)
T smart00408       60 N   60 (63)
T ss_pred             c
Confidence            4


No 142
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=98.66  E-value=6.2e-08  Score=61.63  Aligned_cols=32  Identities=9%  Similarity=0.090  Sum_probs=23.1

Q ss_pred             ceEEEeCCcEEEEEEeecc-----CCccceeeeEEEEEEecCCcc
Q psy5838          26 NVTVTVGRDALLACVVDNL-----KGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        26 ~~~~~~G~~v~L~C~~~~~-----~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      ...+.+|.++.|.|...+.     +.+.       +.|+|+ +.+
T Consensus         4 ~~~~~~g~~~~l~Cp~~~~~~~~~~~p~-------i~Wyk~-~~~   40 (92)
T cd05757           4 KQILFSTKGGKIVCPDLDDFKNENTLPP-------VQWYKD-CKL   40 (92)
T ss_pred             eEEEeeccCCEEECCChHHccCCCCCCc-------EEEeEC-CEE
Confidence            4567899999999987543     2344       999994 443


No 143
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=98.63  E-value=1.2e-07  Score=58.32  Aligned_cols=21  Identities=14%  Similarity=0.343  Sum_probs=18.4

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +.|.|.+.|.|.|.       +.|+|++
T Consensus         1 ~~l~C~~~G~P~P~-------v~W~k~g   21 (77)
T cd05875           1 IIIECEAKGNPVPT-------FQWTRNG   21 (77)
T ss_pred             CEEEEeccccCCCE-------EEEEECC
Confidence            47999999999998       9999943


No 144
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=98.63  E-value=1.7e-07  Score=58.94  Aligned_cols=27  Identities=15%  Similarity=0.367  Sum_probs=18.8

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      |++++|.|.+.+.+.+. .    .+.|.+.++
T Consensus         1 Ge~~~L~C~~~~~~~~~-~----~~~W~~p~~   27 (86)
T cd05862           1 GEKLVLNCTARTELNVG-I----DFQWDYPGK   27 (86)
T ss_pred             CCcEEEEEEEEeCCCCc-E----EEEEEcCCc
Confidence            78999999998654332 1    178987543


No 145
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=98.63  E-value=1.5e-07  Score=69.98  Aligned_cols=68  Identities=26%  Similarity=0.501  Sum_probs=39.4

Q ss_pred             CCceEEEeCCcEEEEEEeecc-----CCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccce
Q psy5838          24 IPNVTVTVGRDALLACVVDNL-----KGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQ   98 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~-----~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~   98 (215)
                      +....+.+|+++.|.|...+.     +.+.       +.|+| ++..+.        .+.++.+..   ..+.|.|.+++
T Consensus       136 ~~~~~~~~G~~v~L~C~~~~~~~~~~p~p~-------I~WyK-ng~~l~--------~~~r~~~~~---~~~~L~I~~V~  196 (227)
T PHA02826        136 TINYQFNSGKDSKLHCYGTDGISSTFKDYT-------LTWYK-NGNIVL--------YTDRIQLRN---NNSTLVIKSAT  196 (227)
T ss_pred             CccceEecCCCEEEEeeCCCCccccCCCce-------EEEEE-CCEECC--------CCCCEEEeC---CCCEEEECcCC
Confidence            345667889999999997632     3455       99999 555431        223333321   12255655555


Q ss_pred             ecCCEEEEEEcc
Q psy5838          99 ESDRGWYMCQVN  110 (215)
Q Consensus        99 ~~d~G~Y~C~~~  110 (215)
                      .+|+|.|+|.+.
T Consensus       197 ~~DsG~YtC~a~  208 (227)
T PHA02826        197 HDDSGIYTCNLR  208 (227)
T ss_pred             HHhCEEEEEEEE
Confidence            555555555443


No 146
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=98.63  E-value=1.2e-06  Score=56.02  Aligned_cols=35  Identities=31%  Similarity=0.489  Sum_probs=23.8

Q ss_pred             eEEEEEcccCCCCCeEEEEEeecCCCcceeeEEEE
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNTDPMRSRQGYLQV  158 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~~~~l~v  158 (215)
                      +.+|.|.+++.+|.|.|+|.+...+.......+.|
T Consensus        59 d~sI~i~nvt~~D~G~Y~C~~~t~P~g~~~~~i~~   93 (96)
T cd05889          59 DMSLSFNNATEEDVGLYCCSLVTYPQGSWEKVIEV   93 (96)
T ss_pred             ccEEEEcCCCcccCEEEEEEEEeCCCCCeEEEEEE
Confidence            34577788888888888888766555555555544


No 147
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=98.61  E-value=2.1e-07  Score=58.99  Aligned_cols=58  Identities=22%  Similarity=0.370  Sum_probs=44.6

Q ss_pred             CCEEEEEEccCCCceEEEEccC-----------------------------CeEEEEEcccCCCCCeEEEEEeec-CCCc
Q psy5838         101 DRGWYMCQVNTNPRISLTYNDH-----------------------------RSWFLNIKNVQESDRGWYMCQVNT-DPMR  150 (215)
Q Consensus       101 d~G~Y~C~~~~~~~~~~~~~~~-----------------------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~  150 (215)
                      +...+.|.+.+.|.+.+.|...                             ....|.|.+++.+|+|.|+|.|.+ .+..
T Consensus         2 ~~v~l~C~v~g~P~P~i~W~k~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~~   81 (90)
T cd04974           2 SDVEFHCKVYSDAQPHIQWLKHVEVNGSKYGPDGLPYVTVLKVAGINTTDNESEVLYLRNVSFDDAGEYTCLAGNSIGPS   81 (90)
T ss_pred             CcEEEEEEEeCCCCCeEEEEEecccCCceeCCCCCceEEEEEecCCcccccccceEEEeccccccCcEEEEEeecccCcc
Confidence            3467899999999999999531                             013588999999999999999976 4555


Q ss_pred             ceeeEEEE
Q psy5838         151 SRQGYLQV  158 (215)
Q Consensus       151 ~~~~~l~v  158 (215)
                      ...+.|.|
T Consensus        82 ~~sa~L~V   89 (90)
T cd04974          82 HHSAWLTV   89 (90)
T ss_pred             cCCEEEEe
Confidence            66666665


No 148
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=98.61  E-value=2.7e-07  Score=60.57  Aligned_cols=23  Identities=30%  Similarity=0.423  Sum_probs=17.7

Q ss_pred             eEEEEEcccCCCCCeEEEEEeec
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      +.+|+|.+++.+|+|.|.|.+..
T Consensus        71 ~asL~i~nv~~~D~G~Y~C~v~~   93 (110)
T cd05902          71 NASLVLSRLRYSDSGTYRCEVVL   93 (110)
T ss_pred             eEEEEECCCCHHHCEEEEEEEEE
Confidence            45677888888888888888764


No 149
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=98.60  E-value=1.9e-07  Score=59.37  Aligned_cols=73  Identities=15%  Similarity=0.185  Sum_probs=39.8

Q ss_pred             CCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEcc
Q psy5838          17 MPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKN   96 (215)
Q Consensus        17 ~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~   96 (215)
                      .|.+...|. ..+..|+.|+|.|.... +...       +.|+|+ +.....            .........+.+.|.+
T Consensus         2 kP~L~a~p~-~vV~~G~~VtL~C~~~~-~~~~-------f~l~k~-g~~~~~------------~~~~~~~~~~~f~i~~   59 (91)
T cd05751           2 KPSLWAEPS-SVVPLGKPVTLRCQGPY-GAVE-------YRLYRE-GSTFAV------------KKPPEPQNKAKFFIPS   59 (91)
T ss_pred             CCEEEecCC-CccCCCCcEEEEEecCC-CCCE-------EEEEEC-CCCccc------------cccCCCceeEEEEccC
Confidence            455555553 46779999999998753 2333       788884 332100            0001112334566666


Q ss_pred             ceecCCEEEEEEccC
Q psy5838          97 VQESDRGWYMCQVNT  111 (215)
Q Consensus        97 ~~~~d~G~Y~C~~~~  111 (215)
                      ++.+|+|.|+|...+
T Consensus        60 v~~~~~G~Y~C~~~~   74 (91)
T cd05751          60 MKREHAGRYRCYYRS   74 (91)
T ss_pred             CChhHCEEEEEEEEC
Confidence            666666666665543


No 150
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=98.59  E-value=2.3e-06  Score=56.49  Aligned_cols=35  Identities=29%  Similarity=0.334  Sum_probs=21.9

Q ss_pred             eEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEEE
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQV  158 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v  158 (215)
                      +.+|+|.+++.+|+|.|.|.+... ......+.|+|
T Consensus        78 ~asL~i~~v~~sD~G~Y~C~V~~g~~~~~~~v~L~V  113 (117)
T cd05901          78 DASLTIVKLRASDAGVYRCEVMHGIEDTQDTVSLDV  113 (117)
T ss_pred             ceEEEEcccccccCEEEEEEEEECCcccEEEEEEEE
Confidence            356778888888888888887543 22333344444


No 151
>smart00406 IGv Immunoglobulin V-Type.
Probab=98.58  E-value=5.5e-07  Score=55.62  Aligned_cols=70  Identities=21%  Similarity=0.386  Sum_probs=37.0

Q ss_pred             cEEEEEEeeccCCccceeeeEEEEEEecCC-cc--EEEee---ecee---eeCCceEEEEcC-CceEEEEEccceecCCE
Q psy5838          34 DALLACVVDNLKGFKGLRIGWQVAWVRVDT-QT--ILSIH---HNVI---TQNPRISLTYND-HRSWFLNIKNVQESDRG  103 (215)
Q Consensus        34 ~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~-~~--~~~~~---~~~~---~~~~~~~~~~~~-~~~~~l~i~~~~~~d~G  103 (215)
                      +|+|.|.+...... ..    .+.|++... ..  ++...   ....   ...+|+.+.... ....+|.|.+++.+|+|
T Consensus         1 ~v~l~C~~~~~~~~-~~----~v~W~~~~~~~~~~~l~~~~~~~~~~~~~~~~~R~~~~~~~~~~~~~L~i~~~~~~D~G   75 (81)
T smart00406        1 SVTLSCKASGFTFS-SY----YVSWVRQPPGKGLEWLGYIGSSGSTYYQQSYKGRVTISKDTSKNDVSLTISNLRVEDTG   75 (81)
T ss_pred             CEEEEEEEeccccc-ee----EEEEEEeCCCCCeEEEEEEcCCCcEEECcccCCcEEEEecCcCCEEEEEEcCCCHHHCE
Confidence            47899999865543 11    189998642 11  11111   1111   123455554442 34566666666666666


Q ss_pred             EEEEE
Q psy5838         104 WYMCQ  108 (215)
Q Consensus       104 ~Y~C~  108 (215)
                      .|.|.
T Consensus        76 ~Y~C~   80 (81)
T smart00406       76 TYYCA   80 (81)
T ss_pred             EEEEc
Confidence            66664


No 152
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=98.57  E-value=2.9e-07  Score=56.20  Aligned_cols=54  Identities=24%  Similarity=0.411  Sum_probs=39.7

Q ss_pred             EEEEEccCCCceEEEEccC------------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEE
Q psy5838         104 WYMCQVNTNPRISLTYNDH------------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQ  157 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~------------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~  157 (215)
                      ...|.+.+.|.+.+.|...                  ....|.|.+++.+|+|.|+|.+.+ .+.....+.|.
T Consensus         2 ~l~C~v~G~P~P~i~W~k~~~~i~~~~~r~~~~~~~~g~~~L~I~~~~~~D~G~Y~C~A~N~~G~~~~~a~L~   74 (75)
T cd05892           2 KLECQISAIPPPKIFWKRNNEMVQYNTDRISLYQDNSGRVTLLIKNVNKKDAGWYTVSAVNEAGVATCHARLD   74 (75)
T ss_pred             EEEEEEEecCCCeEEEEECCEECcCCCCeEEEEEcCCCcEEEEECCCChhhCEEEEEEEEcCcCeEEEEEEEe
Confidence            3579999999999998321                  112699999999999999999976 34444444444


No 153
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=98.53  E-value=3e-07  Score=58.99  Aligned_cols=17  Identities=18%  Similarity=0.407  Sum_probs=14.7

Q ss_pred             CceEEEeCCcEEEEEEe
Q psy5838          25 PNVTVTVGRDALLACVV   41 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~   41 (215)
                      ....+.+|++|.|.|..
T Consensus         8 ~~~~~~~GE~v~l~C~~   24 (104)
T cd05896           8 KKYMVLAGEPVRIKCAL   24 (104)
T ss_pred             eeEEEcCCCeEEEECCC
Confidence            45778899999999996


No 154
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=98.52  E-value=3.9e-07  Score=58.25  Aligned_cols=36  Identities=17%  Similarity=0.231  Sum_probs=24.4

Q ss_pred             CcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          18 PHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        18 p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |.+...+ ...+..|++|+|.|.... ....       +.|+|++
T Consensus         2 P~l~a~p-~~vV~~G~~VTL~C~~~~-~~~~-------f~l~k~g   37 (94)
T cd05711           2 PFLSAHP-SPVVPSGENVTLQCHSDI-RFDR-------FILYKEG   37 (94)
T ss_pred             CEEEecC-CCccCCCCeEEEEEecCC-CCCE-------EEEEECC
Confidence            4444433 556779999999998764 2233       8899954


No 155
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.51  E-value=4.9e-07  Score=54.90  Aligned_cols=56  Identities=21%  Similarity=0.393  Sum_probs=41.7

Q ss_pred             CEEEEEEccCCCceEEEEccC-------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEE
Q psy5838         102 RGWYMCQVNTNPRISLTYNDH-------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQ  157 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~~-------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~  157 (215)
                      .-.+.|.+.+.|.+.+.|...             .+..|.|.+++.+|+|.|+|.+.+. +.....+.|.
T Consensus         3 ~~~l~C~~~g~P~p~v~W~k~~~~l~~~~r~~~~~~g~L~I~~v~~~D~G~Y~C~A~N~~G~~~~~~~l~   72 (73)
T cd05852           3 RVIIECKPKAAPKPKFSWSKGTELLVNNSRISIWDDGSLEILNITKLDEGSYTCFAENNRGKANSTGVLS   72 (73)
T ss_pred             eEEEEEecceeCCCEEEEEeCCEecccCCCEEEcCCCEEEECcCChhHCEEEEEEEECCCCceeEEEEEE
Confidence            346789999999989888431             2346999999999999999999763 4444444443


No 156
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.50  E-value=4.2e-07  Score=55.36  Aligned_cols=57  Identities=21%  Similarity=0.311  Sum_probs=42.7

Q ss_pred             CCEEEEEEccCCCceEEEEccC-------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEE
Q psy5838         101 DRGWYMCQVNTNPRISLTYNDH-------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQ  157 (215)
Q Consensus       101 d~G~Y~C~~~~~~~~~~~~~~~-------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~  157 (215)
                      ++-...|.+.+.|.+.+.|...             ....|.|.+++.+|+|.|+|.+.+. +.....+.|.
T Consensus         3 ~~v~l~C~~~g~P~p~i~W~k~g~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~~~~~~~L~   73 (74)
T cd05745           3 QTVDFLCEAQGYPQPVIAWTKGGSQLSVDRRHLVLSSGTLRISRVALHDQGQYECQAVNIVGSQRTVAQLT   73 (74)
T ss_pred             CeEEEEeECCEecCCEEEEEECCEECCCCCCeEEccCCeEEEeeCCHHhCEEEEEEEEeCCCceeEEEEEe
Confidence            4457789999999999999421             2346999999999999999999763 4444444443


No 157
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=98.49  E-value=4.9e-07  Score=55.21  Aligned_cols=54  Identities=20%  Similarity=0.399  Sum_probs=39.8

Q ss_pred             EEEEEccCCCceEEEEccC------------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEE
Q psy5838         104 WYMCQVNTNPRISLTYNDH------------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQ  157 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~------------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~  157 (215)
                      .+.|.+.|.|.+.+.|...                  ....|.|.+++.+|+|.|+|.|.+. +..+..+.|.
T Consensus         2 ~l~C~v~G~P~P~v~W~k~~~~l~~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~~~~~a~L~   74 (75)
T cd05893           2 RLECRVSGVPHPQIFWKKENESLTHNTDRVSMHQDNCGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLD   74 (75)
T ss_pred             EEEEEEeEecCCEEEEEECCEECCCCCCeEEEEEcCCCEEEEEECCCCHHHCEEEEEEEEcCCCEEEEEEEEe
Confidence            4679999999999999431                  0125889999999999999999763 4444444444


No 158
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=98.49  E-value=7.3e-07  Score=54.83  Aligned_cols=58  Identities=29%  Similarity=0.426  Sum_probs=38.6

Q ss_pred             eEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEE
Q psy5838          27 VTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYM  106 (215)
Q Consensus        27 ~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~  106 (215)
                      ..+.+|++++|.|.+.+.+...       +.|+++ +..+..               .   .+ .+.+.++..+|+|.|+
T Consensus         9 ~~v~~g~~~~l~C~~~~~p~~~-------~~w~~~-~~~~~~---------------~---~~-~~~~~~~~~~~~g~y~   61 (80)
T PF13895_consen    9 QSVEEGDSVTLTCSVSGNPPPQ-------VQWYKN-GSPINS---------------S---QN-GLFIPNVSPEDSGNYT   61 (80)
T ss_dssp             SEEETTSEEEEEEEEESSSSSE-------EEEEET-TEEEEE---------------E---SS-EEEESSEEGGGTEEEE
T ss_pred             eEEeCCCcEEEEEEEEccccee-------eeeeee-eeeeee---------------e---ee-eeeeeeeccccCEEEE
Confidence            5688999999999999776665       999994 332210               0   01 2566666666666666


Q ss_pred             EEccC
Q psy5838         107 CQVNT  111 (215)
Q Consensus       107 C~~~~  111 (215)
                      |.+.+
T Consensus        62 C~~~~   66 (80)
T PF13895_consen   62 CRASN   66 (80)
T ss_dssp             EEEEE
T ss_pred             EEEEe
Confidence            66544


No 159
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.46  E-value=1.3e-06  Score=56.31  Aligned_cols=59  Identities=25%  Similarity=0.417  Sum_probs=44.3

Q ss_pred             ecCCEEEEEEccCCCceEEEEccC-----------------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceee
Q psy5838          99 ESDRGWYMCQVNTNPRISLTYNDH-----------------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQG  154 (215)
Q Consensus        99 ~~d~G~Y~C~~~~~~~~~~~~~~~-----------------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~  154 (215)
                      ..+.....|.+.+.|.+.+.|...                       ....|.|.+++.+|+|.|+|.+.+. +.....+
T Consensus        15 ~G~~v~l~C~~~G~P~p~i~W~k~~~g~~~~~~~~~~~~r~~v~~~~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~~~~~~   94 (98)
T cd05870          15 ENGAATLSCKAEGEPIPEITWKRASDGHTFSEGDKSPDGRIEVKGQHGESSLHIKDVKLSDSGRYDCEAASRIGGHQKSM   94 (98)
T ss_pred             CCCcEEEEEecccCCCCeEEEEECCCCceeccCCcCcCceEEEeecCCeeEEEEeeCCcCCCEEEEEEEeccCCcceeEE
Confidence            466778899999999988888431                       1246899999999999999999763 4445555


Q ss_pred             EEE
Q psy5838         155 YLQ  157 (215)
Q Consensus       155 ~l~  157 (215)
                      .|.
T Consensus        95 ~l~   97 (98)
T cd05870          95 YLD   97 (98)
T ss_pred             EEe
Confidence            554


No 160
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=98.46  E-value=1.3e-06  Score=54.84  Aligned_cols=58  Identities=12%  Similarity=0.181  Sum_probs=42.8

Q ss_pred             cCCEEEEEEccCCCceEEEEccC-----------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEE
Q psy5838         100 SDRGWYMCQVNTNPRISLTYNDH-----------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQ  157 (215)
Q Consensus       100 ~d~G~Y~C~~~~~~~~~~~~~~~-----------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~  157 (215)
                      .+.-...|.+.+.|.+.+.|...                 ....|.|.++..+|+|.|+|.+.+. +.....+.|.
T Consensus        10 G~~v~l~c~~~G~P~P~v~W~k~~~~i~~~~~r~~~~~~~~~~~L~I~~~~~~D~G~Y~c~a~N~~G~~~~~~~l~   85 (86)
T cd05894          10 GNKLRLDVPISGEPAPTVTWSRGDKAFTETEGRVRVESYKDLSSFVIEGAEREDEGVYTITVTNPVGEDHASLFVK   85 (86)
T ss_pred             CCEEEEEeeEeecCCCeEEEEECCEECccCCCeEEEEEcCCeEEEEECCCccCcCEEEEEEEEeCCCcEEEEEEEE
Confidence            44567789999999999999321                 1356999999999999999999763 4444444443


No 161
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.46  E-value=5.9e-07  Score=54.03  Aligned_cols=55  Identities=18%  Similarity=0.230  Sum_probs=41.0

Q ss_pred             EEEEEccCCCceEEEEccC-----------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEEE
Q psy5838         104 WYMCQVNTNPRISLTYNDH-----------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQV  158 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~-----------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v  158 (215)
                      .+.|.+.+.|.+.+.|...           ....|.|.++..+|+|.|+|.+.+. +......++.+
T Consensus         2 ~~~c~v~G~P~P~v~W~k~g~~l~~~~~~~~~~~L~I~~v~~~D~G~YtC~a~N~~G~~~~~~t~~l   68 (70)
T cd05864           2 KIPVKYYGYPPPEVKWYKNGQLIVLNHTFKRGVHLTIYEVTEKDAGNYTVVLTNPITKEEQRHTFQL   68 (70)
T ss_pred             EEEeEEEEeCCCEEEEEECCEECCCCCEEccCCEEEECcCCHHHCEEEEEEEEECCCceeeEEEEEE
Confidence            4679999999999999432           1346999999999999999999764 44444444444


No 162
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=98.45  E-value=1.2e-06  Score=54.79  Aligned_cols=61  Identities=23%  Similarity=0.411  Sum_probs=45.1

Q ss_pred             ceecCCEEEEEEccCCCceEEEEccC-----------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEE
Q psy5838          97 VQESDRGWYMCQVNTNPRISLTYNDH-----------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQ  157 (215)
Q Consensus        97 ~~~~d~G~Y~C~~~~~~~~~~~~~~~-----------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~  157 (215)
                      +...+.....|.+.+.|.+.+.|...                 ..+.|.|.++..+|+|.|+|.+.+ .+.....+.|.
T Consensus         6 v~~G~~~~L~C~~~g~P~p~i~W~k~g~~l~~~~~~~~~~~~~~~~~l~i~~~~~~D~G~Y~C~a~N~~G~~~~~~~l~   84 (85)
T cd05857           6 VPAANTVKFRCPAAGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSINHTYHLD   84 (85)
T ss_pred             cCCCCEEEEEEEcCCCCCCEEEEEECCEECCCCCceeeeEEeCCceEEEEccCCcccCEEEEEEEEeCCCEEEEEEEEE
Confidence            44566678899999999999999321                 134688999999999999999976 34444444444


No 163
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=98.45  E-value=3.7e-07  Score=55.37  Aligned_cols=72  Identities=25%  Similarity=0.423  Sum_probs=41.4

Q ss_pred             CcccCCCCceEEEeCCcEEEEEEeeccC-CccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEcc
Q psy5838          18 PHFAEPIPNVTVTVGRDALLACVVDNLK-GFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKN   96 (215)
Q Consensus        18 p~~~~~~~~~~~~~G~~v~L~C~~~~~~-~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~   96 (215)
                      |.+...+.......+. +.|.|.+.+.+ .+.       +.|+. ......        ..    ..........|.|.+
T Consensus         2 P~I~~~~~~~~~~~~~-~~l~C~~~~~~~~~~-------~~W~~-~~~~~~--------~~----~~~~~~~~~~L~i~~   60 (75)
T PF13927_consen    2 PQISVPPPPVVTSGGS-VTLTCSAEGGPPPPS-------ISWYD-SNPSFN--------SN----SRGSSSSNSTLTISN   60 (75)
T ss_dssp             SEEEEESTSEEETTEE-EEEEEEESSEESSEE-------EEEET-EEEEEE--------EE----EEEEEEEEEEEEESS
T ss_pred             CEEEEcCCCcEeecee-EEEEEEEccccCCeE-------EEEEe-cCCcee--------ee----eeeccceeeEEEEcc
Confidence            5555555555554444 99999999876 444       88981 111000        00    001111344777778


Q ss_pred             ceecCCEEEEEEcc
Q psy5838          97 VQESDRGWYMCQVN  110 (215)
Q Consensus        97 ~~~~d~G~Y~C~~~  110 (215)
                      +..+|.|.|+|.|.
T Consensus        61 v~~~~~g~y~C~a~   74 (75)
T PF13927_consen   61 VTRSDNGTYTCIAS   74 (75)
T ss_dssp             CCGGGTEEEEEEEE
T ss_pred             CCHHhCcEEEEEEE
Confidence            88888888888764


No 164
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=98.44  E-value=2.3e-06  Score=54.87  Aligned_cols=61  Identities=20%  Similarity=0.388  Sum_probs=44.5

Q ss_pred             eecCCEEEEEEccCCCc-eEEEEcc--CC-----------------eEEEEEcccCCCCCeEEEEEeecC--CCcceeeE
Q psy5838          98 QESDRGWYMCQVNTNPR-ISLTYND--HR-----------------SWFLNIKNVQESDRGWYMCQVNTD--PMRSRQGY  155 (215)
Q Consensus        98 ~~~d~G~Y~C~~~~~~~-~~~~~~~--~~-----------------~~~l~i~~~~~~d~G~Y~C~~~~~--~~~~~~~~  155 (215)
                      ...+.-.+.|.+.+.|. +.+.|..  ..                 ...|.|..++.+|+|.|+|.|.+.  +.....+.
T Consensus        13 ~~G~~v~l~C~v~G~P~~p~i~W~~~~g~~l~~~~~r~~v~~~~~~~~~L~I~~v~~~D~G~YtC~A~N~~~g~~~~s~~   92 (96)
T cd05865          13 SVGESKFFLCQVAGEAKDKDISWFSPNGEKLTPNQQRISVVRNDDYSSTLTIYNANIDDAGIYKCVVSNEDEGESEATVN   92 (96)
T ss_pred             CCCCeEEEEEEEeCCCCCCEEEEECCCCcCccccCCeEEEEeCCCCceEEEEeccChhhCEEEEEEEEcCCCCcEEEEEE
Confidence            34667789999999984 6999943  10                 135899999999999999999874  34444444


Q ss_pred             EEE
Q psy5838         156 LQV  158 (215)
Q Consensus       156 l~v  158 (215)
                      |+|
T Consensus        93 l~v   95 (96)
T cd05865          93 VKI   95 (96)
T ss_pred             EEE
Confidence            443


No 165
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.44  E-value=8.3e-07  Score=54.38  Aligned_cols=57  Identities=21%  Similarity=0.392  Sum_probs=43.6

Q ss_pred             CEEEEEEccCCCceEEEEccC---------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEE
Q psy5838         102 RGWYMCQVNTNPRISLTYNDH---------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQV  158 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~~---------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v  158 (215)
                      ...+.|.+.+.|.+.++|...               ....|.|.+++.+|+|.|+|.+.+ .+.....+.|.|
T Consensus         3 ~~~l~C~a~G~P~P~i~W~k~g~~i~~~~~~~~~~~~~~~l~i~~v~~~D~G~Y~C~A~N~~G~~~~~~~l~v   75 (76)
T cd05868           3 DGTLICRANGNPKPSISWLTNGVPIEIAPTDPSRKVDGDTIIFSKVQERSSAVYQCNASNEYGYLLANAFVNV   75 (76)
T ss_pred             CEEEEEEeeEeCCCeEEEEECCEEccccCCCceEEecCCEEEECCCCHhhCEEEEEEEEcCCCEEEEEEEEEe
Confidence            467889999999999999421               113588999999999999999976 455566666655


No 166
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=98.43  E-value=1.7e-06  Score=55.32  Aligned_cols=59  Identities=27%  Similarity=0.435  Sum_probs=43.5

Q ss_pred             ecCCEEEEEEccCCCceEEEEccC-------------------------CeEEEEEcccCCCCCeEEEEEeecCCCccee
Q psy5838          99 ESDRGWYMCQVNTNPRISLTYNDH-------------------------RSWFLNIKNVQESDRGWYMCQVNTDPMRSRQ  153 (215)
Q Consensus        99 ~~d~G~Y~C~~~~~~~~~~~~~~~-------------------------~~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~~  153 (215)
                      ..++-.+.|.+.+.|.+.+.|...                         ..+.|.|.+++.+|+|.|+|.+.......+.
T Consensus        11 ~G~tv~L~C~v~g~~~~~v~W~k~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~L~I~nV~~~D~G~YtC~~~t~~~~~~~   90 (95)
T cd05882          11 VGGTVTLKCGVKEHDNSSLQWSNTAQQTLYFGEKRALRDNRIQLVKSTPTELIISISNVQLSDEGEYTCSIFTMPVRTAK   90 (95)
T ss_pred             cCCcEEEEEEEeCCCCCeEEEeccCccEEEeCCeEEEeCCeEEEEeCCCceEEEEECCCCcccCEEEEEEEEeeccccEE
Confidence            456667889988888888888221                         1367999999999999999999764444555


Q ss_pred             eEEE
Q psy5838         154 GYLQ  157 (215)
Q Consensus       154 ~~l~  157 (215)
                      .++.
T Consensus        91 ~~~~   94 (95)
T cd05882          91 ATVT   94 (95)
T ss_pred             EEEE
Confidence            4443


No 167
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=98.43  E-value=1.4e-06  Score=53.17  Aligned_cols=53  Identities=23%  Similarity=0.401  Sum_probs=38.2

Q ss_pred             EEEEccCCCceEEEEcc------------------CCeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEE
Q psy5838         105 YMCQVNTNPRISLTYND------------------HRSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQ  157 (215)
Q Consensus       105 Y~C~~~~~~~~~~~~~~------------------~~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~  157 (215)
                      ..|.+.+.|.+.+.|..                  .....|.|.+++.+|+|.|+|.+.+ .+.....+.|.
T Consensus         3 L~C~v~G~P~P~v~W~k~~~~i~~~~~r~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~~G~~~~~~~l~   74 (75)
T cd05744           3 LECRVSAIPPPQIFWKKNNEMLTYNTDRISLYQDNCGRICLLIQNANKEDAGWYTVSAVNEAGVVSCNARLD   74 (75)
T ss_pred             EEEEEeecCCCeEEEEECCEECCCCCCcEEEEEcCCCeEEEEECCCCcccCEEEEEEEEcCCCcEEEEEEEe
Confidence            56888888888888821                  1123599999999999999999976 34444444443


No 168
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.42  E-value=9.6e-07  Score=52.96  Aligned_cols=53  Identities=23%  Similarity=0.413  Sum_probs=39.5

Q ss_pred             EEEEEccCCCceEEEEccC------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEE
Q psy5838         104 WYMCQVNTNPRISLTYNDH------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYL  156 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l  156 (215)
                      ...|.+.+.|.+.+.|...            ....|.|.+++.+|+|.|+|.+.+. +.....+.|
T Consensus         2 ~l~C~~~g~P~p~v~W~k~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~a~N~~G~~~~~~~l   67 (69)
T cd05725           2 EFQCEVGGDPVPTVLWRKEDGELPKGRAEILDDKSLKIRNVTAGDEGSYTCEAENMVGKIEASASL   67 (69)
T ss_pred             EEEEECccCCCCEEEEEECCccCCCCcEEEeeCCEEEECcCChhHCEEEEEEEEcCCCcEEEEEEE
Confidence            3579999999999998432            1346999999999999999999763 433444444


No 169
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=98.41  E-value=1.4e-06  Score=55.19  Aligned_cols=57  Identities=21%  Similarity=0.395  Sum_probs=43.6

Q ss_pred             CEEEEEEccCCCceEEEEccC-----------------------------CeEEEEEcccCCCCCeEEEEEeec-CCCcc
Q psy5838         102 RGWYMCQVNTNPRISLTYNDH-----------------------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRS  151 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~~-----------------------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~  151 (215)
                      +....|.+.+.|.+.+.|...                             ....|.|.+++.+|+|.|+|.+.+ .+...
T Consensus         3 ~v~L~C~~~g~P~P~i~W~k~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~~~   82 (90)
T cd05858           3 TVEFVCKVYSDAQPHIQWLKHVEKNGSKYGPDGLPYVTVLKTAGVNTTDKEMEVLYLRNVTFEDAGEYTCLAGNSIGISH   82 (90)
T ss_pred             eEEEEEEEecCCCCEEEEEEecccCCcEeCCCCCeeEEEeccCCceecCCceeEEEEccCCHHHCEEEEEEEEeCCCccc
Confidence            456789999999888888531                             013699999999999999999965 45566


Q ss_pred             eeeEEEE
Q psy5838         152 RQGYLQV  158 (215)
Q Consensus       152 ~~~~l~v  158 (215)
                      ..+.|.|
T Consensus        83 ~~a~L~V   89 (90)
T cd05858          83 HSAWLTV   89 (90)
T ss_pred             ceEEEEE
Confidence            6666665


No 170
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=98.41  E-value=1.7e-06  Score=52.58  Aligned_cols=53  Identities=23%  Similarity=0.260  Sum_probs=38.7

Q ss_pred             EEEEEccCCCceEEEEccC----------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEE
Q psy5838         104 WYMCQVNTNPRISLTYNDH----------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYL  156 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~----------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l  156 (215)
                      ...|.+.+.|.+.+.|...                ....|.|.++..+|+|.|+|.+.+. +.....+.|
T Consensus         3 ~l~c~~~G~P~p~v~W~k~g~~l~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~~G~~~~~~~l   72 (74)
T cd05748           3 RLEVPISGRPTPTVTWSKDGKPLKLSGRVQIETTASSTSLVIKNAERSDSGKYTLTLKNPAGEKSATINV   72 (74)
T ss_pred             EEEeeEeeeCCCeEEEEECCEEcCCCCeEEEEECCCeEEEEECCCCcCcCEEEEEEEECCCccEEEEEEE
Confidence            3568888888888888321                2356999999999999999999763 444444444


No 171
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=98.41  E-value=2.2e-06  Score=55.12  Aligned_cols=58  Identities=26%  Similarity=0.426  Sum_probs=43.5

Q ss_pred             cCCEEEEEEccCCCceEEEEccC---------------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEE
Q psy5838         100 SDRGWYMCQVNTNPRISLTYNDH---------------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQ  157 (215)
Q Consensus       100 ~d~G~Y~C~~~~~~~~~~~~~~~---------------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~  157 (215)
                      .+.-...|.+.+.|.+.++|...                     ....|.|.+++.+|+|.|+|.+.+ .+.....+.|.
T Consensus        17 g~~v~l~C~~~G~P~P~v~W~~~~~~~~~~~~~~~~~~~v~~~~~~~~L~I~~v~~~D~G~Y~C~A~N~~G~~~~~~~l~   96 (97)
T cd05869          17 EEQITLTCEASGDPIPSITWRTSTRNISSEEKTLDGHIVVRSHARVSSLTLKYIQYTDAGEYLCTASNTIGQDSQSMYLE   96 (97)
T ss_pred             CCCEEEEEEeeEeCCCEEEEEECCccccCCccccCccEEEEcCccEEEEEEecCccCcCEEEEEEEecCCCCeeEEEEEE
Confidence            46678899999999999988321                     114688999999999999999976 34445555554


No 172
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.40  E-value=1.7e-06  Score=52.81  Aligned_cols=55  Identities=20%  Similarity=0.331  Sum_probs=40.5

Q ss_pred             EEEEEccCCCceEEEEccC-----------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEE
Q psy5838         104 WYMCQVNTNPRISLTYNDH-----------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQV  158 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~-----------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v  158 (215)
                      ...|.+.+.|.+.++|...                 ....|.|.+++.+|+|.|+|.+.+ .+.....+.|.|
T Consensus         2 ~l~C~~~G~P~P~v~W~k~~~~~~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~A~N~~G~~~~~~~l~V   74 (75)
T cd05763           2 RLECAATGHPTPQIAWQKDGGTDFPAARERRMHVMPEDDVFFIVDVKIEDTGVYSCTAQNTAGSISANATLTV   74 (75)
T ss_pred             EeEeecccccCCEEEEEeCCCccCCcccccceEEecCCCEEEEeeCCcccCEEEEEEEEcCCCEEEeeEEEEE
Confidence            3579999999988888321                 124589999999999999999976 344455555554


No 173
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.39  E-value=1.6e-06  Score=54.74  Aligned_cols=60  Identities=23%  Similarity=0.349  Sum_probs=45.1

Q ss_pred             ecCCEEEEEEccCCCceEEEEccC------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEE
Q psy5838          99 ESDRGWYMCQVNTNPRISLTYNDH------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQV  158 (215)
Q Consensus        99 ~~d~G~Y~C~~~~~~~~~~~~~~~------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v  158 (215)
                      ..+.....|.+.+.|.+.+.|...            .+..|.|.+++.+|+|.|.|.+.+ .+.....+.|.|
T Consensus        15 ~g~~v~l~C~~~g~P~p~v~W~k~~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~a~N~~G~~~~~~~l~V   87 (88)
T cd04968          15 KGQNVTLECFALGNPVPQIKWRKVDGSMPSSAEISMSGAVLKIPNIQFEDEGTYECEAENIKGKDTHQGRIYV   87 (88)
T ss_pred             CCCcEEEEEEeeEeCCCEEEEEECCCcCCCccEEEEeCCEEEECCCCcccCEEEEEEEEECCCcEEEEEEEEE
Confidence            466678899999999989998331            235689999999999999999976 344444455544


No 174
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.37  E-value=8.6e-07  Score=53.53  Aligned_cols=53  Identities=21%  Similarity=0.463  Sum_probs=38.7

Q ss_pred             EEEEEccCCCceEEEEccC-------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEE
Q psy5838         104 WYMCQVNTNPRISLTYNDH-------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYL  156 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~-------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l  156 (215)
                      .+.|.+.+.|.+.++|...             ....|.|.+++.+|+|.|+|.|.+. +.....+.|
T Consensus         3 ~l~C~~~G~P~p~v~W~k~g~~~~~~~~~~~~~~~~l~i~~v~~~D~G~Y~C~A~N~~G~~~~~~~L   69 (71)
T cd05723           3 IFECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNVQASAQL   69 (71)
T ss_pred             EEEEEEEEeCCCEEEEEECCeECCCCCCEEEEecCCEEEEcCCcccCEEEEEEEEcCCCEEEEEEEE
Confidence            5689999999999999431             1223778899999999999999763 444444444


No 175
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=98.37  E-value=2.7e-06  Score=54.13  Aligned_cols=58  Identities=21%  Similarity=0.180  Sum_probs=42.2

Q ss_pred             ecCCEEEEEEccCCCceEEEEcc-----------------CCeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEE
Q psy5838          99 ESDRGWYMCQVNTNPRISLTYND-----------------HRSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYL  156 (215)
Q Consensus        99 ~~d~G~Y~C~~~~~~~~~~~~~~-----------------~~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l  156 (215)
                      ..++-...|.+.+.|.+.+.|..                 .....|.|.+++.+|+|.|+|.+.+ .+.....+.+
T Consensus        15 ~G~~v~L~C~v~G~P~p~v~W~k~g~~l~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~a~N~~G~~~~~~~v   90 (92)
T cd05737          15 EGKTLNLTCTVFGDPDPEVSWLKNDQALALSDHYNVKVEQGKYASLTIKGVSSEDSGKYGIVVKNKYGGETVDVTV   90 (92)
T ss_pred             CCCcEEEEEEEEecCCCeEEEEECCEECccCCCEEEEEcCCCEEEEEEccCChhhCEEEEEEEEECCCcceEEEEE
Confidence            34556778999999988888832                 1134699999999999999999976 3444444444


No 176
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.36  E-value=2e-06  Score=52.49  Aligned_cols=57  Identities=21%  Similarity=0.360  Sum_probs=42.3

Q ss_pred             CEEEEEEccCCCceEEEEcc---------------CCeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEEE
Q psy5838         102 RGWYMCQVNTNPRISLTYND---------------HRSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQV  158 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~---------------~~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~v  158 (215)
                      .-.+.|.+.+.|.+.+.|..               .....|.|.+++.+|+|.|+|.+.+ .+.....+.|.|
T Consensus         3 ~~~l~C~~~g~P~p~i~W~~~g~~~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~A~N~~G~~~~~~~l~V   75 (76)
T cd04978           3 TGRLDCEAEGIPQPTITWRLNGVPIEELPPDPRRRVDGGTLILSNVQPNDTAVYQCNASNVHGYLLANAFVHV   75 (76)
T ss_pred             eEEEEEEceeeCCCEEEEEECCEECCCCCCcceEEccCCEEEECCCChhhCEEEEEEEEccCCeEEEeEEEEE
Confidence            45678999999988888832               1135589999999999999999976 344455555554


No 177
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=98.35  E-value=1.3e-06  Score=52.60  Aligned_cols=54  Identities=22%  Similarity=0.297  Sum_probs=39.0

Q ss_pred             EEEEccCCCceEEEEccC-------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEEE
Q psy5838         105 YMCQVNTNPRISLTYNDH-------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQV  158 (215)
Q Consensus       105 Y~C~~~~~~~~~~~~~~~-------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v  158 (215)
                      ..|.+.+.|.+.+.|...             ....|.|.+++.+|+|.|+|.+.+. +.....+.+.|
T Consensus         3 l~C~~~g~P~p~v~W~k~~~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~a~N~~G~~~~~~~l~V   70 (71)
T cd05731           3 LECIAEGLPTPEISWIKIGGELPADRTKFENFNKTLKIDNVSEEDDGEYRCTASNSLGSARHTISVTV   70 (71)
T ss_pred             EEEEeeEecCCeEEEEECCeECCCCceeEecCCCEEEECCCCHHHCEEEEEEEEeCCceEEEEEEEEE
Confidence            468888888888888421             2346999999999999999999763 44444444443


No 178
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=98.31  E-value=1.3e-05  Score=52.39  Aligned_cols=38  Identities=16%  Similarity=0.084  Sum_probs=28.0

Q ss_pred             CCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          23 PIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      .+....+..|+.+.|.|.+.+....+.+.    +.|+|+...
T Consensus         4 ~~~~~lv~p~~sv~LsC~~sg~~~s~e~~----~~wvRq~pg   41 (115)
T cd05721           4 QQSPVLASSNGAASLVCEYTYNGFSKEFR----ASLLKGADS   41 (115)
T ss_pred             ecCCeEEcCCCCEEEEEEecCCccccEEE----EEEEEeCCC
Confidence            34567888999999999998765544343    899997433


No 179
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=98.30  E-value=5.3e-06  Score=52.54  Aligned_cols=60  Identities=10%  Similarity=0.138  Sum_probs=44.4

Q ss_pred             eecCCEEEEEEccCCCceEEEEccC----------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEE
Q psy5838          98 QESDRGWYMCQVNTNPRISLTYNDH----------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQ  157 (215)
Q Consensus        98 ~~~d~G~Y~C~~~~~~~~~~~~~~~----------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~  157 (215)
                      ...+.-...|.+.+.|.+.+.|...                ....|.|.+++.+|.|.|+|.|.+. +.....+.|.
T Consensus        13 ~~G~~v~l~C~~~G~P~p~v~W~~~g~~~~~~~~~~~~~~~~~~~L~I~~v~~~D~g~Y~C~A~N~~G~~~~~~~L~   89 (90)
T cd04972          13 YEGGTATIRCTAEGSPLPKVEWIIAGLIVIQTRTDTLETTVDIYNLQLSNITSETQTTVTCTAENPVGQANVSVQVT   89 (90)
T ss_pred             cCCCcEEEEEEEEEcCCCeEEEEECCEEccCCccEEEEecCCEEEEEEecCCcccCEEEEEEEECCCCceeEEEEEe
Confidence            3456677899999999999999321                1346899999999999999999763 4444444443


No 180
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=98.29  E-value=5.6e-06  Score=53.00  Aligned_cols=59  Identities=25%  Similarity=0.398  Sum_probs=42.9

Q ss_pred             ecCCEEEEEEccCCCceEEEEccC---------------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEE
Q psy5838          99 ESDRGWYMCQVNTNPRISLTYNDH---------------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYL  156 (215)
Q Consensus        99 ~~d~G~Y~C~~~~~~~~~~~~~~~---------------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l  156 (215)
                      ..+.-...|.+.+.|.+.+.|...                     ....|.|.+++.+|+|.|+|.+.+ .+.....+.|
T Consensus        15 ~g~~v~l~C~~~g~p~p~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~a~N~~G~~~~s~~l   94 (96)
T cd05732          15 ELEQITLTCEAEGDPIPEITWRRATRNFSEGDKSLDGRIVVRGHARVSSLTLKDVQLTDAGRYDCEASNRIGGDQQSMYL   94 (96)
T ss_pred             cCCcEEEEEEEeEcCCCcEEEEECCcccCCCCccccceEEEeCCccEEEEEECcCCcCcCEEeEEEEEeCCCCcEEEEEE
Confidence            346677889999988888888321                     124689999999999999999976 3444444444


Q ss_pred             E
Q psy5838         157 Q  157 (215)
Q Consensus       157 ~  157 (215)
                      .
T Consensus        95 ~   95 (96)
T cd05732          95 E   95 (96)
T ss_pred             e
Confidence            3


No 181
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.29  E-value=3.3e-06  Score=52.07  Aligned_cols=43  Identities=30%  Similarity=0.611  Sum_probs=33.5

Q ss_pred             EEEEccCCCceEEEEccC---------------------CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838         105 YMCQVNTNPRISLTYNDH---------------------RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       105 Y~C~~~~~~~~~~~~~~~---------------------~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ..|.+.+.|.+.+.|...                     .+..|.|.++..+|+|.|.|.+.+.
T Consensus         3 l~C~~~G~P~P~v~W~~~~~~~~~~~~~~~~~~~r~~~~~~~~L~I~~v~~~D~G~Y~C~a~N~   66 (79)
T cd05734           3 LNCSAEGYPPPTIVWKHSKGRGHPQHTHTCCLAGRIQLLSNGSLLIKHVLEEDSGYYLCKVSND   66 (79)
T ss_pred             eEeeCeEeCCCEEEEEECCCccccccccccccCCCEEEecCCeEEECcCCcccCEEEEEEEEeC
Confidence            568888888888877321                     1345899999999999999999764


No 182
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=98.29  E-value=1e-05  Score=50.54  Aligned_cols=57  Identities=16%  Similarity=0.202  Sum_probs=39.8

Q ss_pred             CEEEEEEccCCCceEEEEccC--------------------CeEEEEEcccCCCCCeEEEEEeecCC---CcceeeEEEE
Q psy5838         102 RGWYMCQVNTNPRISLTYNDH--------------------RSWFLNIKNVQESDRGWYMCQVNTDP---MRSRQGYLQV  158 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~~--------------------~~~~l~i~~~~~~d~G~Y~C~~~~~~---~~~~~~~l~v  158 (215)
                      +-.+.|.+.+.|.+.+.|...                    ....|.|.+++.+|+|.|.|.+.+..   .....+.|+|
T Consensus         3 ~~~l~C~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~s~L~I~~~~~~DsG~Y~C~a~n~~~~~~~~~sv~i~V   82 (84)
T cd05861           3 TITVNCIVQGNEVVDFSWTYPGKDIGKGIPEVEEVKVPATTLRSTLTFPHATVEDSGTYECAAHESTQDQKAFKKVNITV   82 (84)
T ss_pred             cEEEEEEEECCCccEEEEEECCccCCCCceEEEEEecCCcEEEEEEEECCCCcCCCEEEEEEEEECccCcceeEEEEEEE
Confidence            446778888887777777321                    13469999999999999999997643   2334444444


No 183
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=98.29  E-value=2.4e-06  Score=53.92  Aligned_cols=59  Identities=29%  Similarity=0.379  Sum_probs=44.0

Q ss_pred             ecCCEEEEEEccCCCceEEEEcc----------------CCeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEE
Q psy5838          99 ESDRGWYMCQVNTNPRISLTYND----------------HRSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQ  157 (215)
Q Consensus        99 ~~d~G~Y~C~~~~~~~~~~~~~~----------------~~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~  157 (215)
                      ..+...+.|.+.+.|.+.+.|..                .....|.|.+++.+|+|.|+|.+.+. +.....+.|.
T Consensus        14 ~G~~~~l~c~~~~~p~~~v~W~~~~~~l~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~~~n~~g~~~~~~~l~   89 (90)
T PF07679_consen   14 EGESVTLECEVSGNPPPTVTWYKNGRPLTSSQRYQIESDGGSSSLTIKNVTREDAGTYTCVASNSSGEATASVNLT   89 (90)
T ss_dssp             TTSEEEEEEEEEESSSSEEEEEETTEEEESSSSEEEEEETTEEEEEESSESGGGSEEEEEEEEETTEEEEEEEEEE
T ss_pred             CCCEEEEEEEEEeCCCCcccccccccceeeeeeeeeecccceeEEccCCCChhhCEEEEEEEEECCCEEEEEEEEE
Confidence            45667889999998888888822                24677999999999999999999764 3333333343


No 184
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=98.29  E-value=4.9e-06  Score=52.80  Aligned_cols=61  Identities=21%  Similarity=0.363  Sum_probs=45.0

Q ss_pred             ceecCCEEEEEEccCCCceEEEEccC-------------CeEEEEEcccCCCCCeEEEEEeecCC--CcceeeEEEE
Q psy5838          97 VQESDRGWYMCQVNTNPRISLTYNDH-------------RSWFLNIKNVQESDRGWYMCQVNTDP--MRSRQGYLQV  158 (215)
Q Consensus        97 ~~~~d~G~Y~C~~~~~~~~~~~~~~~-------------~~~~l~i~~~~~~d~G~Y~C~~~~~~--~~~~~~~l~v  158 (215)
                      +...++....|.+.+. .+.+.|...             ....|.|.+++.+|+|.|.|.+.+..  ..+..+.|.|
T Consensus        15 v~~g~~v~l~C~a~g~-~p~i~W~kng~~l~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~a~N~~G~~~S~~~~L~V   90 (91)
T cd05740          15 PEDNQPVTLTCEAEGQ-ATYIWWVNNGSLLVPPRLQLSNDNRTLTFNNVTRSDTGHYQCEASNEVSNMTSDPYILNV   90 (91)
T ss_pred             cccCCcEEEEEEeCCC-CCEEEEEECCEECCCCCEEEeCCCCEEEECcCChhhCEEEEEEEEcCCCCEEeeeEEEEe
Confidence            3457778899999998 888888431             23469999999999999999997643  2344444544


No 185
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.29  E-value=3.2e-06  Score=51.27  Aligned_cols=55  Identities=24%  Similarity=0.360  Sum_probs=40.1

Q ss_pred             CEEEEEEccCCCceEEEEccC-------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEE
Q psy5838         102 RGWYMCQVNTNPRISLTYNDH-------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYL  156 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~~-------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l  156 (215)
                      +-...|.+.+.|.+.++|...             ....|.|.+++.+|+|.|+|.+.+. +.....+.|
T Consensus         3 ~v~L~C~~~g~P~p~v~W~k~~~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~a~N~~G~~~~~~~l   71 (73)
T cd04969           3 DVIIECKPKAAPKPTISWSKGTELLTNSSRICIWPDGSLEILNVTKSDEGKYTCFAENFFGKANSTGSL   71 (73)
T ss_pred             eEEEEEeeeEcCCCEEEEEECCEEcccCCCEEECCCCeEEEccCChhHCEEEEEEEECCCCceEEEEEE
Confidence            345679999888888888432             1346999999999999999999763 444444444


No 186
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.28  E-value=4.3e-06  Score=51.68  Aligned_cols=56  Identities=23%  Similarity=0.352  Sum_probs=40.3

Q ss_pred             CEEEEEEccCCCceEEEEccC---------------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEEE
Q psy5838         102 RGWYMCQVNTNPRISLTYNDH---------------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYLQ  157 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~~---------------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l~  157 (215)
                      .-.+.|.+.+.|.+.+.|...                     ....|.|.+++.+|+|.|+|.+.+ .+.....+.|.
T Consensus         3 ~v~l~C~~~g~P~p~v~W~k~~~~~~~~~~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~~G~~~~~~~l~   80 (81)
T cd05765           3 TASFHCDVTGRPPPEITWEKQVHGKENLIMRPNHVRGNVVVTNIGQLVIYNAQPQDAGLYTCTARNSGGLLRANFPLS   80 (81)
T ss_pred             cEEEEeeccccCCCcEEEEecCCCCcceeecCCcccCCEEEccccEEEEccCCcccCEEEEEEEecCCceEEEEEEEe
Confidence            346789999988888888432                     013589999999999999999976 34444444443


No 187
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=98.28  E-value=3.7e-06  Score=52.06  Aligned_cols=49  Identities=29%  Similarity=0.602  Sum_probs=38.6

Q ss_pred             ecCCEEEEEEccCCCceEEEEcc--------------CCeEEEEEcccCCCCCeEEEEEeecC
Q psy5838          99 ESDRGWYMCQVNTNPRISLTYND--------------HRSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus        99 ~~d~G~Y~C~~~~~~~~~~~~~~--------------~~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ..+.....|.+.+.|.+.+.|..              .....|.|.+++.+|+|.|+|.+.+.
T Consensus         8 ~G~~v~L~C~~~g~p~p~i~W~k~~~~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Y~C~a~N~   70 (82)
T cd05856           8 VGSSVRLKCVASGNPRPDITWLKDNKPLTPTEIGESRKKKWTLSLKNLKPEDSGKYTCHVSNR   70 (82)
T ss_pred             CCCeEEEEEEeeEeCCCcEEEEECCcCCcCCccceecCceEEEEEccCChhhCEEEEEEEEcC
Confidence            34566778999998888888832              12367999999999999999999763


No 188
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=98.26  E-value=4.1e-06  Score=51.51  Aligned_cols=51  Identities=16%  Similarity=0.156  Sum_probs=36.8

Q ss_pred             EEEccCCCceEEEEccC---------------------CeEEEEEcccCCCCCeEEEEEeec-CCCcceeeEE
Q psy5838         106 MCQVNTNPRISLTYNDH---------------------RSWFLNIKNVQESDRGWYMCQVNT-DPMRSRQGYL  156 (215)
Q Consensus       106 ~C~~~~~~~~~~~~~~~---------------------~~~~l~i~~~~~~d~G~Y~C~~~~-~~~~~~~~~l  156 (215)
                      .|.+.|.|.++++|...                     ....|.|..+..+|+|.|+|.|.+ .+...+.+.+
T Consensus         4 ~~~v~G~P~Pti~W~kng~~l~~~~~~~~~~~~~~~~~~~~~L~i~~~~~~D~G~YtC~A~N~~G~~~~~~~~   76 (79)
T cd05855           4 PFTVKGNPKPTLQWFHEGAILNESEYICTKIHVINNTEYHGCLQLDNPTHLNNGIYTLVAKNEYGEDEKNVSA   76 (79)
T ss_pred             EEEEeEeCCCceEEEECCEECCCCcceeeeeEeecccceEEEEEECCCCcccCEEEEEEEEcCCcccceEEEe
Confidence            57778888888888321                     124689999999999999999976 3444444443


No 189
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.26  E-value=4.5e-06  Score=50.73  Aligned_cols=47  Identities=17%  Similarity=0.339  Sum_probs=36.9

Q ss_pred             CCEEEEEEccCCCceEEEEcc-C-------------CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838         101 DRGWYMCQVNTNPRISLTYND-H-------------RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       101 d~G~Y~C~~~~~~~~~~~~~~-~-------------~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      +.-.+.|.+.+.|.+.+.|.. .             ....|.|..+..+|+|.|+|.+.+.
T Consensus         2 ~~~~l~C~~~g~P~p~v~W~~~~~~~~~~~~~~~~~~~~~L~i~~~~~~D~G~Y~C~a~N~   62 (74)
T cd05764           2 QRATLRCKARGDPEPAIHWISPDGKLISNSSRTLVYDNGTLDILITTVKDTGSFTCIASNA   62 (74)
T ss_pred             CeEEEEEEccCcCCCEEEEEeCCCEEecCCCeEEEecCCEEEEEECChhhCEEEEEEEECC
Confidence            345678999999999999842 1             1245889999999999999999763


No 190
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.24  E-value=3.2e-06  Score=50.67  Aligned_cols=43  Identities=26%  Similarity=0.574  Sum_probs=34.6

Q ss_pred             EEEEccCCCceEEEEccC-------------CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838         105 YMCQVNTNPRISLTYNDH-------------RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       105 Y~C~~~~~~~~~~~~~~~-------------~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ..|.+.+.|.+.+.|...             ....|.|.+++.+|+|.|+|.+.+.
T Consensus         3 L~C~~~g~P~p~i~W~k~g~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~   58 (69)
T cd05746           3 IPCSAQGDPEPTITWNKDGVQVTESGKFHISPEGYLAIRDVGVADQGRYECVARNT   58 (69)
T ss_pred             eEecceEeCCCEEEEEECCEECCCCCCEEECCCCEEEECcCChhhCEEEEEEEECC
Confidence            578999988888888321             2346999999999999999999763


No 191
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.24  E-value=8.7e-06  Score=51.74  Aligned_cols=50  Identities=22%  Similarity=0.432  Sum_probs=39.2

Q ss_pred             ceecCCEEEEEEccCCCceEEEEccC-----------------CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838          97 VQESDRGWYMCQVNTNPRISLTYNDH-----------------RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus        97 ~~~~d~G~Y~C~~~~~~~~~~~~~~~-----------------~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      +...++-.+.|.+.+.|. .+.|...                 ....|.|..+..+|+|.|+|.|.+.
T Consensus        12 v~~G~~v~l~C~~~G~P~-~v~W~k~~g~~~~~~~r~~~~~~g~~~~L~I~~v~~~D~G~Y~C~A~N~   78 (92)
T cd05866          12 LSVGESKFFTCTAIGEPE-SIDWYNPQGEKIVSSQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDA   78 (92)
T ss_pred             EcCCCeEEEEEEEEEeCC-eEEEEeCCCeEecCCCCEEEEeCCCeeEEEEecCChHHCEEEEEEEEcC
Confidence            345666788999999887 8888421                 1236999999999999999999774


No 192
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=98.23  E-value=1.2e-05  Score=51.11  Aligned_cols=50  Identities=22%  Similarity=0.476  Sum_probs=38.8

Q ss_pred             ceecCCEEEEEEccCCCceEEEEccC------------------CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838          97 VQESDRGWYMCQVNTNPRISLTYNDH------------------RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus        97 ~~~~d~G~Y~C~~~~~~~~~~~~~~~------------------~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      +...++..+.|.+.+.|. .+.|...                  ....|.|.+++.+|+|.|+|.+.+.
T Consensus        12 v~~G~~~~l~C~~~G~p~-~i~W~~~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~A~N~   79 (92)
T cd04977          12 ISVGESKFFLCQVIGEPK-DISWFSPNGEKLVTQQQISVVQNDDVRSTLTIYNANIEDAGIYKCVATDA   79 (92)
T ss_pred             ECCCCeEEEEEEeEeeCC-eEEEECCCCCEeccCCCEEEEeCCCCEEEEEEecCCcccCEEEEEEEEcC
Confidence            345677788999988875 7888421                  1236999999999999999999774


No 193
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=98.23  E-value=6.1e-06  Score=50.21  Aligned_cols=55  Identities=33%  Similarity=0.455  Sum_probs=39.3

Q ss_pred             EEEEEccCCCceEEEEccC---------------CeEEEEEcccCCCCCeEEEEEeecCCC--cceeeEEEE
Q psy5838         104 WYMCQVNTNPRISLTYNDH---------------RSWFLNIKNVQESDRGWYMCQVNTDPM--RSRQGYLQV  158 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~---------------~~~~l~i~~~~~~d~G~Y~C~~~~~~~--~~~~~~l~v  158 (215)
                      ...|.+.+.|.+.+.|...               .+..|.|.+++.+|+|.|+|.+.+...  .+..+.+.|
T Consensus         2 ~l~C~~~G~P~p~v~W~k~~~~~~~~~~~~~~~~~~g~L~i~~~~~~D~G~Y~C~a~N~~G~~~s~~a~l~v   73 (74)
T cd05738           2 TMLCAASGNPDPEITWFKDFLPVDTTSNGRIKQLRSGALQIENSEESDQGKYECVATNSAGTRYSAPANLYV   73 (74)
T ss_pred             EEEEEEeEecCCEEEEEECCEECccCCCCCEEEcCCcEEEECCCChhhCEEEEEEEECCCCceEcccEEEEE
Confidence            4679999999888888331               134588999999999999999976432  234444443


No 194
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=98.22  E-value=6.3e-06  Score=50.57  Aligned_cols=44  Identities=18%  Similarity=0.478  Sum_probs=34.4

Q ss_pred             EEEEEccCCCceEEEEccC---------------CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838         104 WYMCQVNTNPRISLTYNDH---------------RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~---------------~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ...|.+.+.|.+.+.|...               ....|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~L~C~~~g~P~p~v~W~k~g~~l~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~   60 (77)
T cd05760           2 TLRCHIDGHPRPTYQWFRDGTPLSDGQGNYSVSSKERTLTLRSAGPDDSGLYYCCAHNA   60 (77)
T ss_pred             EEEEEeeecCCCcEEEEECCEECCCCCccEEEeCCCCEEEEeeCCcccCEEEEEEEEeC
Confidence            3578888888888888321               1236899999999999999999763


No 195
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=98.21  E-value=6.5e-06  Score=50.63  Aligned_cols=45  Identities=24%  Similarity=0.384  Sum_probs=36.2

Q ss_pred             CEEEEEEccCCCceEEEEcc----------------CCeEEEEEcccCCCCCeEEEEEeec
Q psy5838         102 RGWYMCQVNTNPRISLTYND----------------HRSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~----------------~~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      +-.+.|.+.+.|.+.+.|..                .....|.|.+++.+|+|.|+|.+.+
T Consensus         3 ~v~l~C~~~g~P~p~v~W~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~a~N   63 (78)
T cd05743           3 TVEFTCVATGVPTPIINWRLNWGHVPDSARVSITSEGGYGTLTIRDVKESDQGAYTCEAIN   63 (78)
T ss_pred             EEEEEEEEEEecCCEEEEEECCeECCCCCCEEEEECCCEEEEEECCCChHHCEEEEEEEEe
Confidence            44678999999988888832                1135699999999999999999965


No 196
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=98.21  E-value=2.7e-06  Score=54.21  Aligned_cols=31  Identities=16%  Similarity=0.344  Sum_probs=20.5

Q ss_pred             eEEEeCCcEEEEEEe-e----ccCCccceeeeEEEEEEecCCcc
Q psy5838          27 VTVTVGRDALLACVV-D----NLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        27 ~~~~~G~~v~L~C~~-~----~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      ..+..|.+..|.|.- .    ....+.       +.||| ++.+
T Consensus         5 ~~~~~~~~~~l~Cp~~~~f~~~~~~~~-------v~WYK-d~~~   40 (95)
T cd05897           5 QILFTSTSGKLVCPDLSDFTINRTDVE-------LQWYK-DSVL   40 (95)
T ss_pred             eEeccccCcEEECCCHHHcccCCCCCc-------EEEcc-CCEE
Confidence            446678999999972 1    123344       99999 4544


No 197
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.20  E-value=4.5e-06  Score=50.43  Aligned_cols=43  Identities=23%  Similarity=0.315  Sum_probs=34.5

Q ss_pred             EEEEEccCCCceEEEEccC-------------CeEEEEEcccCCCCCeEEEEEeec
Q psy5838         104 WYMCQVNTNPRISLTYNDH-------------RSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~-------------~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .+.|.+.+.|.+.+.|...             ....|.|.+++.+|+|.|+|.+.+
T Consensus         2 ~l~c~v~g~P~P~v~W~kdg~~l~~~~~~~~~~~~~L~I~~v~~~D~G~YtC~a~~   57 (72)
T cd07702           2 RLTPKVKAFPAPEVIWLKDGLPAAEKCSRYHVDGYSLVIKDVTEEDAGIYTILLGI   57 (72)
T ss_pred             eEEeeEEEcCCCeEEEEECCEECCCCCcEEEeCCCEEEECcCCHHHCEEEEEEEEc
Confidence            3578889999999888321             123699999999999999999975


No 198
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=98.20  E-value=1.5e-05  Score=51.02  Aligned_cols=58  Identities=28%  Similarity=0.541  Sum_probs=39.1

Q ss_pred             cCCEEEEEEccCCCceEEEEcc-------------------------CCeEEEEEcccCCCCCeEEEEEeecCCCcceee
Q psy5838         100 SDRGWYMCQVNTNPRISLTYND-------------------------HRSWFLNIKNVQESDRGWYMCQVNTDPMRSRQG  154 (215)
Q Consensus       100 ~d~G~Y~C~~~~~~~~~~~~~~-------------------------~~~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~~~  154 (215)
                      .++....|.+.+.|.+.+.|..                         .....|.|.+++.+|+|.|.|.+..........
T Consensus        12 G~~v~L~C~~~~~p~~~v~W~~~~~~~l~~~~~~~~~~~r~~~~~~~~~~~sL~I~~v~~~DsG~Y~C~~~t~~~~~~~~   91 (95)
T cd07701          12 GGTANLTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISISDVSLSDEGQYTCSLFTMPVKTSKA   91 (95)
T ss_pred             CCcEEEEEEEecCCceEEEEeCCCCeEEEEcCcccccCCCEEEEECCCCcEEEEECcCCcccCEEEEEEeEeecCccEEE
Confidence            4445566766666666666621                         123579999999999999999997644444444


Q ss_pred             EEE
Q psy5838         155 YLQ  157 (215)
Q Consensus       155 ~l~  157 (215)
                      .|.
T Consensus        92 ~l~   94 (95)
T cd07701          92 YLT   94 (95)
T ss_pred             EEE
Confidence            444


No 199
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=98.18  E-value=5.6e-05  Score=48.44  Aligned_cols=33  Identities=12%  Similarity=0.242  Sum_probs=26.9

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      ...+.+.+|+++.|.|.+...|.+.      .+.|.+.+
T Consensus        10 ~~~~~v~~gE~~~L~V~ieAYP~p~------~~~W~~~~   42 (101)
T cd05860          10 NTTIFVNAGENLDLIVEYEAYPKPE------HQQWIYMN   42 (101)
T ss_pred             CceEEEECCCCEEEEEEEEeCCCCe------eeEEEcCC
Confidence            3467899999999999999888875      27899843


No 200
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=98.18  E-value=8.2e-06  Score=50.56  Aligned_cols=51  Identities=20%  Similarity=0.214  Sum_probs=36.2

Q ss_pred             EEEccCCCceEEEEccC-----------------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEE
Q psy5838         106 MCQVNTNPRISLTYNDH-----------------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYL  156 (215)
Q Consensus       106 ~C~~~~~~~~~~~~~~~-----------------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l  156 (215)
                      .|.+.+.|.+.++|...                       ....|.|.+++..|+|.|+|.|.+. +.....+.+
T Consensus         4 ~~~v~G~P~P~v~W~k~g~~i~~~~~~~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~YtC~A~N~~G~~~~~~~~   78 (81)
T cd04971           4 PFTVRGNPKPTLTWYHNGAVLNESDYIRTEIHYEVTTPTEYHGCLQFDNPTHVNNGNYTLVASNEYGQDSKSISA   78 (81)
T ss_pred             EEEeEeeCCCcEEEEECCEECcCCCceeEEEEeecccccccEEEEEECCCCcccCeEEEEEEEeCCCCeeeEEEe
Confidence            47777888888888321                       1235999999999999999999763 444444443


No 201
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=98.17  E-value=1.2e-05  Score=50.14  Aligned_cols=56  Identities=20%  Similarity=0.234  Sum_probs=39.5

Q ss_pred             CEEEEEEccCC--CceEEEEccC---------------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEE
Q psy5838         102 RGWYMCQVNTN--PRISLTYNDH---------------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQ  157 (215)
Q Consensus       102 ~G~Y~C~~~~~--~~~~~~~~~~---------------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~  157 (215)
                      .-...|.+.+.  |.+.+.|...                     ....|.|.+++.+|+|.|+|.+.+. +.......|.
T Consensus         3 ~~~L~C~~~g~~~~~~~i~W~~~~~~~~~~~~~~~~~~~~~~~~~~s~L~I~~v~~~DsG~Y~C~a~n~~~~~~~s~~v~   82 (84)
T cd05742           3 TLVLNCTVLTELNEGVDFQWTYPGKKRGRGKSMVTRQSLSEATELSSTLTIPNATLKDSGTYTCAASSGTMDQKESTKVN   82 (84)
T ss_pred             eEEEEEEEEeCCCccEEEEEecCCcccCCceEeecccccccceEEEEEEEECCCChhhCEEEEEEEccCCCceEEEEEEE
Confidence            34668999888  7788888320                     1246899999999999999999764 3334444443


No 202
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.16  E-value=7.6e-06  Score=51.60  Aligned_cols=42  Identities=31%  Similarity=0.436  Sum_probs=33.1

Q ss_pred             CeEEecCCCcceeeecCCcEEEEEEecccCCCeEEEEeCCCcccc
Q psy5838         162 PSIIDKDTSTDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLS  206 (215)
Q Consensus       162 p~~~~~~~~~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~  206 (215)
                      |.+..  .+.+..+.+|+.+.|.|.+.|.|.|.++|++ ++..+.
T Consensus         2 p~i~~--~~~~~~~~~G~~v~l~C~~~G~P~P~v~W~k-~~~~~~   43 (88)
T cd05851           2 ADINV--KFKDTYALKGQNVTLECFALGNPVPVIRWRK-ILEPMP   43 (88)
T ss_pred             CceEE--ccccEEEeCCCcEEEEEEecccCCCEEEEEE-CCcCCC
Confidence            44444  3446668899999999999999999999999 665553


No 203
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=98.14  E-value=1.8e-05  Score=48.33  Aligned_cols=55  Identities=25%  Similarity=0.335  Sum_probs=39.7

Q ss_pred             EEEEEccCCCceEEEEccC----------------CeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEEE
Q psy5838         104 WYMCQVNTNPRISLTYNDH----------------RSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQV  158 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~----------------~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v  158 (215)
                      ...|.+.+.|.+.+.|...                ....|.|.+++.+|.|.|+|.+.+. +.....+.|.|
T Consensus         2 ~L~C~v~g~P~p~v~W~k~~~~l~~~~~~~~~~~~~~~~l~I~~~~~~D~G~Y~C~a~N~~G~~~~~~~l~V   73 (76)
T cd05736           2 SLRCHAEGIPLPRLTWLKNGMDITPKLSKQLTLIANGSELHISNVRYEDTGAYTCIAKNEAGVDEDISSLFV   73 (76)
T ss_pred             EeEeEeeecCCCEEEEEECCEECCCCCCccEEEeCCCCEEEECcCCcccCEEEEEEEEcCCCCcceEEEEEE
Confidence            3578888888888888321                1235899999999999999999763 44455555554


No 204
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=98.10  E-value=6.7e-06  Score=50.94  Aligned_cols=36  Identities=36%  Similarity=0.755  Sum_probs=31.6

Q ss_pred             CcceeeecCCcEEEEEEecccCCC-eEEEEeCCCcccc
Q psy5838         170 STDLVVREQANVTLNCKAQGYPEP-YVMWRREDGANLS  206 (215)
Q Consensus       170 ~~~~~~~~g~~~~l~C~~~~~p~~-~i~W~~~~~~~~~  206 (215)
                      +.++.+.+|+.+.|.|.+.|.|.| .|.|++ ||.++.
T Consensus         5 P~~~~v~~G~~v~l~C~a~G~P~P~~I~W~k-~g~~l~   41 (81)
T cd05749           5 PEDLSVTANTPFNLTCQAVGPPEPVEILWWQ-GGSPLG   41 (81)
T ss_pred             CCceEEcCCCCEEEEEEeeeecCCeEEEEEE-CCEECC
Confidence            456778999999999999999999 799999 787765


No 205
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=98.07  E-value=2.5e-05  Score=48.80  Aligned_cols=49  Identities=18%  Similarity=0.325  Sum_probs=38.3

Q ss_pred             ecCCEEEEEEc-cCCCceEEEEccC--------------CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838          99 ESDRGWYMCQV-NTNPRISLTYNDH--------------RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus        99 ~~d~G~Y~C~~-~~~~~~~~~~~~~--------------~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ..+.....|.+ .+.|.+.+.|...              ....|.|.+++.+|+|.|+|.+.+.
T Consensus        10 ~G~~v~l~C~~~~g~p~p~i~W~k~g~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~   73 (86)
T cd05724          10 VGEMAVLECSPPRGHPEPTVSWRKDGQPLNLDNERVRIVDDGNLLIAEARKSDEGTYKCVATNM   73 (86)
T ss_pred             CCCCEEEEEECCCCCCCCEEEEEECCEECCCCCCCEEEccCCEEEEeECCcccCEEEEEEEEec
Confidence            35667788998 6888888888331              1246999999999999999999764


No 206
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=98.06  E-value=1.2e-05  Score=51.19  Aligned_cols=45  Identities=29%  Similarity=0.651  Sum_probs=35.4

Q ss_pred             CCeEEecCCCcceeeecCCcEEEEEEecccCCCeEEEEeCCCcccccc
Q psy5838         161 PPSIIDKDTSTDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYN  208 (215)
Q Consensus       161 ~p~~~~~~~~~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~~  208 (215)
                      ||.+..  .+.+..+.+|+.+.|.|.+.|+|.|.+.|++ +|..+...
T Consensus         3 ~~~~~~--~p~~~~~~~G~~~~L~C~~~g~P~p~v~W~k-~g~~l~~~   47 (92)
T cd05747           3 PATILT--KPRSLTVSEGESARFSCDVDGEPAPTVTWMR-EGQIIVSS   47 (92)
T ss_pred             CCcccc--cCccEEEeCCCcEEEEEEEeecCCCEEEEEE-CCEECCCC
Confidence            455443  3456778999999999999999999999999 67666543


No 207
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=98.06  E-value=1.4e-05  Score=51.53  Aligned_cols=41  Identities=22%  Similarity=0.338  Sum_probs=34.4

Q ss_pred             CcceeeecCCcEEEEEEecccCCCeEEEEeCCCccccccCCc
Q psy5838         170 STDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYNGDT  211 (215)
Q Consensus       170 ~~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~~~~~  211 (215)
                      +....+..|+.+.|.|.+.|.|++.+.|++ +|..+..+.+.
T Consensus         7 p~~~~v~~G~~v~l~C~~~G~p~p~v~W~k-dg~~l~~~~~~   47 (98)
T cd05762           7 PEDMKVRAGESVELFCKVTGTQPITCTWMK-FRKQIQEGEGI   47 (98)
T ss_pred             CcCEEEECCCEEEEEEEEcccCCCceEEEE-CCEEecCCCcE
Confidence            446678999999999999999999999999 88888654443


No 208
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=98.05  E-value=2.4e-05  Score=47.93  Aligned_cols=44  Identities=23%  Similarity=0.419  Sum_probs=32.7

Q ss_pred             EEEEEccCCCceEEEEccC----------------CeEEEEEcccCC----CCCeEEEEEeecC
Q psy5838         104 WYMCQVNTNPRISLTYNDH----------------RSWFLNIKNVQE----SDRGWYMCQVNTD  147 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~----------------~~~~l~i~~~~~----~d~G~Y~C~~~~~  147 (215)
                      .+.|.+.+.|.++++|...                ....|.|..+..    +|+|.|+|.|.+.
T Consensus         2 ~l~C~~~G~P~P~v~W~k~g~~l~~~~~~~~~~~~~~g~L~i~~~~~~~~~~d~G~Y~C~A~N~   65 (77)
T cd05733           2 VIKCEAKGNPPPTFSWTRNGTHFDPEKDPRVTMKPDSGTLVIDNMNGGRAEDYEGEYQCYASNE   65 (77)
T ss_pred             EEEeeCcccCCCeEEEEECCeECCCCCCCCEEEeCCCCEEEEeccCCCCCcCCCEEEEEEEEcC
Confidence            3679999999999999421                134577777643    6899999999774


No 209
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=98.04  E-value=1.2e-05  Score=51.67  Aligned_cols=43  Identities=40%  Similarity=0.828  Sum_probs=34.7

Q ss_pred             CeEEecCCCcceeeecCCcEEEEEEecccCCCeEEEEeCCCccccc
Q psy5838         162 PSIIDKDTSTDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSY  207 (215)
Q Consensus       162 p~~~~~~~~~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~  207 (215)
                      |.+..  .+.+..+.+|+.+.|.|.+.|.|.|.+.|++ +|..+..
T Consensus         2 P~i~~--~p~~~~v~~G~~~~l~C~~~g~P~p~i~W~k-~g~~l~~   44 (100)
T cd07693           2 PRIVE--HPSDLIVSKGDPATLNCKAEGRPTPTIQWLK-NGQPLET   44 (100)
T ss_pred             CeEEe--cCceeEEcCCCeEEEEeeCCcCCCCEEEEEE-CCEECcc
Confidence            44443  3456678899999999999999999999999 7777654


No 210
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=98.04  E-value=3.1e-05  Score=47.01  Aligned_cols=43  Identities=21%  Similarity=0.451  Sum_probs=34.0

Q ss_pred             EEEEccC-CCceEEEEccC-------------------CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838         105 YMCQVNT-NPRISLTYNDH-------------------RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       105 Y~C~~~~-~~~~~~~~~~~-------------------~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ..|.+.+ .|.+.+.|...                   ....|.|.+++.+|+|.|+|.+.+.
T Consensus         3 l~C~~~g~~P~p~~~W~k~g~~l~~~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N~   65 (75)
T cd05750           3 LKCEATSEYPSLRFKWFKDGKELNRKNKPRNIKIRNKKKNSELQINKAKLADSGEYTCVVENI   65 (75)
T ss_pred             EEEEccCCCCCceEEEEcCCeeccccCCcceEEEEecCceEEEEEccCCcccCeEEEEEEEEc
Confidence            4788888 88888888321                   1346899999999999999999763


No 211
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=98.04  E-value=1e-05  Score=51.74  Aligned_cols=45  Identities=31%  Similarity=0.716  Sum_probs=34.6

Q ss_pred             CeEEecCCCcceeeecCCcEEEEEEecccCCCeEEEEeCCCccccc
Q psy5838         162 PSIIDKDTSTDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSY  207 (215)
Q Consensus       162 p~~~~~~~~~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~  207 (215)
                      |.+.......+..+..|+++.|.|.+.|.|.|.+.|++ +|..+..
T Consensus         2 p~i~~~~~~~~~~~~~G~~v~L~C~~~g~P~p~v~W~k-~g~~~~~   46 (95)
T cd05730           2 PTIRARQSEVNATANLGQSVTLACDADGFPEPTMTWTK-DGEPIES   46 (95)
T ss_pred             CccccCCcccceEEeCCCCEEEEEeccEeCCCEEEEEE-CCEECcC
Confidence            44443333445568899999999999999999999999 7776654


No 212
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=98.02  E-value=3.1e-05  Score=49.23  Aligned_cols=45  Identities=27%  Similarity=0.321  Sum_probs=33.0

Q ss_pred             CEEEEEEccCCCceEEEEccC-----------------CeEEEEEcccCCCCCeEEEEEeec
Q psy5838         102 RGWYMCQVNTNPRISLTYNDH-----------------RSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~~-----------------~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .-...|.+.+.|.+.+.|...                 ....|.|.+++.+|+|.|+|.+.+
T Consensus        18 ~v~L~C~v~g~P~p~i~W~k~~~~~~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~Y~C~a~N   79 (92)
T cd05891          18 TLNLTCTVFGNPDPEVIWFKNDQDIELSEHYSVKLEQGKYASLTIKGVTSEDSGKYSINVKN   79 (92)
T ss_pred             EEEEEEEEEEeCCCeEEEEECCEECCCCCCEEEEEcCCCEEEEEECCCChhhCEEEEEEEEe
Confidence            345567777777777777221                 123689999999999999999975


No 213
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.00  E-value=5.1e-05  Score=46.49  Aligned_cols=44  Identities=18%  Similarity=0.395  Sum_probs=32.1

Q ss_pred             EEEEccCCCceEEEEccC----------------CeEEEEEcccCC----CCCeEEEEEeecCC
Q psy5838         105 YMCQVNTNPRISLTYNDH----------------RSWFLNIKNVQE----SDRGWYMCQVNTDP  148 (215)
Q Consensus       105 Y~C~~~~~~~~~~~~~~~----------------~~~~l~i~~~~~----~d~G~Y~C~~~~~~  148 (215)
                      ..|.+.|.|.++++|...                .+..|.|..+..    .|.|.|+|.|.+..
T Consensus         3 l~C~a~G~P~P~i~W~k~g~~l~~~~~~~~~~~~~~g~l~i~~~~~~~~~~d~G~Y~C~A~N~~   66 (77)
T cd05874           3 IQCEAKGKPPPSFSWTRNGTHFDIDKDPKVTMKPNTGTLVINIMNGEKAEAYEGVYQCTARNER   66 (77)
T ss_pred             EEeeCcccCCCeEEEEECCeECCCcCCCCEEEeCCCceEEEeccccCCCCCCCEEEEEEEEcCC
Confidence            579999999999999321                234466766654    37899999998743


No 214
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=97.99  E-value=5.5e-05  Score=46.35  Aligned_cols=45  Identities=24%  Similarity=0.347  Sum_probs=32.8

Q ss_pred             EEEEEccCCCceEEEEccC----------------CeEEEEEcccC----CCCCeEEEEEeecCC
Q psy5838         104 WYMCQVNTNPRISLTYNDH----------------RSWFLNIKNVQ----ESDRGWYMCQVNTDP  148 (215)
Q Consensus       104 ~Y~C~~~~~~~~~~~~~~~----------------~~~~l~i~~~~----~~d~G~Y~C~~~~~~  148 (215)
                      .+.|.+.|.|.+.++|...                .+..|.|..+.    .+|+|.|+|.|.+..
T Consensus         2 ~l~C~~~G~P~P~v~W~k~g~~~~~~~~~~~~~~~~~~~L~i~~~~~~~~~~d~G~Y~C~A~N~~   66 (77)
T cd05875           2 IIECEAKGNPVPTFQWTRNGKFFNVAKDPRVSMRRRSGTLVIDFSGGGRPEDYEGEYQCFARNNL   66 (77)
T ss_pred             EEEEeccccCCCEEEEEECCEEccCcCCCcEEEeCCCceEEEeccCCCCCCCCCEEEEEEEEecc
Confidence            3679999999999999431                13457777654    246899999997743


No 215
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=97.97  E-value=3.2e-05  Score=49.27  Aligned_cols=47  Identities=23%  Similarity=0.331  Sum_probs=36.7

Q ss_pred             CCEEEEEEccCCCceEEEEccCC-------------eEEEEEcccC-CCCCeEEEEEeecC
Q psy5838         101 DRGWYMCQVNTNPRISLTYNDHR-------------SWFLNIKNVQ-ESDRGWYMCQVNTD  147 (215)
Q Consensus       101 d~G~Y~C~~~~~~~~~~~~~~~~-------------~~~l~i~~~~-~~d~G~Y~C~~~~~  147 (215)
                      +.-.+.|.+.+.|.+.++|....             +..|.|.++. .+|+|.|+|.|.+.
T Consensus        20 ~~v~l~C~a~G~P~P~i~W~k~~~~i~~~~~~~~~~~g~L~I~~~~~~~D~G~Y~C~A~N~   80 (93)
T cd05849          20 GKVSVNCRARANPFPIYKWRKNNLDIDLTNDRYSMVGGNLVINNPDKYKDAGRYVCIVSNI   80 (93)
T ss_pred             CeEEEeCcCccCCCCEEEEEECCEEccCCCCeEEEECCEEEECcCCcCCCCEEEEEEEEeC
Confidence            34678999999999999994321             2358888875 68999999999764


No 216
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=97.97  E-value=1.6e-05  Score=51.46  Aligned_cols=37  Identities=24%  Similarity=0.443  Sum_probs=32.1

Q ss_pred             cceeeecCCcEEEEEEecc-cCCCeEEEEeCCCcccccc
Q psy5838         171 TDLVVREQANVTLNCKAQG-YPEPYVMWRREDGANLSYN  208 (215)
Q Consensus       171 ~~~~~~~g~~~~l~C~~~~-~p~~~i~W~~~~~~~~~~~  208 (215)
                      ....+..|+++.|.|.+.| .|+|.+.|+| ||.+|...
T Consensus        11 ~~~~v~~G~~v~L~c~v~g~~P~p~v~W~K-dg~~i~~~   48 (101)
T cd04975          11 TTIFVNLGENLNLVVEVEAYPPPPHINWTY-DNRTLTNK   48 (101)
T ss_pred             ceEEEECCCCEEEEEEEEecCCCCccEEEe-CCeeCCCC
Confidence            4566889999999999999 8889999999 88888743


No 217
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=97.96  E-value=8.9e-05  Score=47.34  Aligned_cols=35  Identities=29%  Similarity=0.515  Sum_probs=26.5

Q ss_pred             CeEEEEEcccCCCCCeEEEEEeecCCCcceeeEEE
Q psy5838         123 RSWFLNIKNVQESDRGWYMCQVNTDPMRSRQGYLQ  157 (215)
Q Consensus       123 ~~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~~~~l~  157 (215)
                      ....|.|.+++.+|+|.|.|.+.........+.|.
T Consensus        60 ~~~~L~I~~v~~~DsG~Y~C~~~~~~~~~~~~~~~   94 (95)
T cd05717          60 NELSISISNVSLSDEGRYTCSLYTMPVQTAKATVT   94 (95)
T ss_pred             CeeEEEEccCCcccCEEEEEEEecCCCceEEEEEE
Confidence            34579999999999999999997655445555544


No 218
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=97.96  E-value=7.6e-05  Score=46.25  Aligned_cols=24  Identities=21%  Similarity=0.441  Sum_probs=17.8

Q ss_pred             cEEEEEEeec-cCCccceeeeEEEEEEecCCcc
Q psy5838          34 DALLACVVDN-LKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        34 ~v~L~C~~~~-~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      .+.|.|.+.+ .|.+.       +.|++ ++..
T Consensus         1 ~~~L~C~v~g~~P~~~-------v~W~~-~g~~   25 (82)
T cd05759           1 PYNLTCRARGAKPAAE-------IIWFR-DGEV   25 (82)
T ss_pred             CEEEEEEEeCccCCCE-------EEEEE-CCEE
Confidence            3689999987 45555       99999 4554


No 219
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=97.94  E-value=9e-05  Score=47.28  Aligned_cols=48  Identities=21%  Similarity=0.322  Sum_probs=36.2

Q ss_pred             cCCEEEEEEccCCCceEEEEccCC--------------eEEEEEcccC-CCCCeEEEEEeecC
Q psy5838         100 SDRGWYMCQVNTNPRISLTYNDHR--------------SWFLNIKNVQ-ESDRGWYMCQVNTD  147 (215)
Q Consensus       100 ~d~G~Y~C~~~~~~~~~~~~~~~~--------------~~~l~i~~~~-~~d~G~Y~C~~~~~  147 (215)
                      .+.....|.+.+.|.+.++|....              ...|.|.++. ..|.|.|.|.|.+.
T Consensus        19 g~~v~l~C~a~g~P~p~i~W~~~g~~l~~~~~~~~~~~~g~L~I~~~~~~~D~G~Y~C~A~N~   81 (94)
T cd05850          19 EEKVTLGCRARASPPATYRWKMNGTEIKFAPESRYTLVAGNLVINNPQKARDAGSYQCLAINR   81 (94)
T ss_pred             CCeEEEEeEceeCCCCEEEEEECCEECccCCCceEEEECCeEEEccCCccCcCEEEEEEEEcC
Confidence            456788999999999999994311              2346776654 58999999999764


No 220
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.90  E-value=2.4e-05  Score=48.93  Aligned_cols=38  Identities=26%  Similarity=0.533  Sum_probs=32.4

Q ss_pred             CcceeeecCCcEEEEEEecccCCCeEEEEeCCCcccccc
Q psy5838         170 STDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYN  208 (215)
Q Consensus       170 ~~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~~  208 (215)
                      +.+..+..|+.+.|.|.+.|.|.|.+.|++ ++..+...
T Consensus         6 p~~~~~~~G~~~~l~C~~~g~p~p~v~W~k-~g~~~~~~   43 (85)
T cd05728           6 ISDTEADIGSSLRWECKASGNPRPAYRWLK-NGQPLASE   43 (85)
T ss_pred             CCccEEcCCCcEEEEEEeeEeCCCEEEEEE-CCEECCCC
Confidence            445678899999999999999999999999 77776543


No 221
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=97.88  E-value=6e-05  Score=48.11  Aligned_cols=47  Identities=21%  Similarity=0.348  Sum_probs=35.0

Q ss_pred             cCCEEEEEEccC-----CCceEEEEccC----------------CeEEEEEcccCCCCCeEEEEEeec
Q psy5838         100 SDRGWYMCQVNT-----NPRISLTYNDH----------------RSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       100 ~d~G~Y~C~~~~-----~~~~~~~~~~~----------------~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .+.-...|.+.+     .|.+.+.|...                .+..|.|.++..+|+|.|+|.+.+
T Consensus        14 G~~~~L~C~~~g~~~~~~p~~~v~Wyk~~~~~~~~~~~~~r~~~~~~~L~I~~~~~~DsG~Y~C~~~N   81 (94)
T cd05756          14 GEPVVIKCPLFYSYIAQSPGLNLTWYKSDGKTPIPTEERSRMHQQKDLLWFLPAALEDSGLYTCVVRN   81 (94)
T ss_pred             CCCeEEECCCCCcccccCCCceEEEEEcCCCCcccccccceeeecCCeEEEccCCcccCeEEEEEEcC
Confidence            444566788887     57777777321                134589999999999999999976


No 222
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=97.88  E-value=3.1e-05  Score=49.48  Aligned_cols=38  Identities=37%  Similarity=0.747  Sum_probs=32.0

Q ss_pred             CcceeeecCCcEEEEEEecccCCCeEEEEeCCCcccccc
Q psy5838         170 STDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYN  208 (215)
Q Consensus       170 ~~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~~  208 (215)
                      +.+..+.+|+++.|.|.+.|.|.|.+.|++ ||..+...
T Consensus         6 P~~~~~~~g~~v~l~C~v~g~P~p~i~W~k-~g~~l~~~   43 (95)
T cd05722           6 PSDIVAVRGGPVVLNCSAEGEPPPKIEWKK-DGVLLNLV   43 (95)
T ss_pred             CCCeEEcCCCCEEEeeecccCCCCEEEEEE-CCeECccc
Confidence            345567789999999999999999999999 88877644


No 223
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=97.85  E-value=5.4e-05  Score=48.33  Aligned_cols=31  Identities=35%  Similarity=0.807  Sum_probs=27.2

Q ss_pred             cCCcEEEEEEecccCCCeEEEEeCCCcccccc
Q psy5838         177 EQANVTLNCKAQGYPEPYVMWRREDGANLSYN  208 (215)
Q Consensus       177 ~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~~  208 (215)
                      +|+.+.|.|.+.|.|.|.++|++ +|..+...
T Consensus        18 ~g~~v~l~C~~~G~P~P~i~W~k-~g~~l~~~   48 (94)
T cd05848          18 DEKKVILNCEARGNPVPTYRWLR-NGTEIDTE   48 (94)
T ss_pred             CCCEEEEEEEeeecCCCEEEEEE-CCeECccC
Confidence            57899999999999999999999 78777543


No 224
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=97.84  E-value=0.00013  Score=44.75  Aligned_cols=58  Identities=19%  Similarity=0.255  Sum_probs=40.4

Q ss_pred             eecCCEEEEEEccCCCc-eEEEEccC------CeEEEEEcccCCCCCeEEEEEeecCCCcceeeEEE
Q psy5838          98 QESDRGWYMCQVNTNPR-ISLTYNDH------RSWFLNIKNVQESDRGWYMCQVNTDPMRSRQGYLQ  157 (215)
Q Consensus        98 ~~~d~G~Y~C~~~~~~~-~~~~~~~~------~~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~~~~l~  157 (215)
                      ...|.-..+|.+.+.|. ..+.|...      ....|.|.++ .+|+|.|+|.+.+. ..+..+.|+
T Consensus        13 ~~G~~V~L~C~~~~~p~~~~~~W~kng~~l~~~~~~l~i~~~-~~dsG~Y~C~a~~~-~~S~~v~l~   77 (78)
T cd05752          13 FQGEKVTLTCNGFNSPEQNSTQWYHNGKLLETTTNSYRIRAA-NNDSGEYRCQTQGS-SLSDPVHLE   77 (78)
T ss_pred             eCCCCEEEEEeCCCCCCCccEEEEECCEEeeccCCeEEEeec-ccCCEEeEEECCCC-cCCCCEEEe
Confidence            34667788999998765 35777432      2346889999 99999999999743 444444444


No 225
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=97.82  E-value=7.6e-05  Score=47.99  Aligned_cols=37  Identities=14%  Similarity=0.252  Sum_probs=30.7

Q ss_pred             cceeeecCCcEEEEEEecccCCC-eEEEEeCCCcccccc
Q psy5838         171 TDLVVREQANVTLNCKAQGYPEP-YVMWRREDGANLSYN  208 (215)
Q Consensus       171 ~~~~~~~g~~~~l~C~~~~~p~~-~i~W~~~~~~~~~~~  208 (215)
                      ....+.+|+.+.|.|.+.|.|.| .+.|++ ++..+...
T Consensus         9 ~~~~~~~G~~v~L~C~~~g~P~P~~v~W~~-~~~~i~~~   46 (98)
T cd05758           9 ATQYAILGDKGRVECFIFSTPPPDRIVWTW-KENELESG   46 (98)
T ss_pred             CcEEEeCCCcEEEEEEEcccCCCCEeEEEE-CCEEccCC
Confidence            34557899999999999999999 699999 77766543


No 226
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=97.80  E-value=3.6e-05  Score=46.07  Aligned_cols=28  Identities=43%  Similarity=0.895  Sum_probs=24.7

Q ss_pred             CCcEEEEEEecccCCCeEEEEeCCCcccc
Q psy5838         178 QANVTLNCKAQGYPEPYVMWRREDGANLS  206 (215)
Q Consensus       178 g~~~~l~C~~~~~p~~~i~W~~~~~~~~~  206 (215)
                      |+++.|.|.+.|.|.|.+.|++ ++..+.
T Consensus         1 G~~v~L~C~a~G~P~P~v~W~k-~g~~l~   28 (69)
T cd05739           1 GGSVNLTCVAVGAPMPYVKWMK-GGEELT   28 (69)
T ss_pred             CCeEEEEEEeeecCCCEEEEEE-CCEECC
Confidence            6789999999999999999999 676654


No 227
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=97.79  E-value=0.00027  Score=45.10  Aligned_cols=47  Identities=28%  Similarity=0.449  Sum_probs=34.7

Q ss_pred             CCCceEEEEccCCeEEEEEcccCCCCCeEEEEEeecCCCcceeeEEE
Q psy5838         111 TNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTDPMRSRQGYLQ  157 (215)
Q Consensus       111 ~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~~~~l~  157 (215)
                      .++++.+.......+.|+|.+++.+|+|.|.|.+..........++.
T Consensus        48 ~d~Rf~~~~~~~~~~tL~I~~vq~~D~G~Y~Cqv~t~p~~~~~~~~~   94 (95)
T cd05881          48 KDSRFQLVNFSSNELRVSLSNVSLSDEGRYFCQLYTDPPQEAYTTIT   94 (95)
T ss_pred             CCcCEEEEeCCCCEEEEEECcCCcccCEEEEEEEEcccCeEEEEEEE
Confidence            34566665545678889999999999999999997655555554443


No 228
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=97.78  E-value=5.3e-05  Score=49.05  Aligned_cols=36  Identities=19%  Similarity=0.340  Sum_probs=31.6

Q ss_pred             ceeeecCCcEEEEEEecccCCCeEEEEeCCCcccccc
Q psy5838         172 DLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYN  208 (215)
Q Consensus       172 ~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~~  208 (215)
                      ...+..|+.+.|.|.+.|+|+|.+.|++ ||.++..+
T Consensus        12 ~~~~~~~~~~~l~~~v~g~P~P~v~W~k-dg~~l~~~   47 (101)
T cd05859          12 LEFANLHEVKEFVVEVEAYPPPQIRWLK-DNRTLIEN   47 (101)
T ss_pred             eEEEecCCcEEEEEEEEEeCCCceEEEE-CCEECcCC
Confidence            4557889999999999999999999999 88887644


No 229
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=97.76  E-value=0.00018  Score=43.84  Aligned_cols=23  Identities=30%  Similarity=0.457  Sum_probs=20.4

Q ss_pred             EEEEEcccCCCCCeEEEEEeecC
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ..|.|.+++.+|+|.|+|.+.+.
T Consensus        44 ~~L~I~~~~~~DsG~Y~C~a~N~   66 (76)
T cd05895          44 SELQISKASLADNGEYKCMVSSK   66 (76)
T ss_pred             EEEEECcCCcccCEEEEEEEEeC
Confidence            56899999999999999999763


No 230
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=97.75  E-value=0.00015  Score=44.64  Aligned_cols=20  Identities=10%  Similarity=0.277  Sum_probs=15.0

Q ss_pred             EEEcccCCCCCeEEEEEeec
Q psy5838         127 LNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       127 l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      |.+.....+|.+.|+|+|.+
T Consensus        45 L~~~~~~~Ddg~~~~C~A~n   64 (80)
T cd05885          45 IRFPVDRKDDGAILSCEASH   64 (80)
T ss_pred             EEEEeeeccCCcEEEEEEEC
Confidence            56677777777888888865


No 231
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=97.74  E-value=0.00025  Score=43.95  Aligned_cols=48  Identities=29%  Similarity=0.571  Sum_probs=36.1

Q ss_pred             cCCEEEEEEccCCCceEEEEccC-----------------CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838         100 SDRGWYMCQVNTNPRISLTYNDH-----------------RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       100 ~d~G~Y~C~~~~~~~~~~~~~~~-----------------~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      .++-...|.+.+.|.+.+.|...                 ..+.|.|.++..+|.|.|.|.+.+.
T Consensus         9 G~~~~l~C~~~~~p~~~v~W~k~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~g~Y~C~~~n~   73 (85)
T cd05729           9 GSTVRLKCPASGNPRPTITWLKDGKPFKKEHRIGGYKVRKKKWTLILESVVPSDSGKYTCIVENK   73 (85)
T ss_pred             CCcEEEEEEcCCCCCCeEEEEECCEECcccCceeEEEccCcEEEEEEeECCcccCEEEEEEEEEC
Confidence            44556789888888777887321                 1245889999999999999999753


No 232
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=97.73  E-value=0.00018  Score=44.91  Aligned_cols=49  Identities=27%  Similarity=0.501  Sum_probs=37.8

Q ss_pred             eecCCEEEEEEccC-CCceEEEEccC----------CeEEEEEcccCCCCCeEEEEEeec
Q psy5838          98 QESDRGWYMCQVNT-NPRISLTYNDH----------RSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus        98 ~~~d~G~Y~C~~~~-~~~~~~~~~~~----------~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ...+.....|.+.+ .|.+.+.|...          .+..|.|..++.+|+|.|.|.+.+
T Consensus        14 ~~G~~v~L~C~~~~~~~~~~i~W~~~~~~~~~~~~~~~~~L~I~~v~~~DsG~Y~C~a~n   73 (85)
T cd05754          14 RPGADVSFICRAKSKSPAYTLVWTRVGGGLPSRAMDFNGILTIRNVQLSDAGTYVCTGSN   73 (85)
T ss_pred             cCCCCEEEEEEcCCCCCCcEEEEEECCCcCCCcccccCCEEEECCCCHHHCEEEEEEEec
Confidence            34667788999875 57777777332          245799999999999999999965


No 233
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=97.69  E-value=6.5e-05  Score=45.85  Aligned_cols=29  Identities=28%  Similarity=0.729  Sum_probs=25.7

Q ss_pred             CCcEEEEEEecccCCCeEEEEeCCCccccc
Q psy5838         178 QANVTLNCKAQGYPEPYVMWRREDGANLSY  207 (215)
Q Consensus       178 g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~  207 (215)
                      |+++.|.|.+.|.|.|.++|++ +|..+..
T Consensus         1 G~~v~l~C~~~G~P~p~i~W~k-~g~~i~~   29 (76)
T cd05867           1 GETARLDCQVEGIPTPNITWSI-NGAPIEG   29 (76)
T ss_pred             CCeEEEEEEeeEeCCCeEEEEE-CCEECCC
Confidence            6889999999999999999999 8877654


No 234
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=97.67  E-value=0.00047  Score=43.18  Aligned_cols=34  Identities=29%  Similarity=0.405  Sum_probs=25.1

Q ss_pred             EEEEEcccCCCCCeEEEEEeecC-CCcceeeEEEE
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQV  158 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~v  158 (215)
                      ..|.|.+++.+|+|.|+|.+.+. +.......|.|
T Consensus        50 s~L~I~~~~~~DsG~Y~C~a~n~~~~~~~~t~~~V   84 (86)
T cd05862          50 STLTIENVTLSDLGRYTCTASSGQMIAKNSTIVIV   84 (86)
T ss_pred             eEEEEecCCcccCEEEEEEEeecceEecccEEEEE
Confidence            46999999999999999999763 33344444544


No 235
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=97.63  E-value=0.00013  Score=42.63  Aligned_cols=21  Identities=14%  Similarity=0.474  Sum_probs=15.7

Q ss_pred             EEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          35 ALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        35 v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      +.|.|.+.+.+...       +.|++++
T Consensus         1 ~~l~C~~~~~~~~~-------~~W~~~~   21 (74)
T cd00096           1 VTLTCLASGPPPPT-------ITWLKNG   21 (74)
T ss_pred             CEEEEEecCCCCCc-------EEEEECC
Confidence            47899998855555       9999954


No 236
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=97.60  E-value=0.00012  Score=48.12  Aligned_cols=30  Identities=30%  Similarity=0.671  Sum_probs=26.4

Q ss_pred             cCCcEEEEEEecccCCCeEEEEeCCCccccc
Q psy5838         177 EQANVTLNCKAQGYPEPYVMWRREDGANLSY  207 (215)
Q Consensus       177 ~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~  207 (215)
                      .|..+.|.|.+.|.|.+.++|++ ||..+..
T Consensus        22 ~g~~v~L~C~a~G~P~p~i~W~k-~g~~l~~   51 (109)
T cd05773          22 GSSDANLVCQAQGVPRVQFRWAK-NGVPLDL   51 (109)
T ss_pred             CCCEEEEEEECcccCCCEEEEEE-CCEECCC
Confidence            56899999999999999999999 8877753


No 237
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=97.58  E-value=0.0007  Score=43.44  Aligned_cols=60  Identities=20%  Similarity=0.280  Sum_probs=41.1

Q ss_pred             ceecCCEEEEEEccCCCce---EEEEcc--------------------CCeEEEEEcccCCCC-CeEEEEEeec-CCCcc
Q psy5838          97 VQESDRGWYMCQVNTNPRI---SLTYND--------------------HRSWFLNIKNVQESD-RGWYMCQVNT-DPMRS  151 (215)
Q Consensus        97 ~~~~d~G~Y~C~~~~~~~~---~~~~~~--------------------~~~~~l~i~~~~~~d-~G~Y~C~~~~-~~~~~  151 (215)
                      +...|.+...|.+.+.|.+   .|.|..                    .....|.|.++...| .|.|.|.|.+ .+...
T Consensus        13 ~~~G~~~~L~C~~~s~P~P~~i~W~w~~~~i~~~~~~r~~I~~~~~~~g~~S~L~I~~~~~~d~~g~Y~C~a~N~~G~d~   92 (98)
T cd05898          13 AVRGERGKVKCFIGSTPPPDRIAWAWKENVLESGTSERYTVERTSTGSGVLSTLTINNIMEADFQTHYNCTAWNSFGSGT   92 (98)
T ss_pred             EeCCCcEEEEEEEccCCCCcEEEEEEccccccCCCCCCEEEEEEccCCCcEEEEEECCCccccCCcEEEEEEEeCCccce
Confidence            4567888999999776654   566621                    134558999998777 6899999966 34444


Q ss_pred             eeeEE
Q psy5838         152 RQGYL  156 (215)
Q Consensus       152 ~~~~l  156 (215)
                      ..++|
T Consensus        93 ~~i~L   97 (98)
T cd05898          93 AIIQL   97 (98)
T ss_pred             EEEEe
Confidence            44433


No 238
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=97.55  E-value=0.00021  Score=43.94  Aligned_cols=38  Identities=21%  Similarity=0.414  Sum_probs=30.3

Q ss_pred             ceeeecCCcEEEEEEecccCCCeEEEEeCCCccccccCCc
Q psy5838         172 DLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYNGDT  211 (215)
Q Consensus       172 ~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~~~~~  211 (215)
                      ...+.+|+.+.|.|.+.+. .+.+.|++ ||..+..+.+.
T Consensus         3 ~~~~~~G~~v~l~C~~~~~-~~~v~W~k-~g~~l~~~~~~   40 (79)
T cd04973           3 SYSAHPGDLLQLRCRLRDD-VQSINWTK-DGVQLGENNRT   40 (79)
T ss_pred             cEEecCCCCEEEEEEecCC-CceEEEee-CCcCCCCCceE
Confidence            4557899999999999886 56899999 88887654443


No 239
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=97.51  E-value=0.00012  Score=43.55  Aligned_cols=25  Identities=40%  Similarity=0.761  Sum_probs=22.5

Q ss_pred             EEEEEEecccCCCeEEEEeCCCcccc
Q psy5838         181 VTLNCKAQGYPEPYVMWRREDGANLS  206 (215)
Q Consensus       181 ~~l~C~~~~~p~~~i~W~~~~~~~~~  206 (215)
                      +.|.|.+.|+|.|.+.|++ ||+.+.
T Consensus         1 ~~l~c~v~g~P~P~v~W~k-dg~~l~   25 (67)
T cd05863           1 VKLPVKVAAYPPPEFQWYK-DGKLIS   25 (67)
T ss_pred             CEEEEEEEEeCCCEEEEEE-CCEECc
Confidence            4689999999999999999 888875


No 240
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=97.50  E-value=0.00029  Score=44.85  Aligned_cols=28  Identities=18%  Similarity=0.595  Sum_probs=21.0

Q ss_pred             EeCCcEEEEEEeecc-CC-ccceeeeEEEEEEecCCcc
Q psy5838          30 TVGRDALLACVVDNL-KG-FKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        30 ~~G~~v~L~C~~~~~-~~-~~~~~~~~~v~W~~~~~~~   65 (215)
                      ..|+.++|.|.+.+. |. ..       +.|++ ++..
T Consensus        11 ~~~~~~~L~C~a~g~~P~~~~-------i~W~~-~g~~   40 (95)
T cd00098          11 LLGGSVTLTCLATGFYPPDIT-------VTWLK-NGKE   40 (95)
T ss_pred             HcCCCeEEEEEEeeEECCCcE-------EEEEE-CCEE
Confidence            468899999999986 32 34       89999 4443


No 241
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=97.50  E-value=0.00055  Score=44.01  Aligned_cols=34  Identities=24%  Similarity=0.279  Sum_probs=23.9

Q ss_pred             CceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          25 PNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      .+-.+.+|+.++|.|.+.+..+.....    +.|||++
T Consensus         9 ~p~~~~eG~~~tL~C~v~g~~P~a~L~----i~W~rG~   42 (100)
T cd05755           9 LPSWQPVGKNYTLQCDVPGVAPRQNLT----VVLLRGN   42 (100)
T ss_pred             CCCcccCCCcEEEEEEEcCcCCCCcEE----EEEeeCC
Confidence            334457999999999999754443221    6999954


No 242
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=97.48  E-value=0.00046  Score=43.94  Aligned_cols=23  Identities=39%  Similarity=0.637  Sum_probs=20.3

Q ss_pred             eEEEEEcccCCCCCeEEEEEeec
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ...|.|.+++.+|+|.|.|.+.+
T Consensus        64 ~~~L~I~~l~~sDsgtY~C~v~~   86 (94)
T cd07690          64 SFPLIIKNLKIEDSDTYICEVED   86 (94)
T ss_pred             eEEEEECCCCHHHCEEEEEEECC
Confidence            35699999999999999999864


No 243
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=97.46  E-value=0.0007  Score=42.07  Aligned_cols=49  Identities=27%  Similarity=0.324  Sum_probs=34.4

Q ss_pred             ecCCEEEEEEccC-CCceEEEEcc--------CCeEEEEEcccCCCCCeEEEEEeecC
Q psy5838          99 ESDRGWYMCQVNT-NPRISLTYND--------HRSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus        99 ~~d~G~Y~C~~~~-~~~~~~~~~~--------~~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ..|.-..+|.+.+ .+...+.|..        .....|.|..++.+|+|.|+|.+.+.
T Consensus        13 ~G~~vtL~C~~~~~~~~~~~~w~k~g~~~~~~~~~~~l~I~~~~~~dsG~Y~C~~~~~   70 (83)
T cd05753          13 EGEPLVLRCHGWKNKPVYKVTYYRDGKAKKYSHSNSNLSIPQATLSDSGSYHCSGIIG   70 (83)
T ss_pred             CCCCEEEEeeCCCCCcceEEEEEECCeEccccCCCceEEECccCHHHCEEEEEEEEeC
Confidence            4455566788743 4555666633        22356999999999999999999653


No 244
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=97.45  E-value=0.002  Score=44.25  Aligned_cols=39  Identities=15%  Similarity=0.361  Sum_probs=27.8

Q ss_pred             CCcccCCCCceEEEeCCcEEEEEEeeccCCc--cceeeeEEEEEEecC
Q psy5838          17 MPHFAEPIPNVTVTVGRDALLACVVDNLKGF--KGLRIGWQVAWVRVD   62 (215)
Q Consensus        17 ~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~--~~~~~~~~v~W~~~~   62 (215)
                      .|.+...+......+|+.++|.|.+.+..++  .       +.|++++
T Consensus        38 ~P~v~~~~~~~~~~~~~~~~L~C~a~g~~P~~~~-------i~W~~~g   78 (139)
T cd05771          38 PPRVRLSLEKLVSMIEEPQTLICHIAGYYPLDVQ-------VEWTREP   78 (139)
T ss_pred             CCceEEeCCCceeecCCcEEEEEEECCCCCCCeE-------EEEEECC
Confidence            4666555555555589999999999985332  4       8999954


No 245
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=97.44  E-value=0.00093  Score=41.44  Aligned_cols=32  Identities=19%  Similarity=0.118  Sum_probs=23.2

Q ss_pred             ceEEEeCCcEEEEEEeeccCCc--cceeeeEEEEEEecCCc
Q psy5838          26 NVTVTVGRDALLACVVDNLKGF--KGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        26 ~~~~~~G~~v~L~C~~~~~~~~--~~~~~~~~v~W~~~~~~   64 (215)
                      ...+-.|++++|.|.......|  .       +.|+....+
T Consensus         8 ~~~lL~G~sLtLtl~~~s~s~p~~~-------i~w~~P~n~   41 (88)
T cd07694           8 SDHVLSGTNLTLTLHGSSNSLPAFK-------VEWRGPGNK   41 (88)
T ss_pred             CCeeecCCcEEEEEecCCCCCCCcc-------EEEeCCCCc
Confidence            3466789999999998654343  5       999885544


No 246
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=97.40  E-value=0.0008  Score=38.54  Aligned_cols=45  Identities=24%  Similarity=0.369  Sum_probs=33.3

Q ss_pred             CEEEEEEccCCCceEEEEcc------------CCeEEEEEcccCCCCCeEEEEEeec
Q psy5838         102 RGWYMCQVNTNPRISLTYND------------HRSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       102 ~G~Y~C~~~~~~~~~~~~~~------------~~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      +....|.+.+.+.+.+.|..            .....|.|.+++..|+|.|+|.+.+
T Consensus         4 ~~~l~C~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~L~i~~~~~~d~G~Y~C~~~n   60 (63)
T smart00408        4 SVTLTCPAEGDPVPNITWLKDGKPLPESNRLSASGSTLTIKSVSLEDSGEYTCVAEN   60 (63)
T ss_pred             eEEEEeeCccCCCCeEEEEECCEECCCCCEEecCCcEEEEeeCCcccCEEEEEEEec
Confidence            34556777766666777732            2345699999999999999999864


No 247
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=97.40  E-value=0.00046  Score=40.30  Aligned_cols=43  Identities=30%  Similarity=0.474  Sum_probs=31.5

Q ss_pred             CEEEEEEc-cCCCceEEEEccC---------------Ce---EEEEEcccCCCCCeEEEEEe
Q psy5838         102 RGWYMCQV-NTNPRISLTYNDH---------------RS---WFLNIKNVQESDRGWYMCQV  144 (215)
Q Consensus       102 ~G~Y~C~~-~~~~~~~~~~~~~---------------~~---~~l~i~~~~~~d~G~Y~C~~  144 (215)
                      +-...|.+ .+.+...+.|...               ..   ..|.|.+++.+|+|.|+|.|
T Consensus         3 ~v~L~C~~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~v   64 (64)
T PF00047_consen    3 SVTLTCSVSSGPPPTTVTWSKNGQSLPEGSTTNRSTNSVSSTSRLTISNVTPEDSGTYTCVV   64 (64)
T ss_dssp             EEEEEEEEEESSSTSEEEEEETTTTTSEEEEEEEEETTTEEEEEEEESSCTGGGTEEEEEEE
T ss_pred             eEEEEeecCCCCCCcEEEEEECCccccCcceeEeecccceeeeEEEEccCCHHHCEEEEEEC
Confidence            34567888 7777777877321               11   12999999999999999986


No 248
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=97.36  E-value=0.00064  Score=43.15  Aligned_cols=47  Identities=23%  Similarity=0.392  Sum_probs=33.4

Q ss_pred             cCCEEEEEEccCC-----CceEEEEccC------------CeEEEEEcccCCCCCeEEEEEeec
Q psy5838         100 SDRGWYMCQVNTN-----PRISLTYNDH------------RSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       100 ~d~G~Y~C~~~~~-----~~~~~~~~~~------------~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ...+...|.+.+.     |.+.+.|...            .+..|.|.++..+|+|.|+|.+.+
T Consensus        10 g~~~~l~Cp~~~~~~~~~~~p~i~Wyk~~~~i~~~~~~~~~~~~L~I~~v~~~DsG~YtC~~~n   73 (92)
T cd05757          10 TKGGKIVCPDLDDFKNENTLPPVQWYKDCKLLEGDRKRFVKGSKLLIQNVTEEDAGNYTCKLTF   73 (92)
T ss_pred             ccCCEEECCChHHccCCCCCCcEEEeECCEECCCCccEEecCCEEEEeeCChhhCEEEEEEEEe
Confidence            4456677876532     4556666321            345699999999999999999965


No 249
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=97.33  E-value=0.00033  Score=44.07  Aligned_cols=29  Identities=17%  Similarity=0.406  Sum_probs=25.4

Q ss_pred             CCcEEEEEEecccCCCeEEEEeCCCccccc
Q psy5838         178 QANVTLNCKAQGYPEPYVMWRREDGANLSY  207 (215)
Q Consensus       178 g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~  207 (215)
                      |+.+.|.|.+.|.|++.+.|++ +++.+..
T Consensus         1 g~~~~l~C~~~g~p~~~i~W~k-~~~~i~~   29 (88)
T cd05735           1 GQKKEMSCTAHGEKPIIVRWEK-EDRIINP   29 (88)
T ss_pred             CCeEEEEEEEECCCCCEEEEee-CCEECCC
Confidence            7889999999999999999999 7776654


No 250
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=97.33  E-value=0.00056  Score=42.85  Aligned_cols=37  Identities=22%  Similarity=0.411  Sum_probs=30.6

Q ss_pred             CcceeeecCCcEEEEEEecccCCCeEEEEeCCCcccccc
Q psy5838         170 STDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYN  208 (215)
Q Consensus       170 ~~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~~  208 (215)
                      +.+..+..|+++.|.|.+.+ |.+.+.|++ ||.++..+
T Consensus         3 P~~~~v~~G~~v~L~C~~~~-~~~~i~W~~-ng~~i~~~   39 (87)
T cd05873           3 PRQRTFKLGNNAELKCSPKS-NLARVVWKF-DGKVLTPE   39 (87)
T ss_pred             cceEEEECCCCEEEEEECCC-CCCeEEEEE-CCEECCCC
Confidence            44667889999999999865 678999999 88888755


No 251
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=97.32  E-value=0.0032  Score=39.95  Aligned_cols=26  Identities=19%  Similarity=0.440  Sum_probs=19.1

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |+.++|.|.+.+..... .    .+.|++++
T Consensus        14 ~~~~~L~C~a~gF~P~~-i----~v~W~~~g   39 (93)
T cd07698          14 DGSLTLSCHATGFYPRD-I----EVTWLRDG   39 (93)
T ss_pred             CCcEEEEEEEEEEeCCC-c----EEEEEECC
Confidence            77899999999854332 1    18999953


No 252
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=97.28  E-value=0.00046  Score=44.09  Aligned_cols=76  Identities=22%  Similarity=0.406  Sum_probs=49.1

Q ss_pred             CcEEEEEEeeccCCccceeeeEEEEEEecCC--ccEEEee----ecee--eeCCceEEEEcCCceEEEEEccceecCCEE
Q psy5838          33 RDALLACVVDNLKGFKGLRIGWQVAWVRVDT--QTILSIH----HNVI--TQNPRISLTYNDHRSWFLNIKNVQESDRGW  104 (215)
Q Consensus        33 ~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~--~~~~~~~----~~~~--~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~  104 (215)
                      +.++|.|.+......  .    +|.|.|...  ...+...    ...+  ...+|+.+......+.+|.|.|++.+|+|.
T Consensus         1 ~~vtL~C~~~~~~~~--~----qV~W~k~~~~~~~~iavy~~~~g~~~~~~y~~Rv~f~~~~~~d~sI~i~nvt~~D~G~   74 (96)
T cd05889           1 EKMKLECVYPKTGVL--I----QVSWTKHNGSHKENIAVYHPIYGMHIEDKYRGRVYFLNSTREDMSLSFNNATEEDVGL   74 (96)
T ss_pred             CCEEEEeEcCCCCcE--E----EEEEEEcCCCCCceEEEEECCCCCEECccccCeEEEecCCCCccEEEEcCCCcccCEE
Confidence            468999998743221  2    388988543  1222222    1111  223566665443467899999999999999


Q ss_pred             EEEEccCCCc
Q psy5838         105 YMCQVNTNPR  114 (215)
Q Consensus       105 Y~C~~~~~~~  114 (215)
                      |+|.+...|.
T Consensus        75 Y~C~~~t~P~   84 (96)
T cd05889          75 YCCSLVTYPQ   84 (96)
T ss_pred             EEEEEEeCCC
Confidence            9999887664


No 253
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=97.21  E-value=0.00049  Score=43.95  Aligned_cols=76  Identities=25%  Similarity=0.431  Sum_probs=49.8

Q ss_pred             CcEEEEEEeeccCCccceeeeEEEEEEecCCc--cEEEeeec----ee--eeCCceEEEEcCCceEEEEEccceecCCEE
Q psy5838          33 RDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ--TILSIHHN----VI--TQNPRISLTYNDHRSWFLNIKNVQESDRGW  104 (215)
Q Consensus        33 ~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~--~~~~~~~~----~~--~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~  104 (215)
                      ++|+|+|.+......  .    +|.|.|....  ..+...+.    .+  ...+|+.+...+....+|.|.|++.+|+|.
T Consensus         1 ~~vtL~C~~~~~~~~--~----qV~W~k~~~~~~~~ia~y~~~~g~~~~~~y~~Rv~~~~~~~~d~sl~i~nv~~~D~G~   74 (96)
T cd05887           1 KNVTLKCRIQVNETI--T----QSSWEKIHGKGSVTLAVHHPMYGISIQPDYQGRVSFKNYSLLDATIMLENVGFSDIGV   74 (96)
T ss_pred             CCEEEEEEecCCCcE--E----EEEEEEcCCCCcEEEEEEcccCCcccChhhCCcEEEcCCCCCccEEEEeCCCccccEE
Confidence            478999999854322  2    3899875322  22222211    11  233577665445567899999999999999


Q ss_pred             EEEEccCCCc
Q psy5838         105 YMCQVNTNPR  114 (215)
Q Consensus       105 Y~C~~~~~~~  114 (215)
                      |+|.+..-|.
T Consensus        75 Y~C~v~tfP~   84 (96)
T cd05887          75 YICKAVTFPL   84 (96)
T ss_pred             EEEEEEeCCC
Confidence            9999877654


No 254
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=97.21  E-value=0.0027  Score=40.17  Aligned_cols=35  Identities=26%  Similarity=0.349  Sum_probs=24.7

Q ss_pred             EEEEEcccCCCCCeEEEEEeecCC--CcceeeEEEEE
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNTDP--MRSRQGYLQVV  159 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~~~--~~~~~~~l~v~  159 (215)
                      ..|.|.+++.+|+|.|+|.+.+..  .....++|+|.
T Consensus        53 ~~L~I~~~~~~DsG~Y~C~a~~~~~~~~~~~~~l~v~   89 (91)
T cd05871          53 RGLLLRSLQRSDAGVYTCTAVEHSFSQTLAKYTLHVI   89 (91)
T ss_pred             CeEEEeeCChhHCEEEEEEEEccCCeEEEEEEEEEEe
Confidence            348999999999999999996422  22334455553


No 255
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=97.20  E-value=0.00098  Score=42.11  Aligned_cols=29  Identities=34%  Similarity=0.863  Sum_probs=25.0

Q ss_pred             cCCcEEEEEEecccCCCeEEEEeCCCcccc
Q psy5838         177 EQANVTLNCKAQGYPEPYVMWRREDGANLS  206 (215)
Q Consensus       177 ~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~  206 (215)
                      .|..+.|.|.+.|.|.|.++|++ ++..+.
T Consensus        18 ~~~~~~l~C~~~g~p~p~i~W~k-~~~~l~   46 (91)
T cd04967          18 DEGKVSLNCRARGSPPPTYRWLM-NGTEID   46 (91)
T ss_pred             CCCEEEEEEeeeEcCCCEEEEEE-CCEECC
Confidence            44679999999999999999999 777764


No 256
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=97.19  E-value=0.00042  Score=41.63  Aligned_cols=27  Identities=33%  Similarity=0.705  Sum_probs=23.2

Q ss_pred             EEEEEEecccCCCeEEEEeCCCcccccc
Q psy5838         181 VTLNCKAQGYPEPYVMWRREDGANLSYN  208 (215)
Q Consensus       181 ~~l~C~~~~~p~~~i~W~~~~~~~~~~~  208 (215)
                      +.|.|.+.|.|.|.+.|++ ||+.+..+
T Consensus         1 ~~l~c~v~g~P~p~v~W~k-~g~~l~~~   27 (71)
T cd04976           1 VRLPVKVKAYPPPEIQWYK-NGKLISEK   27 (71)
T ss_pred             CEEEeEEEEeCCCEEEEEE-CCEECCCC
Confidence            3689999999999999999 88877644


No 257
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=97.19  E-value=0.0098  Score=36.72  Aligned_cols=21  Identities=29%  Similarity=0.328  Sum_probs=14.7

Q ss_pred             EEEEcccCCCCCeEEEEEeec
Q psy5838         126 FLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .|.+......|...|+|.+.+
T Consensus        45 ~L~~~p~~eDdG~~~~C~a~~   65 (82)
T cd05883          45 QLMLKVTKEDDGVPVICLVDH   65 (82)
T ss_pred             EEEEECchhhCCCEEEEEEcC
Confidence            466666666666688998865


No 258
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=97.13  E-value=0.0027  Score=38.53  Aligned_cols=51  Identities=29%  Similarity=0.429  Sum_probs=37.5

Q ss_pred             eecCCEEEEEEccCCCceEEEEccCCe------EEEEEcccCCCCCeEEEEEeecCC
Q psy5838          98 QESDRGWYMCQVNTNPRISLTYNDHRS------WFLNIKNVQESDRGWYMCQVNTDP  148 (215)
Q Consensus        98 ~~~d~G~Y~C~~~~~~~~~~~~~~~~~------~~l~i~~~~~~d~G~Y~C~~~~~~  148 (215)
                      ...|.-..+|.+.+.|...+.|.....      ..+.+..+..+|.|.|+|.+.+..
T Consensus        12 ~~g~~~~l~C~~~~~p~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~g~y~C~~~~~~   68 (80)
T PF13895_consen   12 EEGDSVTLTCSVSGNPPPQVQWYKNGSPINSSQNGLFIPNVSPEDSGNYTCRASNGS   68 (80)
T ss_dssp             ETTSEEEEEEEEESSSSSEEEEEETTEEEEEESSEEEESSEEGGGTEEEEEEEEETT
T ss_pred             eCCCcEEEEEEEEcccceeeeeeeeeeeeeeeeeeeeeeeeccccCEEEEEEEEeCC
Confidence            345666778999988888888854221      116678889999999999997643


No 259
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=97.06  E-value=0.0027  Score=40.83  Aligned_cols=79  Identities=20%  Similarity=0.372  Sum_probs=51.2

Q ss_pred             CcEEEEEEeeccCC-ccceeeeEEEEEEecC--CccEEEeeec----ee--eeCCceEEEEcCCceEEEEEccceecCCE
Q psy5838          33 RDALLACVVDNLKG-FKGLRIGWQVAWVRVD--TQTILSIHHN----VI--TQNPRISLTYNDHRSWFLNIKNVQESDRG  103 (215)
Q Consensus        33 ~~v~L~C~~~~~~~-~~~~~~~~~v~W~~~~--~~~~~~~~~~----~~--~~~~~~~~~~~~~~~~~l~i~~~~~~d~G  103 (215)
                      .+|+|.|.+..... ....    +|.|.+..  ....+...+.    ..  ...+|+.+.......++|.|.|++.+|+|
T Consensus         1 ~~v~L~C~f~~~~~~~~~~----~V~W~k~~~~~~~~va~y~~~~g~~~~~~f~~Rv~f~~~~~~daSi~i~nl~~~D~G   76 (99)
T cd05886           1 TDVVLHCSFINPLPPVKIT----QVTWQKLTNGSKQNVAIYNPSMGVSVLPPYRERVTFKNPSFEDGTISLSRLELEDEG   76 (99)
T ss_pred             CcEEEEeEeecCCCCCCeE----EEEEEECCCCCceEEEEECCcCCcccCccccCcEEEcCCCCCcceEEEcCCccccCE
Confidence            36899999985322 2212    28887742  2222222221    11  23477777655557789999999999999


Q ss_pred             EEEEEccCCCce
Q psy5838         104 WYMCQVNTNPRI  115 (215)
Q Consensus       104 ~Y~C~~~~~~~~  115 (215)
                      .|+|.+.+.|.-
T Consensus        77 ~Y~C~v~t~P~g   88 (99)
T cd05886          77 VYICEFATFPTG   88 (99)
T ss_pred             EEEEEEEeCCCC
Confidence            999999886543


No 260
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=97.06  E-value=0.003  Score=40.37  Aligned_cols=33  Identities=27%  Similarity=0.518  Sum_probs=23.5

Q ss_pred             ceEEEeCCcEEEEEEeecc-CCccceeeeEEEEEEecCC
Q psy5838          26 NVTVTVGRDALLACVVDNL-KGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        26 ~~~~~~G~~v~L~C~~~~~-~~~~~~~~~~~v~W~~~~~   63 (215)
                      .-.+..|+.++|.|.+.+. .++ ...    +.|+|+++
T Consensus         8 ~~~l~~~~~~tLtC~v~gf~yP~-~i~----v~W~r~~~   41 (96)
T cd07696           8 PKQLLLTKSVKLTCLVTNLTSPE-GVN----VTWTRGSG   41 (96)
T ss_pred             HHHhccCCCeEEEEEEeCCCCCC-CcE----EEEEECCe
Confidence            3345568999999999988 333 232    89999544


No 261
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=97.04  E-value=0.0054  Score=37.90  Aligned_cols=23  Identities=13%  Similarity=0.385  Sum_probs=17.0

Q ss_pred             EEEEEEeecc-CCccceeeeEEEEEEecCCcc
Q psy5838          35 ALLACVVDNL-KGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        35 v~L~C~~~~~-~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      +.|.|.+.+. |.+.       +.|+++ +..
T Consensus         2 ~~L~C~~~~~~P~~~-------v~W~~~-~~~   25 (82)
T cd05761           2 VELTCTSSGSKPAAT-------IRWFKG-DKE   25 (82)
T ss_pred             EEEEEEecCcCcCCe-------EEEEEC-CEE
Confidence            6899999875 5555       999994 443


No 262
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=97.03  E-value=0.011  Score=37.65  Aligned_cols=28  Identities=25%  Similarity=0.475  Sum_probs=20.6

Q ss_pred             eCCcEEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          31 VGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      .|+.++|.|.+.+..+.. .    .+.|++ ++.
T Consensus        13 ~~~~~~L~C~~~gFyP~~-i----~v~W~~-~g~   40 (94)
T cd05766          13 LSHPHLLVCHVWGFYPPE-I----TVKWFK-NGQ   40 (94)
T ss_pred             CCCCeEEEEEEeeecCCC-C----EEEEEE-CCe
Confidence            588999999999864433 2    289999 444


No 263
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=97.02  E-value=0.0017  Score=41.38  Aligned_cols=38  Identities=18%  Similarity=0.312  Sum_probs=29.8

Q ss_pred             CcceeeecCCcEEEEEE-ecccCCCeEEEEeCCCccccc
Q psy5838         170 STDLVVREQANVTLNCK-AQGYPEPYVMWRREDGANLSY  207 (215)
Q Consensus       170 ~~~~~~~~g~~~~l~C~-~~~~p~~~i~W~~~~~~~~~~  207 (215)
                      ...+.+.+|+.+.|.|. ..|.|.|.|.|+.++...+..
T Consensus        10 ~~~v~V~eG~~~~L~C~pP~g~P~P~i~W~~~~~~~i~~   48 (95)
T cd05845          10 IRPVEVEEGDSVVLPCNPPKSAVPLRIYWMNSDLLHITQ   48 (95)
T ss_pred             cceeEEecCCCEEEEecCCCCCCCCEEEEECCCCccccc
Confidence            34667899999999998 599999999999843344443


No 264
>PHA02982 hypothetical protein; Provisional
Probab=97.00  E-value=0.003  Score=45.44  Aligned_cols=83  Identities=13%  Similarity=0.275  Sum_probs=53.2

Q ss_pred             CCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeee----------CCceEEEEcCCceEEE
Q psy5838          23 PIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQ----------NPRISLTYNDHRSWFL   92 (215)
Q Consensus        23 ~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~~l   92 (215)
                      ...++.+..|++|.|.|.+.....-.      ...|++.++..+.....+...-          .+.+.++..+ +..+|
T Consensus        30 d~~dv~a~vd~~V~L~C~~~~~~~i~------~~~W~~~~~~~la~~~~~~~~iN~~~y~~~~~kd~y~~sv~g-~~STL  102 (251)
T PHA02982         30 DTADVNATVDQEVKLQCLFKDADEIS------RAMWKGDAGFMLAQEANGGTGINAFNYVPGPYKDKYALSVSG-NSSTF  102 (251)
T ss_pred             chhhhhccCCCcEEEEecCCCcchhh------hheeeCCCCeEEEeeecCcceeccccccCCccceeEEEEEec-cceeE
Confidence            34467778899999999976432221      1789997766654222111111          1223333333 56789


Q ss_pred             EEccceecCCEEEEEEccCC
Q psy5838          93 NIKNVQESDRGWYMCQVNTN  112 (215)
Q Consensus        93 ~i~~~~~~d~G~Y~C~~~~~  112 (215)
                      .|.++..+..|.|+|.+...
T Consensus       103 TIkk~~i~N~GCYtc~~ks~  122 (251)
T PHA02982        103 TMKKPDPQNLGCFTCEAKDA  122 (251)
T ss_pred             EeccCCcccCCceEEEEecC
Confidence            99999999999999988753


No 265
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=96.98  E-value=0.0017  Score=38.85  Aligned_cols=44  Identities=27%  Similarity=0.455  Sum_probs=34.7

Q ss_pred             EEEEEEccCCC-ceEEEEc------c-------CCeEEEEEcccCCCCCeEEEEEeec
Q psy5838         103 GWYMCQVNTNP-RISLTYN------D-------HRSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       103 G~Y~C~~~~~~-~~~~~~~------~-------~~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      -..+|.+.+.+ ...+.|.      .       .....|.+.++..+|.|.|+|.|.+
T Consensus        18 ~~l~C~~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~~~L~i~~v~~~~~g~y~C~a~N   75 (75)
T PF13927_consen   18 VTLTCSAEGGPPPPSISWYDSNPSFNSNSRGSSSSNSTLTISNVTRSDNGTYTCIASN   75 (75)
T ss_dssp             EEEEEEESSEESSEEEEEETEEEEEEEEEEEEEEEEEEEEESSCCGGGTEEEEEEEEE
T ss_pred             EEEEEEEccccCCeEEEEEecCCceeeeeeeccceeeEEEEccCCHHhCcEEEEEEEC
Confidence            35679998877 8888886      1       2345699999999999999999863


No 266
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=96.98  E-value=0.0094  Score=37.92  Aligned_cols=28  Identities=32%  Similarity=0.617  Sum_probs=19.6

Q ss_pred             eCCcEEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          31 VGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      .|+..+|.|.+.+..+.. .    .+.|.+ ++.
T Consensus        14 ~~~~~tL~C~a~gFyP~~-I----~v~W~~-~g~   41 (94)
T cd05767          14 LGEPNTLICFVDNFFPPV-L----NVTWLK-NGV   41 (94)
T ss_pred             CCCCeEEEEEEEEEECCc-C----EEEEEE-CCe
Confidence            466789999999864433 2    289999 444


No 267
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=96.98  E-value=0.014  Score=37.09  Aligned_cols=29  Identities=14%  Similarity=0.308  Sum_probs=20.3

Q ss_pred             eCCcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          31 VGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      .|+..+|.|.+.+..++..     .+.|+| ++..
T Consensus        14 ~g~~~~L~C~a~gFyP~~i-----~v~W~~-dg~~   42 (93)
T cd05770          14 NGKPNVLNCYVTGFHPPDI-----EIRLLK-NGVK   42 (93)
T ss_pred             CCCceEEEEEEEEEeCCCC-----EEEEEE-CCEE
Confidence            4667799999998644432     289999 5543


No 268
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=96.95  E-value=0.0023  Score=40.18  Aligned_cols=35  Identities=26%  Similarity=0.396  Sum_probs=28.0

Q ss_pred             cceeeecCCcEEEEEEecccCCCeEEEEeCCCccccc
Q psy5838         171 TDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSY  207 (215)
Q Consensus       171 ~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~  207 (215)
                      ..+.+.+|+++.|.|.+.+ |.+.+.|++ ++..+..
T Consensus         4 ~~~~v~~g~~v~L~C~~~~-p~~~i~W~k-~~~~~~~   38 (89)
T cd04979           4 KVVTVVEGNSVFLECSPKS-NLASVVWLF-QGGPLQR   38 (89)
T ss_pred             eEEEEECCCcEEEEEeCCC-CCceEEEEE-CCccccc
Confidence            3456789999999999987 778999999 6655543


No 269
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=96.93  E-value=0.0011  Score=39.82  Aligned_cols=25  Identities=44%  Similarity=0.826  Sum_probs=20.6

Q ss_pred             EEEEEEecccCCCeEEEEeCCCcccc
Q psy5838         181 VTLNCKAQGYPEPYVMWRREDGANLS  206 (215)
Q Consensus       181 ~~l~C~~~~~p~~~i~W~~~~~~~~~  206 (215)
                      +.|.|.+.|.|.|.+.|++ ++..+.
T Consensus         1 ~~L~C~~~G~P~P~v~W~k-~~~~~~   25 (71)
T cd05876           1 LVLECIAEGLPTPEVHWDR-IDGPLS   25 (71)
T ss_pred             CEEEEEeeEecCCeEEEEE-CCcCCC
Confidence            4689999999999999999 555443


No 270
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=96.92  E-value=0.01  Score=37.34  Aligned_cols=25  Identities=28%  Similarity=0.328  Sum_probs=21.6

Q ss_pred             eEEEEEcccCCCCCeEEEEEeecCC
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNTDP  148 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~~~  148 (215)
                      +.+|.|.+++.+|+|.|+|.+....
T Consensus        56 ~~sL~I~~l~~~DsG~Y~c~v~~~~   80 (92)
T cd05741          56 NGSLLIQNLTKEDSGTYTLQIISTN   80 (92)
T ss_pred             CceEEEccCCchhcEEEEEEEEcCC
Confidence            3679999999999999999996543


No 271
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=96.91  E-value=0.0056  Score=38.97  Aligned_cols=28  Identities=21%  Similarity=0.478  Sum_probs=19.5

Q ss_pred             eCCcEEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          31 VGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      .++.++|.|.+.+..+.. .    .+.|++ ++.
T Consensus        13 ~~~~~~L~C~a~gFyP~~-I----~vtW~~-dg~   40 (94)
T cd05847          13 TSETIQLLCLISGYTPGT-I----EVEWLV-DGQ   40 (94)
T ss_pred             CCCCEEEEEEEEeEECCC-C----EEEEEE-CCE
Confidence            456799999999864442 2    289999 444


No 272
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=96.90  E-value=0.0055  Score=38.02  Aligned_cols=22  Identities=18%  Similarity=0.339  Sum_probs=15.3

Q ss_pred             EEEEcccCCCCCeEEEEEeecC
Q psy5838         126 FLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      .|.+......+...|+|.+.+.
T Consensus        47 ~l~~~~~~~d~g~~~tC~v~h~   68 (83)
T cd07705          47 SVEFQVTREDDGAEITCSVGHE   68 (83)
T ss_pred             EEEEEecchhCCCEEEEEEECc
Confidence            3666666666777888888654


No 273
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=96.86  E-value=0.0065  Score=40.19  Aligned_cols=31  Identities=16%  Similarity=0.389  Sum_probs=21.1

Q ss_pred             EEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          28 TVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        28 ~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      ....++.++|.|.+.+..+.. .    .+.|++ ++.
T Consensus        14 e~~~~~~~tL~Cla~gFyP~~-I----~V~W~k-ng~   44 (115)
T cd05769          14 EIRNKRKATLVCLATGFYPDH-V----SLSWKV-NGK   44 (115)
T ss_pred             HhccCCCcEEEEEEEeEeCCC-c----EEEEEE-CCE
Confidence            333567899999999864432 2    189999 444


No 274
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=96.84  E-value=0.0027  Score=41.29  Aligned_cols=78  Identities=22%  Similarity=0.387  Sum_probs=48.2

Q ss_pred             eCCcEEEEEEeeccCC---ccceeeeEEEEEEecC--C--c-cEEEeeeceee----eCCceEEEEcCCceEEEEEccce
Q psy5838          31 VGRDALLACVVDNLKG---FKGLRIGWQVAWVRVD--T--Q-TILSIHHNVIT----QNPRISLTYNDHRSWFLNIKNVQ   98 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~---~~~~~~~~~v~W~~~~--~--~-~~~~~~~~~~~----~~~~~~~~~~~~~~~~l~i~~~~   98 (215)
                      .|++|+|+|.+...+.   .....    +.|++..  .  . .++........    ...|+..........+|.|.+++
T Consensus         1 ~G~~V~L~C~~~~~~~~~~~~~~~----i~W~k~~~~~~~~~~v~~~~~~~~~~~~~~~~r~~~~~~~~~~~sL~I~~v~   76 (106)
T cd05714           1 LGGNVTLPCRFHLEPALSAPHGPR----IKWTKLESDGAKEVDVLVAIGGRVKVYGSGRVRVPLYPADPGDASLVITDLR   76 (106)
T ss_pred             CCCCEEEeEEeECCcccCCCCCcE----EEEEEeCCCCCceEEEEEEcCCEEEEcCCCceEEEeeCCCCCcceEEECCCC
Confidence            4899999999986531   12222    8999862  1  1 12221111111    12233332223467899999999


Q ss_pred             ecCCEEEEEEccCC
Q psy5838          99 ESDRGWYMCQVNTN  112 (215)
Q Consensus        99 ~~d~G~Y~C~~~~~  112 (215)
                      .+|+|.|.|.+.+.
T Consensus        77 ~sD~G~Y~C~v~~~   90 (106)
T cd05714          77 LEDSGRYRCEVIDG   90 (106)
T ss_pred             HHHCEEEEEEEEcC
Confidence            99999999998764


No 275
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=96.82  E-value=0.0043  Score=39.58  Aligned_cols=76  Identities=21%  Similarity=0.382  Sum_probs=47.2

Q ss_pred             CcEEEEEEeeccCCccceeeeEEEEEEecCCc--cEEEeeec----ee--eeCCceEEEEcCCceEEEEEccceecCCEE
Q psy5838          33 RDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ--TILSIHHN----VI--TQNPRISLTYNDHRSWFLNIKNVQESDRGW  104 (215)
Q Consensus        33 ~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~--~~~~~~~~----~~--~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~  104 (215)
                      ++|+|.|.+.........    .+.|+|....  ..+.....    ..  ....|+.+........+|.|.+++.+|+|.
T Consensus         1 ~~v~L~C~~~~~~~~~~~----~v~W~k~~~~~~~~i~~~~~~~~~~~~~~~~~R~~~~~~~~~~~sL~I~~v~~~D~G~   76 (98)
T cd05718           1 ESVTLECSFPVPGPVQIT----QVTWMKITGGSKQNIAVFHPQYGISIPPSYEGRVSFLNSSLEDATISISNLRLEDEGN   76 (98)
T ss_pred             CCEEEEeEeeCCCCceEE----EEEEeeECCCCCEEEEEEecCCCcccCcCcCceEEEeCCCCCceEEEEccCCcccCEE
Confidence            579999999865422222    2899996532  11111110    01  113455544433367899999999999999


Q ss_pred             EEEEccCC
Q psy5838         105 YMCQVNTN  112 (215)
Q Consensus       105 Y~C~~~~~  112 (215)
                      |.|.+...
T Consensus        77 Y~C~v~~~   84 (98)
T cd05718          77 YICEFATF   84 (98)
T ss_pred             EEEEEEeC
Confidence            99987653


No 276
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=96.82  E-value=0.0038  Score=40.57  Aligned_cols=78  Identities=18%  Similarity=0.299  Sum_probs=49.3

Q ss_pred             eCCcEEEEEEeeccC---CccceeeeEEEEEEecCCc--c--EEEeeece-----eeeCCceEEEEcCCceEEEEEccce
Q psy5838          31 VGRDALLACVVDNLK---GFKGLRIGWQVAWVRVDTQ--T--ILSIHHNV-----ITQNPRISLTYNDHRSWFLNIKNVQ   98 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~---~~~~~~~~~~v~W~~~~~~--~--~~~~~~~~-----~~~~~~~~~~~~~~~~~~l~i~~~~   98 (215)
                      .|++|+|+|.+...+   .....    .+.|+|....  .  ........     .....|+.+........+|.|.+++
T Consensus         1 ~G~~vtL~C~~~~~~~~~~~~~~----~v~W~k~~~~~~~~~~~~~~~~~~~~~~~~~~~R~~~~~~~~~~~sL~I~~v~   76 (106)
T cd05877           1 RGGNVTLPCRYHYEPELSAPRKI----RVKWTKLESDYLKEEDVLVAIGTRHKSYGSYQGRVFLRRAHDLDASLVITDLR   76 (106)
T ss_pred             CCCcEEEEeEeECCCcCCCCccc----eEEEEEecCCCCeeEEEEEEcCcEEEeccCccCcEEecCCCCCcEEEEEccCC
Confidence            489999999987653   11112    2899996421  1  11111111     1123566665443457799999999


Q ss_pred             ecCCEEEEEEccCC
Q psy5838          99 ESDRGWYMCQVNTN  112 (215)
Q Consensus        99 ~~d~G~Y~C~~~~~  112 (215)
                      .+|+|.|.|.+.+.
T Consensus        77 ~~DsG~Y~C~v~~~   90 (106)
T cd05877          77 LEDYGRYRCEVIDG   90 (106)
T ss_pred             hHHCEEEEEEEEec
Confidence            99999999988653


No 277
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=96.82  E-value=0.0096  Score=36.92  Aligned_cols=22  Identities=18%  Similarity=0.371  Sum_probs=14.9

Q ss_pred             EEEEcccCCCCCeEEEEEeecC
Q psy5838         126 FLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      .|.+......+...|+|.+.+.
T Consensus        47 ~L~~~~~~~d~g~~ytC~v~h~   68 (83)
T cd05884          47 TLDFRVDRSDDGVAIICRVDHE   68 (83)
T ss_pred             EEEEEcccccCCCEEEEEEech
Confidence            4666655556667899998653


No 278
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=96.80  E-value=0.0022  Score=42.20  Aligned_cols=47  Identities=28%  Similarity=0.442  Sum_probs=32.1

Q ss_pred             EEcCCeEEecCCCcceeeecCCcEEEEEEecc-cCC-CeEEEEeCCCcccc
Q psy5838         158 VVVPPSIIDKDTSTDLVVREQANVTLNCKAQG-YPE-PYVMWRREDGANLS  206 (215)
Q Consensus       158 v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~-~p~-~~i~W~~~~~~~~~  206 (215)
                      |.++|...+...+ ......|+.++|.|.+.+ +|. ..++|++ ||+.+.
T Consensus         2 v~~~P~~p~i~~~-~~~~~~g~~~tL~C~a~gF~P~~i~v~W~k-ng~~~~   50 (111)
T cd05772           2 VRAKPSVPVVSGP-SGRANPGQSVNFTCSAHGFSPRDITVKWLK-NGNELS   50 (111)
T ss_pred             cccCCCCcEeCCc-hhccCCCCCEEEEEEEeeEeCCCCEEEEEE-CCEECc
Confidence            3456665544222 333457888999999988 565 4899999 887764


No 279
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=96.78  E-value=0.0049  Score=39.28  Aligned_cols=22  Identities=32%  Similarity=0.732  Sum_probs=19.8

Q ss_pred             EEEEEcccCCCCCeEEEEEeec
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ..|.|.++..+|+|.|+|.+.+
T Consensus        55 ~~L~I~~v~~~D~G~YtC~~~~   76 (95)
T cd05897          55 TYLHIIDVSLNDSGYYTCKLQF   76 (95)
T ss_pred             CEEEEEEcChhhCEEEEEEEEE
Confidence            4699999999999999999965


No 280
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=96.77  E-value=0.02  Score=34.69  Aligned_cols=22  Identities=36%  Similarity=0.564  Sum_probs=19.9

Q ss_pred             EEEEEcccCCCCCeEEEEEeec
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ..|.|.+++.+|.|.|.|.+..
T Consensus        51 ~~l~i~~~~~~d~G~Y~C~v~~   72 (86)
T smart00410       51 STLTISNVTPEDSGTYTCAATN   72 (86)
T ss_pred             eEEEEEeeccccCeEEEEEEEc
Confidence            5699999999999999999974


No 281
>smart00409 IG Immunoglobulin.
Probab=96.77  E-value=0.02  Score=34.69  Aligned_cols=22  Identities=36%  Similarity=0.564  Sum_probs=19.9

Q ss_pred             EEEEEcccCCCCCeEEEEEeec
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ..|.|.+++.+|.|.|.|.+..
T Consensus        51 ~~l~i~~~~~~d~G~Y~C~v~~   72 (86)
T smart00409       51 STLTISNVTPEDSGTYTCAATN   72 (86)
T ss_pred             eEEEEEeeccccCeEEEEEEEc
Confidence            5699999999999999999974


No 282
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=96.76  E-value=0.0019  Score=40.62  Aligned_cols=25  Identities=36%  Similarity=1.012  Sum_probs=22.3

Q ss_pred             CCcEEEEEEecccCCCeEEEEeCCCc
Q psy5838         178 QANVTLNCKAQGYPEPYVMWRREDGA  203 (215)
Q Consensus       178 g~~~~l~C~~~~~p~~~i~W~~~~~~  203 (215)
                      |+++.|.|.+.+.|.|.+.|++ +|.
T Consensus         1 G~~v~L~C~~~g~P~p~v~W~k-~g~   25 (90)
T cd05726           1 GRTVTFQCEATGNPQPAIFWQK-EGS   25 (90)
T ss_pred             CCEEEEEEECCccCCCEEEEEe-CCC
Confidence            6889999999999999999999 444


No 283
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=96.73  E-value=0.0076  Score=37.14  Aligned_cols=44  Identities=11%  Similarity=0.258  Sum_probs=28.4

Q ss_pred             EEEEEccC-CCceEEEEccCC---------------------eEEEEEcccCCCCCeEEEEEeecC
Q psy5838         104 WYMCQVNT-NPRISLTYNDHR---------------------SWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       104 ~Y~C~~~~-~~~~~~~~~~~~---------------------~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      +.+|.+.+ .|.+.++|....                     ...|.+......|.|.|+|.+.+.
T Consensus         3 ~L~C~v~g~~P~~~v~W~~~g~~l~~~~~~~~~~~~~~~~~~~s~L~i~~~~~~~~~~y~C~a~n~   68 (82)
T cd05759           3 NLTCRARGAKPAAEIIWFRDGEVLDGATYSKELLKDGKRETTVSTLPITPSDHDTGRTFTCRARNE   68 (82)
T ss_pred             EEEEEEeCccCCCEEEEEECCEEccCceeeeeEecCCCeEEEEEEEEEeCceecCCCEEEEEEcCc
Confidence            34677765 566677772210                     124667666667888999999653


No 284
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=96.73  E-value=0.011  Score=35.88  Aligned_cols=25  Identities=32%  Similarity=0.662  Sum_probs=17.0

Q ss_pred             cEEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          34 DALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        34 ~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      .++|.|.+.+..++. .    .+.|+| +++
T Consensus         1 ~~~L~C~a~gf~P~~-i----~v~W~k-~g~   25 (75)
T smart00407        1 KATLVCLVSGFYPPD-I----TVTWLR-NGQ   25 (75)
T ss_pred             CeEEEEEEEeEeCCC-C----EEEEEE-CCE
Confidence            368999999863332 1    189999 444


No 285
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=96.69  E-value=0.0055  Score=39.48  Aligned_cols=19  Identities=37%  Similarity=0.704  Sum_probs=9.9

Q ss_pred             EEEcccCCCCCeEEEEEee
Q psy5838         127 LNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       127 l~i~~~~~~d~G~Y~C~~~  145 (215)
                      |.|.+++.+|+|.|.|.+.
T Consensus        66 L~I~nv~~sD~GtY~C~v~   84 (100)
T cd05888          66 LILRNAVQADEGKYKCRVI   84 (100)
T ss_pred             EEEecCccccceEEEEEEE
Confidence            4455555555555555543


No 286
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=96.63  E-value=0.005  Score=39.43  Aligned_cols=22  Identities=32%  Similarity=0.584  Sum_probs=10.9

Q ss_pred             eEEEEEccceecCCEEEEEEcc
Q psy5838          89 SWFLNIKNVQESDRGWYMCQVN  110 (215)
Q Consensus        89 ~~~l~i~~~~~~d~G~Y~C~~~  110 (215)
                      +++|.|.+++.+|+|.|.|.+.
T Consensus        60 ~~sL~I~~~~~~DsG~Y~c~v~   81 (97)
T cd05775          60 DYSLQISNLKMEDAGSYRAEIN   81 (97)
T ss_pred             ceeEEECCCchHHCEEEEEEEE
Confidence            3455555555555444444443


No 287
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=96.62  E-value=0.0066  Score=39.86  Aligned_cols=78  Identities=22%  Similarity=0.457  Sum_probs=49.7

Q ss_pred             eCCcEEEEEEeeccCCc-------cceeeeEEEEEEecC-Ccc--EEEeeecee----eeCCceEEEE--cCCceEEEEE
Q psy5838          31 VGRDALLACVVDNLKGF-------KGLRIGWQVAWVRVD-TQT--ILSIHHNVI----TQNPRISLTY--NDHRSWFLNI   94 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~-------~~~~~~~~v~W~~~~-~~~--~~~~~~~~~----~~~~~~~~~~--~~~~~~~l~i   94 (215)
                      .|++|+|+|.+......       ...    .+.|+|.+ +..  ++....+..    ...+|+.+..  ......+|.|
T Consensus         1 ~G~~V~LpC~~~~~~~~~~~~~~~~~~----~i~W~k~~~~~~~~v~~~~~~~~~~~~~f~gR~~~~~~~~~~~~asL~I   76 (110)
T cd05878           1 LSSSVLLPCYFTLPPALPPPSNAPESP----RIKWTKLSGQKEVTVLVAQDGVVKVGQEYQGRVSLPNYPENRGDASLEI   76 (110)
T ss_pred             CCCCEEEeeEeeCCccccccccCCCCC----EEEEEEecCCCcEEEEEEECCEEEecccccCeEEeccCCCCCCcEEEEE
Confidence            48999999999865421       112    28999863 222  221222221    1235666543  2346788999


Q ss_pred             ccceecCCEEEEEEccCC
Q psy5838          95 KNVQESDRGWYMCQVNTN  112 (215)
Q Consensus        95 ~~~~~~d~G~Y~C~~~~~  112 (215)
                      .+++.+|+|.|.|.+...
T Consensus        77 ~~l~~sD~G~Y~C~v~~~   94 (110)
T cd05878          77 SRLRSSDSGVYRCEVMHG   94 (110)
T ss_pred             CCCChhhCEEEEEEEEeC
Confidence            999999999999988653


No 288
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=96.58  E-value=0.0031  Score=38.75  Aligned_cols=25  Identities=32%  Similarity=0.620  Sum_probs=21.1

Q ss_pred             EEEEEEecc-cCCCeEEEEeCCCcccc
Q psy5838         181 VTLNCKAQG-YPEPYVMWRREDGANLS  206 (215)
Q Consensus       181 ~~l~C~~~~-~p~~~i~W~~~~~~~~~  206 (215)
                      +.|.|.+.+ .|++.|+|++ |++.+.
T Consensus         2 ~~L~C~s~~skP~a~i~W~k-~~~~l~   27 (80)
T cd05885           2 VELTCLSPRSKPAATLRWYR-DRKELK   27 (80)
T ss_pred             EEEEEeCCCccCCCeEEEEE-CCEECC
Confidence            689999854 8999999999 777764


No 289
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=96.57  E-value=0.0052  Score=35.84  Aligned_cols=23  Identities=17%  Similarity=0.505  Sum_probs=17.0

Q ss_pred             EeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          30 TVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        30 ~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      .-|.+|+|+|....   ..       +.|.+++
T Consensus         5 isGTtVtlTCP~~~---~~-------i~W~~n~   27 (65)
T cd07692           5 ISGTTVTVTCPLSG---DD-------IKWKKND   27 (65)
T ss_pred             EeccEEEEECCCCC---CC-------ceEEeCC
Confidence            35889999998652   22       8899965


No 290
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=96.56  E-value=0.019  Score=35.45  Aligned_cols=25  Identities=24%  Similarity=0.610  Sum_probs=18.8

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      ++.++|.|.+.+..... ..    +.|+++
T Consensus         8 ~~~~~L~C~v~~f~P~~-i~----v~W~~~   32 (83)
T PF07654_consen    8 GGSVTLTCLVSGFYPKD-IT----VTWLKN   32 (83)
T ss_dssp             TSEEEEEEEEEEEBSST-EE----EEEEET
T ss_pred             CCCEEEEEEEEEEECCC-cE----EEEEec
Confidence            78999999999864432 22    899984


No 291
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=96.54  E-value=0.0045  Score=38.57  Aligned_cols=28  Identities=29%  Similarity=0.509  Sum_probs=23.2

Q ss_pred             CcEEEEEEecccCCC--eEEEEeCCCccccc
Q psy5838         179 ANVTLNCKAQGYPEP--YVMWRREDGANLSY  207 (215)
Q Consensus       179 ~~~~l~C~~~~~p~~--~i~W~~~~~~~~~~  207 (215)
                      +++.|.|.+.|.|.|  .+.|++ ||..+..
T Consensus         1 ~~~~L~C~a~g~P~p~~~v~W~~-~g~~i~~   30 (85)
T cd05854           1 ENLTLQCHASHDPTMDLTFTWSL-DDFPIDL   30 (85)
T ss_pred             CcEEEEEEEecCCCCCeEEEEEE-CCeEccc
Confidence            468999999999877  589999 8877754


No 292
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=96.54  E-value=0.0062  Score=38.86  Aligned_cols=33  Identities=24%  Similarity=0.399  Sum_probs=27.4

Q ss_pred             ceeeecCCcEEEEEEe-cccCCCeEEEEeCCCccc
Q psy5838         172 DLVVREQANVTLNCKA-QGYPEPYVMWRREDGANL  205 (215)
Q Consensus       172 ~~~~~~g~~~~l~C~~-~~~p~~~i~W~~~~~~~~  205 (215)
                      ...+.+|..+.|.|.. .|.|.+.+.|++ ++..+
T Consensus        12 ~~~v~eG~~~~L~C~pP~g~P~p~~~W~k-~~~~~   45 (96)
T cd05727          12 EVKVKEGWGVVLFCDPPPHYPDLSYRWLL-NEFPN   45 (96)
T ss_pred             ceeeeeCCcEEEeeCCCCCCCCCEEEEEE-CCccc
Confidence            4558899999999987 678999999999 66543


No 293
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=96.49  E-value=0.0075  Score=39.02  Aligned_cols=29  Identities=21%  Similarity=0.504  Sum_probs=20.9

Q ss_pred             EEEeCCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          28 TVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        28 ~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      .+..|+.++|.|.+.+..... ..    +.|+++
T Consensus        12 ~~~~~~~~tL~C~a~gFyP~~-i~----v~W~k~   40 (102)
T cd05768          12 ELSLQETATLTCLVKGFSPSD-IF----VKWLQN   40 (102)
T ss_pred             HhCcCCceEEEEEEeeEeCCC-CE----EEEEEC
Confidence            334578899999999865443 22    899994


No 294
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=96.48  E-value=0.0066  Score=39.13  Aligned_cols=32  Identities=22%  Similarity=0.353  Sum_probs=21.9

Q ss_pred             EEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          28 TVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        28 ~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      ....++.++|.|.+.+..... ..    +.|++ ++..
T Consensus        13 ~~~~~~~~~L~C~~~gfyP~~-i~----v~W~~-~g~~   44 (100)
T cd07699          13 ELEKSGKATLVCLINDFYPGF-AT----VQWKV-DGAT   44 (100)
T ss_pred             HHccCCCcEEEEEEEeEECCC-CE----EEEEE-CCEE
Confidence            344678899999999865322 22    89999 4443


No 295
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=96.47  E-value=0.0088  Score=38.22  Aligned_cols=22  Identities=41%  Similarity=0.534  Sum_probs=12.9

Q ss_pred             EEEEEcccCCCCCeEEEEEeec
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .+|.|.+++.+|+|.|.|.+..
T Consensus        61 ~sL~I~nv~~~D~G~Y~C~~~~   82 (97)
T cd05846          61 TSITIWNVTLEDEGCYKCIFNT   82 (97)
T ss_pred             cEEEEeCCceeeeEEEEEEEEe
Confidence            3455666666666666666543


No 296
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=96.46  E-value=0.0075  Score=39.24  Aligned_cols=21  Identities=43%  Similarity=0.564  Sum_probs=11.7

Q ss_pred             EEEEccceecCCEEEEEEccC
Q psy5838          91 FLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        91 ~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      +|.|++++.+|+|.|+|.+.+
T Consensus        71 SL~I~~v~~~D~G~Y~~~v~~   91 (105)
T cd05774          71 SLLIQNVTQKDTGFYTLQTIT   91 (105)
T ss_pred             cEEEecCCcccCEEEEEEEEe
Confidence            566665555555555554443


No 297
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=96.44  E-value=0.018  Score=36.01  Aligned_cols=26  Identities=15%  Similarity=0.379  Sum_probs=18.9

Q ss_pred             CCcEEEEEEeec-cCCccceeeeEEEEEEecCCc
Q psy5838          32 GRDALLACVVDN-LKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        32 G~~v~L~C~~~~-~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      |+.+.|.|...+ .|.+.       +.|+.+++.
T Consensus        14 ~~~~~~~C~s~~~~P~~~-------i~W~~~~~~   40 (89)
T PF08205_consen   14 GEEVTLTCSSSGGYPPPQ-------ITWYLDGGP   40 (89)
T ss_dssp             TEEEEEEEEEEEEBS-EE-------EEEEETTCE
T ss_pred             ceEEEEEEEeCCeECCeE-------EEEEECCCc
Confidence            679999997664 56666       999995443


No 298
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=96.44  E-value=0.011  Score=39.16  Aligned_cols=22  Identities=27%  Similarity=0.507  Sum_probs=12.9

Q ss_pred             EEEEEcccCCCCCeEEEEEeec
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .+|.|.+++.+|.|.|+|.+.+
T Consensus        80 aSI~I~nv~~sD~G~Y~C~v~n  101 (116)
T cd05879          80 GSIVIHNLDYTDNGTFTCDVKN  101 (116)
T ss_pred             eEEEEccCCcccCEEEEEEEEc
Confidence            3455666666666666666544


No 299
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=96.44  E-value=0.014  Score=38.03  Aligned_cols=25  Identities=32%  Similarity=0.485  Sum_probs=21.8

Q ss_pred             CCeEEEEEcccCCCCCeEEEEEeec
Q psy5838         122 HRSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       122 ~~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .....|.|.+++.+|+|.|.|.+..
T Consensus        67 ~~~~~L~I~~~~~~DsG~Y~C~~~~   91 (109)
T cd04983          67 RKSSSLHISAAQLSDSAVYFCALSE   91 (109)
T ss_pred             CCEEEEEECCCCHHHCEEEEEEEec
Confidence            3567899999999999999999864


No 300
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=96.41  E-value=0.01  Score=39.12  Aligned_cols=21  Identities=33%  Similarity=0.582  Sum_probs=14.8

Q ss_pred             EEEEEcccCCCCCeEEEEEee
Q psy5838         125 WFLNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~  145 (215)
                      ..|.|.+++.+|+|.|.|.+.
T Consensus        74 asL~I~nl~~sDsG~Y~C~V~   94 (112)
T cd05900          74 ATLEITELRSNDSGTYRCEVM   94 (112)
T ss_pred             cEEEEeecccccCEEEEEEEe
Confidence            446677777777777777775


No 301
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=96.40  E-value=0.015  Score=37.26  Aligned_cols=33  Identities=21%  Similarity=0.466  Sum_probs=23.3

Q ss_pred             eEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          27 VTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        27 ~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      -....+..++|.|.+.+...+....    |.|.++++
T Consensus        14 e~l~~~~~atLtClV~~f~~P~~i~----V~W~~~g~   46 (99)
T cd04986          14 EDLLLGSSASLTCTLSGLRDPEGAV----FTWTPSGG   46 (99)
T ss_pred             HHhCcCCccEEEEEEeccCCCCCeE----EEEEECCc
Confidence            3344688999999999866344443    89988543


No 302
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=96.39  E-value=0.0066  Score=37.70  Aligned_cols=28  Identities=25%  Similarity=0.616  Sum_probs=23.1

Q ss_pred             CcEEEEEEecccCCC--eEEEEeCCCccccc
Q psy5838         179 ANVTLNCKAQGYPEP--YVMWRREDGANLSY  207 (215)
Q Consensus       179 ~~~~l~C~~~~~p~~--~i~W~~~~~~~~~~  207 (215)
                      +++.|.|.+.|.|.|  .+.|++ +|+.+..
T Consensus         1 e~~~L~C~~~g~P~p~i~~~W~~-~g~~i~~   30 (85)
T cd04970           1 ESITLQCHASHDPTLDLTFTWSF-NGVPIDF   30 (85)
T ss_pred             CcEEEEEEEecCCCCCeEEEEEE-CCeEeec
Confidence            468999999999877  579999 8887754


No 303
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=96.30  E-value=0.033  Score=35.58  Aligned_cols=28  Identities=18%  Similarity=0.398  Sum_probs=19.7

Q ss_pred             eCCcEEEEEEeeccCCccceeeeEEEEEEecCCc
Q psy5838          31 VGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQ   64 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~   64 (215)
                      .+..++|.|.+.+..+.. .    .+.|.+ ++.
T Consensus        15 ~~~~~tL~C~a~gFyP~~-I----~v~W~k-ng~   42 (96)
T cd07697          15 KQGQGIYLCLLENFFPDV-I----QVHWRE-GNS   42 (96)
T ss_pred             cCCCEEEEEEEEEEeCCC-e----EEEEEE-CCE
Confidence            456789999999864433 2    289999 444


No 304
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=96.28  E-value=0.03  Score=36.79  Aligned_cols=32  Identities=13%  Similarity=0.366  Sum_probs=22.3

Q ss_pred             EEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCcc
Q psy5838          28 TVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT   65 (215)
Q Consensus        28 ~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~   65 (215)
                      ....|+.++|.|.+.+......     .+.|+| ++..
T Consensus        17 ~~~~g~~~tL~C~a~gF~P~~i-----~v~W~k-ng~~   48 (111)
T cd05772          17 RANPGQSVNFTCSAHGFSPRDI-----TVKWLK-NGNE   48 (111)
T ss_pred             ccCCCCCEEEEEEEeeEeCCCC-----EEEEEE-CCEE
Confidence            3446888999999998644321     189999 5544


No 305
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.24  E-value=0.019  Score=36.96  Aligned_cols=25  Identities=32%  Similarity=0.559  Sum_probs=22.0

Q ss_pred             CeEEEEEcccCCCCCeEEEEEeecC
Q psy5838         123 RSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       123 ~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ....|.|.+++.+|+|.|.|.+...
T Consensus        65 ~~~sL~I~~v~~~D~G~Y~C~v~~~   89 (105)
T cd00099          65 SSFTLTISSLQPEDSAVYYCAVSLS   89 (105)
T ss_pred             CEEEEEECCCCHHHCEEEEEEEecC
Confidence            5678999999999999999999653


No 306
>KOG3515|consensus
Probab=96.23  E-value=0.035  Score=47.96  Aligned_cols=45  Identities=16%  Similarity=0.368  Sum_probs=29.9

Q ss_pred             EEEEEcCCeEEecCCCcceeeecCCcEEEEEEec-ccCCCeEEEEeC
Q psy5838         155 YLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQ-GYPEPYVMWRRE  200 (215)
Q Consensus       155 ~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~-~~p~~~i~W~~~  200 (215)
                      .+.+..++....+ ......+..|.+..+.|... .+|.+.+.|++.
T Consensus       293 ~tav~~~~~~~~I-st~~~~ls~g~s~r~~c~~sss~p~~~i~w~~~  338 (741)
T KOG3515|consen  293 ITAVQVKPTAVPI-STSDSGLSSGRSARSSCVSSSSKPPAHIAWYKD  338 (741)
T ss_pred             eeecccccccccc-cCcccccccccccccceeccCCCCccceeeecc
Confidence            3444455544333 33344478899999998764 578889999993


No 307
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=96.19  E-value=0.047  Score=34.36  Aligned_cols=23  Identities=17%  Similarity=0.313  Sum_probs=20.1

Q ss_pred             eEEEEEcccCCCCCeEEEEEeec
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ...+.|.+++.+|+|.|+|...+
T Consensus        52 ~~~f~i~~v~~~~~G~Y~C~~~~   74 (91)
T cd05751          52 KAKFFIPSMKREHAGRYRCYYRS   74 (91)
T ss_pred             eEEEEccCCChhHCEEEEEEEEC
Confidence            45589999999999999999865


No 308
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=96.18  E-value=0.012  Score=38.55  Aligned_cols=77  Identities=26%  Similarity=0.391  Sum_probs=49.1

Q ss_pred             eCCcEEEEEEeeccCCc----cceeeeEEEEEEecC---Cc--cEEEe-eece----eeeCCceEEEEcC--CceEEEEE
Q psy5838          31 VGRDALLACVVDNLKGF----KGLRIGWQVAWVRVD---TQ--TILSI-HHNV----ITQNPRISLTYND--HRSWFLNI   94 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~----~~~~~~~~v~W~~~~---~~--~~~~~-~~~~----~~~~~~~~~~~~~--~~~~~l~i   94 (215)
                      .|++|+|+|.+...+..    ..++    +.|.+..   +.  ..+.. ....    -...+|+.+....  ....+|.|
T Consensus         1 ~~~~v~LpC~~~~~p~~~~~~~~~~----I~W~k~~~~~~~~~~~v~v~~~~~~~~~~~y~gRvsl~~~~~~~~~asL~i   76 (110)
T cd05902           1 LSSSVLLPCVFTLPPSASSPPEGPR----IKWTKLRPASGQKQRPVLVARDNVVRVAKAFQGRVSLPGYPKNRYNASLVL   76 (110)
T ss_pred             CCCcEEEeeEEEcCccccCCCCCCE----EEEEEeCCCCCceEEEEEECCCCcEEEchhcccEEEeecCCCCCceEEEEE
Confidence            47899999998754321    2344    7887752   11  11111 1111    1334677776532  35789999


Q ss_pred             ccceecCCEEEEEEccC
Q psy5838          95 KNVQESDRGWYMCQVNT  111 (215)
Q Consensus        95 ~~~~~~d~G~Y~C~~~~  111 (215)
                      .+++.+|+|.|.|.+..
T Consensus        77 ~nv~~~D~G~Y~C~v~~   93 (110)
T cd05902          77 SRLRYSDSGTYRCEVVL   93 (110)
T ss_pred             CCCCHHHCEEEEEEEEE
Confidence            99999999999998764


No 309
>PF08204 V-set_CD47:  CD47 immunoglobulin-like domain;  InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ].; PDB: 2VSC_B 2JJS_D 2JJT_C.
Probab=96.14  E-value=0.013  Score=39.43  Aligned_cols=35  Identities=20%  Similarity=0.498  Sum_probs=17.8

Q ss_pred             EEeCCcEEEEEEeeccCC--ccceeeeEEEEEEecCCccEEE
Q psy5838          29 VTVGRDALLACVVDNLKG--FKGLRIGWQVAWVRVDTQTILS   68 (215)
Q Consensus        29 ~~~G~~v~L~C~~~~~~~--~~~~~~~~~v~W~~~~~~~~~~   68 (215)
                      ....++|.|+|.+.....  ...+    .+.|.. ++..++.
T Consensus        24 t~CN~tV~IPC~v~n~~~~ni~~m----~VkWk~-~~~~If~   60 (130)
T PF08204_consen   24 TVCNDTVVIPCFVNNLEANNISEM----YVKWKF-KNKDIFI   60 (130)
T ss_dssp             -TT-SEEEE--BBSS---SSGGGE----EEEEEE-TTEEEEE
T ss_pred             EecCCCEEEEeEeccccccccceE----EEEEEE-CCeEEEE
Confidence            346889999999975211  1122    289988 4455443


No 310
>PHA03273 envelope glycoprotein C; Provisional
Probab=96.14  E-value=0.34  Score=39.49  Aligned_cols=77  Identities=16%  Similarity=0.232  Sum_probs=54.1

Q ss_pred             EEEEEcccCCCCCeEEEEEeec-CCCc--ceeeEEEEEcCCeEEecCCCcceeeecCCcEEEEEEecc-cCCC--eEEEE
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNT-DPMR--SRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQG-YPEP--YVMWR  198 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~-~~~~--~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~-~p~~--~i~W~  198 (215)
                      ..|.|..++..+.|.|+=...+ .+..  ...+.+....+|.+.+...    .+.+|+...-.|.+.. +|+.  .++|+
T Consensus       198 ~~LtI~sltaaTeGvYtWr~~~~n~t~~~~~~VtV~~yr~Psvsv~~~----PvL~Ge~y~A~C~aa~YYPp~Sv~~rWf  273 (486)
T PHA03273        198 FPLTIKSVDWRTAGVYVWSLYAKNGTLVNSTSVTVSTYNAPLVDLSVH----PSLKGENYRAVCVVASYFPHSSVKLRWY  273 (486)
T ss_pred             cceEEEecchhhceEEEEEEecCCCceeeeeEEEEEEecCCcccccCC----ccccCCCceEEEEeeeecCCCceEEEEE
Confidence            4589999999999999865432 1222  2333444467888765421    3678999999999966 5654  58999


Q ss_pred             eCCCcccc
Q psy5838         199 REDGANLS  206 (215)
Q Consensus       199 ~~~~~~~~  206 (215)
                      . ||.++.
T Consensus       274 ~-dg~~V~  280 (486)
T PHA03273        274 K-NAKEVD  280 (486)
T ss_pred             e-CCeecc
Confidence            9 887776


No 311
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=96.14  E-value=0.0092  Score=38.45  Aligned_cols=31  Identities=35%  Similarity=0.679  Sum_probs=24.1

Q ss_pred             eecCCcEEEEEEecc-cCCC-eEEEEeCCCcccc
Q psy5838         175 VREQANVTLNCKAQG-YPEP-YVMWRREDGANLS  206 (215)
Q Consensus       175 ~~~g~~~~l~C~~~~-~p~~-~i~W~~~~~~~~~  206 (215)
                      ...++.+.|.|.+.| +|.. .+.|++ ||..+.
T Consensus        14 ~~~~~~~~L~C~~~gfyP~~i~v~W~~-~g~~~~   46 (100)
T cd07699          14 LEKSGKATLVCLINDFYPGFATVQWKV-DGATVS   46 (100)
T ss_pred             HccCCCcEEEEEEEeEECCCCEEEEEE-CCEECc
Confidence            446788999999998 5643 799999 777663


No 312
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=96.10  E-value=0.014  Score=37.53  Aligned_cols=34  Identities=29%  Similarity=0.349  Sum_probs=26.6

Q ss_pred             ceeeecCCcEEEEEEecc-cCCCe--EEEEeCCCcccc
Q psy5838         172 DLVVREQANVTLNCKAQG-YPEPY--VMWRREDGANLS  206 (215)
Q Consensus       172 ~~~~~~g~~~~l~C~~~~-~p~~~--i~W~~~~~~~~~  206 (215)
                      +..+.+|+.++|.|.+.+ .|.+.  |.|++ ++..+.
T Consensus        10 p~~~~eG~~~tL~C~v~g~~P~a~L~i~W~r-G~~~l~   46 (100)
T cd05755          10 PSWQPVGKNYTLQCDVPGVAPRQNLTVVLLR-GNETLS   46 (100)
T ss_pred             CCcccCCCcEEEEEEEcCcCCCCcEEEEEee-CCEEcc
Confidence            334679999999999977 68776  79999 666554


No 313
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=96.07  E-value=0.014  Score=38.58  Aligned_cols=20  Identities=40%  Similarity=0.624  Sum_probs=10.1

Q ss_pred             EEEEcccCCCCCeEEEEEee
Q psy5838         126 FLNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~  145 (215)
                      +|.|.+++.+|+|.|.|.+.
T Consensus        80 sL~I~~v~~~D~G~Y~C~v~   99 (115)
T cd05880          80 SILIWQLQPTDNGTYTCQVK   99 (115)
T ss_pred             EEEEeeCChhhCEEEEEEEE
Confidence            34455555555555555543


No 314
>PHA03270 envelope glycoprotein C; Provisional
Probab=96.06  E-value=0.55  Score=37.96  Aligned_cols=179  Identities=15%  Similarity=0.181  Sum_probs=93.9

Q ss_pred             CCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEc
Q psy5838          16 LMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIK   95 (215)
Q Consensus        16 ~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~   95 (215)
                      ..+.|...-+.+.+..|+.|.+.|.+.....  .++  . -.|..+.+.. ......-. .....-+...-..++.|...
T Consensus        76 ~~~~~~C~~~~vsa~yg~~v~i~C~~~~~~~--~~R--L-eiwr~~~~~~-~~~~~~P~-~~~~~l~n~~a~~~g~l~y~  148 (466)
T PHA03270         76 PPAPFRCKRPDVLARYGSRVQIRCRFPRPTA--EFR--L-QIWRVAAAPS-EEIRPAPI-EPGAVLVNVTAPPGGELVYD  148 (466)
T ss_pred             CCCCEEecCcccccccCccEEEEecccCCCC--ceE--E-EEEEeccCCc-cccCCCCC-CcccceeecccCCCceEEec
Confidence            3455777788899999999999999985532  222  2 2464421110 00000000 00000011111123445544


Q ss_pred             cceecCCEEEEEEccCCC--ceEE-EEc-cCCeEEEEEcccCCCCCeEEEEEeecC-C--CcceeeEEEEEcCCeEEecC
Q psy5838          96 NVQESDRGWYMCQVNTNP--RISL-TYN-DHRSWFLNIKNVQESDRGWYMCQVNTD-P--MRSRQGYLQVVVPPSIIDKD  168 (215)
Q Consensus        96 ~~~~~d~G~Y~C~~~~~~--~~~~-~~~-~~~~~~l~i~~~~~~d~G~Y~C~~~~~-~--~~~~~~~l~v~~~p~~~~~~  168 (215)
                      ++...-.+.|.-..-..|  .+.+ ... ..-.-.|.|..++....|.|+=...+. .  .....+++....+|.+.+..
T Consensus       149 sa~~~~~~~~~~a~ga~Pg~~P~~y~~~g~~p~~~L~I~slt~aTeGvY~Wr~~~~~~~~~~~~~VtV~~yr~Psvsv~~  228 (466)
T PHA03270        149 SAPNRTDPRVRWAEGAGPGARPRLYSVEGTFPTQRLVIQELTLATQGMYYWARGPADRPHRYGTWTRVRMFRRPSLSIRP  228 (466)
T ss_pred             cCccccCcccccccCCCCCCCCccccccCCCCcceEEEEEcccccceEEEEEEecCCCceeeeeEEEEEEecCCcccccC
Confidence            433211222221111111  0110 001 111234889999999999998876332 2  22233556666788876542


Q ss_pred             CCcceeeecCCcEEEEEEecc-cCCC--eEEEEeCCCcccc
Q psy5838         169 TSTDLVVREQANVTLNCKAQG-YPEP--YVMWRREDGANLS  206 (215)
Q Consensus       169 ~~~~~~~~~g~~~~l~C~~~~-~p~~--~i~W~~~~~~~~~  206 (215)
                      .    .+..|+...-.|.+.. +|+-  .++|+. |+.++.
T Consensus       229 ~----PvL~Ge~Y~AtC~va~YYPp~Sv~lrWf~-ng~~V~  264 (466)
T PHA03270        229 H----AVLEGEPFGATCVAANYYPGDRAAFRWFE-GGDEVF  264 (466)
T ss_pred             C----ccccCCCceEEEEeeeecCCCceEEEEEe-CCcccc
Confidence            2    2678999999999966 5654  589999 777765


No 315
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=96.04  E-value=0.017  Score=38.25  Aligned_cols=20  Identities=40%  Similarity=0.670  Sum_probs=11.1

Q ss_pred             EEEEcccCCCCCeEEEEEee
Q psy5838         126 FLNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~  145 (215)
                      .|.|.+++.+|+|.|.|.+.
T Consensus        81 sL~I~~v~~~D~G~Y~C~v~  100 (116)
T cd05715          81 SIVIHNLQFTDNGTYTCDVK  100 (116)
T ss_pred             EEEEeeCCcccCEEEEEEEE
Confidence            35555555555555555554


No 316
>PHA02633 hypothetical protein; Provisional
Probab=96.00  E-value=0.02  Score=32.88  Aligned_cols=20  Identities=40%  Similarity=0.665  Sum_probs=13.0

Q ss_pred             EEEcccCCCCCeEEEEEeec
Q psy5838         127 LNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       127 l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      |.|.++..+|+|.|.|...+
T Consensus        20 Lwilpa~~sDSGiYiC~~rn   39 (63)
T PHA02633         20 MLILNPTQSDSGIYMCITKN   39 (63)
T ss_pred             EEEeccccccCcEEEEEEcC
Confidence            55666666677777776653


No 317
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=95.97  E-value=0.021  Score=33.64  Aligned_cols=18  Identities=17%  Similarity=0.512  Sum_probs=13.5

Q ss_pred             CCcEEEEEEeeccCCccceeeeEEEEEEe
Q psy5838          32 GRDALLACVVDNLKGFKGLRIGWQVAWVR   60 (215)
Q Consensus        32 G~~v~L~C~~~~~~~~~~~~~~~~v~W~~   60 (215)
                      .+.|.|.|...    .+       +.|++
T Consensus         6 ~~~V~L~C~~~----ts-------i~W~k   23 (69)
T cd07691           6 EGKVFLKCNGA----TN-------ITWKK   23 (69)
T ss_pred             CceEEEEecCC----Cc-------EEEec
Confidence            45799999752    33       99999


No 318
>PHA03271 envelope glycoprotein C; Provisional
Probab=95.95  E-value=0.15  Score=40.82  Aligned_cols=180  Identities=18%  Similarity=0.267  Sum_probs=96.2

Q ss_pred             CCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCccEEE----eeeceeeeCCceEEEEcCC----
Q psy5838          16 LMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILS----IHHNVITQNPRISLTYNDH----   87 (215)
Q Consensus        16 ~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~----   87 (215)
                      -.|.+....+++.++..++-.+.|...-.+...       -.|..=.-..++.    .-+.+.....|+.-.+.-.    
T Consensus        93 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  165 (490)
T PHA03271         93 KMPSIVCDKEEVFVFLNKTGRFVCTLKVDPPSD-------NEWSNFALDLIFNPIEYHANEKNVEAARIAGLYGVPGSDY  165 (490)
T ss_pred             cCCceeeccceEEEEEcCCCcEEEEEEeCCCCc-------chhhhheeeeeecchhhcccccchhhhhhcccccCCCccc
Confidence            367888888899999999989999987554433       4562210000000    0000000001110000000    


Q ss_pred             --ceEEEEEccceecCCEEEEEEcc--CCCceEEEEccCCeEEEEEcccCCCCCeEEEEEeec---CCCcceeeEEEE-E
Q psy5838          88 --RSWFLNIKNVQESDRGWYMCQVN--TNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNT---DPMRSRQGYLQV-V  159 (215)
Q Consensus        88 --~~~~l~i~~~~~~d~G~Y~C~~~--~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~---~~~~~~~~~l~v-~  159 (215)
                        ..-+-.|..+.+...|.|+-...  ++.-+.+.......-.|.|.++...+.|-|+-...+   .....+.+.+.+ +
T Consensus       166 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ky~i~~~ktt~~m~v~I~svD~~t~Gy~~v~~~d~~N~~i~e~~~~~~v~~  245 (490)
T PHA03271        166 AYPRPSELISSIRRDPQGTFWTSPSPHGNKYFIWINKTTNTMGVEIRNVDYADNGYIQVIMRDPFNRPLLDKHIYIRVCQ  245 (490)
T ss_pred             cCCCHHHHhHHhhcCCCCccccCCCCCCceeEEeeccccceeeEEEEEeecccceEEEEEecCCCCCccccceEEEEEEe
Confidence              00112234444555555544322  233333333444566789999999999955444332   222333344444 3


Q ss_pred             cCCeEEecCCCcceeeecCCcEEEEEEecc-cCCC--eEEEEeCCCccccc
Q psy5838         160 VPPSIIDKDTSTDLVVREQANVTLNCKAQG-YPEP--YVMWRREDGANLSY  207 (215)
Q Consensus       160 ~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~-~p~~--~i~W~~~~~~~~~~  207 (215)
                      .||.+.+...    .+..|+...-.|.+.. +|+-  .++|+. ||.++..
T Consensus       246 RPPsVsV~a~----PVL~Ge~YkAtC~vAnYYPP~SvrlrWf~-nG~~V~~  291 (490)
T PHA03271        246 RPASVDVLAP----PVLSGENYKASCIVRHFYPPGSVYVSWRQ-NGNIATP  291 (490)
T ss_pred             cCCCccccCC----ccccCCCceEEEEeeeecCCCceEEEEEe-CCccccC
Confidence            5666665422    2678999999999976 5654  589999 7776643


No 319
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=95.93  E-value=0.013  Score=36.23  Aligned_cols=25  Identities=28%  Similarity=0.664  Sum_probs=20.6

Q ss_pred             EEEEEEecc-cCCCeEEEEeCCCcccc
Q psy5838         181 VTLNCKAQG-YPEPYVMWRREDGANLS  206 (215)
Q Consensus       181 ~~l~C~~~~-~p~~~i~W~~~~~~~~~  206 (215)
                      +.|.|.+.| .|.+.|+|++ ++..+.
T Consensus         2 ~~L~C~s~gSkP~A~I~W~k-~~~~l~   27 (82)
T cd05883           2 IELNCTAMASKPAATIRWFK-GNKELT   27 (82)
T ss_pred             EEEEEEecCCCCCCEEEEEE-CCEECc
Confidence            679999977 6888999999 676654


No 320
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=95.90  E-value=0.047  Score=35.42  Aligned_cols=26  Identities=50%  Similarity=0.813  Sum_probs=22.6

Q ss_pred             CCeEEEEEcccCCCCCeEEEEEeecC
Q psy5838         122 HRSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       122 ~~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      .....|.|.+++.+|+|.|.|.+...
T Consensus        76 ~~~~sL~i~~l~~~DsG~Y~C~v~~~  101 (114)
T PF07686_consen   76 QNNFSLTIKNLQPSDSGTYFCQVSTS  101 (114)
T ss_dssp             TTEEEEEESSESGGGEEEEEEEEEES
T ss_pred             CCeEEEEECCCCcCcCEEEEEEEEEC
Confidence            35678999999999999999998654


No 321
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=95.86  E-value=0.015  Score=38.40  Aligned_cols=44  Identities=27%  Similarity=0.674  Sum_probs=28.9

Q ss_pred             CCeEEecCCCcceeeecCCcEEEEEEecc-cCCC-eEEEEeCCCcccc
Q psy5838         161 PPSIIDKDTSTDLVVREQANVTLNCKAQG-YPEP-YVMWRREDGANLS  206 (215)
Q Consensus       161 ~p~~~~~~~~~~~~~~~g~~~~l~C~~~~-~p~~-~i~W~~~~~~~~~  206 (215)
                      +|.+.+.. +....+..++.+.|.|.+.+ +|.. .+.|++ ||+.+.
T Consensus         2 ~P~V~v~~-ps~~e~~~~~~~tL~Cla~gFyP~~I~V~W~k-ng~~l~   47 (115)
T cd05769           2 PPTVAIFP-PSEAEIRNKRKATLVCLATGFYPDHVSLSWKV-NGKEVT   47 (115)
T ss_pred             CCEEEEEC-cChHHhccCCCcEEEEEEEeEeCCCcEEEEEE-CCEECC
Confidence            35544442 22223445778999999998 4764 799999 776654


No 322
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=95.82  E-value=0.019  Score=35.75  Aligned_cols=36  Identities=22%  Similarity=0.331  Sum_probs=29.8

Q ss_pred             ceeeecCCcEEEEEEecccCCCeEEEEeCCCccccccC
Q psy5838         172 DLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYNG  209 (215)
Q Consensus       172 ~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~~~~  209 (215)
                      ++.+..|+++.|.|...+. .+.+.|++ ||..+..+.
T Consensus         5 ~~tv~~g~~v~L~C~~~s~-~A~v~W~~-ng~~l~~~~   40 (85)
T cd05872           5 NRTVAPGADVVLPCQLRSN-LASPVWLF-NGTPLNAQF   40 (85)
T ss_pred             EEEEecCCCEEEECCCCCC-CccEEEEE-CCcccCCCc
Confidence            4568899999999999875 67999999 888776543


No 323
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=95.80  E-value=0.017  Score=37.32  Aligned_cols=7  Identities=14%  Similarity=0.781  Sum_probs=5.6

Q ss_pred             EEEEecC
Q psy5838          56 VAWVRVD   62 (215)
Q Consensus        56 v~W~~~~   62 (215)
                      +.|+|++
T Consensus        43 v~WyK~~   49 (104)
T cd05896          43 LMWYKSS   49 (104)
T ss_pred             EEEEECC
Confidence            8999954


No 324
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=95.79  E-value=0.018  Score=37.29  Aligned_cols=31  Identities=35%  Similarity=0.789  Sum_probs=23.8

Q ss_pred             eecCCcEEEEEEeccc-CCC-eEEEEeCCCcccc
Q psy5838         175 VREQANVTLNCKAQGY-PEP-YVMWRREDGANLS  206 (215)
Q Consensus       175 ~~~g~~~~l~C~~~~~-p~~-~i~W~~~~~~~~~  206 (215)
                      +..|..++|.|.+.|+ |.. .++|++ ||+.+.
T Consensus        13 ~~~~~~~tL~C~a~gFyP~~i~v~W~k-~g~~~~   45 (102)
T cd05768          13 LSLQETATLTCLVKGFSPSDIFVKWLQ-NGQPLS   45 (102)
T ss_pred             hCcCCceEEEEEEeeEeCCCCEEEEEE-CCEECC
Confidence            3457889999999994 654 689999 776553


No 325
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=95.78  E-value=0.03  Score=35.98  Aligned_cols=34  Identities=26%  Similarity=0.456  Sum_probs=28.7

Q ss_pred             cceeeecCCcEEEEEEecccCCCe-EEEEeCCCccc
Q psy5838         171 TDLVVREQANVTLNCKAQGYPEPY-VMWRREDGANL  205 (215)
Q Consensus       171 ~~~~~~~g~~~~l~C~~~~~p~~~-i~W~~~~~~~~  205 (215)
                      ..+.+.+|+++.|.|.+.++|+|. +.|.+ ++..+
T Consensus        11 ~~~~v~~gE~~~L~V~ieAYP~p~~~~W~~-~~~~l   45 (101)
T cd05860          11 TTIFVNAGENLDLIVEYEAYPKPEHQQWIY-MNRTL   45 (101)
T ss_pred             ceEEEECCCCEEEEEEEEeCCCCeeeEEEc-CCccc
Confidence            355689999999999999999997 99999 55544


No 326
>PHA03269 envelope glycoprotein C; Provisional
Probab=95.74  E-value=0.32  Score=39.86  Aligned_cols=79  Identities=20%  Similarity=0.278  Sum_probs=56.5

Q ss_pred             CeEEEEEcccCCCCCeEEEEEeec--C--CCcceeeEEEEEcCCeEEecCCCcceeeecCCcEEEEEEecc-cCCC--eE
Q psy5838         123 RSWFLNIKNVQESDRGWYMCQVNT--D--PMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQG-YPEP--YV  195 (215)
Q Consensus       123 ~~~~l~i~~~~~~d~G~Y~C~~~~--~--~~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~-~p~~--~i  195 (215)
                      ....|.|..++..+.|.|+=.+.+  .  ......+++.+..+|.+.+..    ..+.+|+...-.|.+.. +|+.  .+
T Consensus       287 ~~~pL~I~sltaATeGvY~Wrv~~~~n~t~~~~~~VtV~~yr~PsVsV~p----~PVL~Ge~YkAtC~vA~YYPp~Svrl  362 (566)
T PHA03269        287 SDFSLHILSLDASTEGTYIWRVIHTANKNVINEHHITVMSYKRPNITVIG----DPVLLGNPYAAYCKVNKYYPPHSVIV  362 (566)
T ss_pred             CccceEEeecccccCceEEEEEecCCCCceeeeeEEEEEEecCCCccccC----CccccCCCceEEEEeeeecCCCceEE
Confidence            445699999999999999866532  1  123344567777788776542    13678999999999966 5654  58


Q ss_pred             EEEeCCCcccc
Q psy5838         196 MWRREDGANLS  206 (215)
Q Consensus       196 ~W~~~~~~~~~  206 (215)
                      +|+. ||.++.
T Consensus       363 rWf~-ng~~V~  372 (566)
T PHA03269        363 KWTS-NFGNIG  372 (566)
T ss_pred             EEEe-CCcccC
Confidence            9999 776665


No 327
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.64  E-value=0.039  Score=35.78  Aligned_cols=23  Identities=30%  Similarity=0.527  Sum_probs=20.4

Q ss_pred             CeEEEEEcccCCCCCeEEEEEee
Q psy5838         123 RSWFLNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       123 ~~~~l~i~~~~~~d~G~Y~C~~~  145 (215)
                      ....|.|.+++.+|+|.|.|.+.
T Consensus        69 ~~~~L~I~~~~~~Dsg~Y~Ca~~   91 (106)
T cd04980          69 TDFTLTISRVEPEDAAVYYCQQY   91 (106)
T ss_pred             CEEEEEECCCChHHCEEEEEEEe
Confidence            45679999999999999999984


No 328
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=95.64  E-value=0.019  Score=35.59  Aligned_cols=25  Identities=24%  Similarity=0.694  Sum_probs=20.5

Q ss_pred             EEEEEEecc-cCCCeEEEEeCCCcccc
Q psy5838         181 VTLNCKAQG-YPEPYVMWRREDGANLS  206 (215)
Q Consensus       181 ~~l~C~~~~-~p~~~i~W~~~~~~~~~  206 (215)
                      +.|.|.+.| +|.+.++|++ ||..+.
T Consensus         2 ~~LtC~a~gf~P~~~itW~k-ng~~l~   27 (83)
T cd05884           2 MQLTCKTSGSKPAADIRWFK-NDKEIK   27 (83)
T ss_pred             EEEEEEeCCccCCCEEEEEE-CCEECc
Confidence            579999987 6878899999 777654


No 329
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=95.52  E-value=0.022  Score=35.32  Aligned_cols=25  Identities=28%  Similarity=0.757  Sum_probs=20.7

Q ss_pred             EEEEEEecc-cCCCeEEEEeCCCcccc
Q psy5838         181 VTLNCKAQG-YPEPYVMWRREDGANLS  206 (215)
Q Consensus       181 ~~l~C~~~~-~p~~~i~W~~~~~~~~~  206 (215)
                      +.|.|.+.+ +|.+.|+|++ +|..+.
T Consensus         2 ~~LtC~a~g~~P~~~ItW~k-~g~~l~   27 (83)
T cd07705           2 AKLRCTSSGSKPAANIKWRK-GDQELE   27 (83)
T ss_pred             EEEEEEecCccCCCEeEEEE-CCEECC
Confidence            679999987 5888999999 776654


No 330
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.48  E-value=0.07  Score=34.00  Aligned_cols=23  Identities=35%  Similarity=0.426  Sum_probs=20.6

Q ss_pred             CeEEEEEcccCCCCCeEEEEEee
Q psy5838         123 RSWFLNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       123 ~~~~l~i~~~~~~d~G~Y~C~~~  145 (215)
                      ....|.|.+++.+|+|.|.|.+.
T Consensus        61 ~~~~L~I~~~~~~Dsg~Y~C~~~   83 (98)
T cd04984          61 NTASLTISGAQTEDEADYYCQVW   83 (98)
T ss_pred             CEEEEEECCCChhhCEEEEEEEc
Confidence            55679999999999999999875


No 331
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=95.46  E-value=0.029  Score=34.95  Aligned_cols=28  Identities=14%  Similarity=0.447  Sum_probs=22.8

Q ss_pred             CcEEEEEEecc--cCCCeEEEEeCCCccccc
Q psy5838         179 ANVTLNCKAQG--YPEPYVMWRREDGANLSY  207 (215)
Q Consensus       179 ~~~~l~C~~~~--~p~~~i~W~~~~~~~~~~  207 (215)
                      +++.|.|.+.+  .+.+.+.|++ ||+.|..
T Consensus         1 ~~~~l~C~v~~d~~l~~~~~W~~-dg~~i~~   30 (85)
T cd05853           1 ESIVLPCQVSHDHSLDIVFTWSF-NGHLIDF   30 (85)
T ss_pred             CcEEEEEEeccCCCCCcEEEEEE-CCEECcc
Confidence            46899999976  4567899999 8988864


No 332
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=95.46  E-value=0.049  Score=34.62  Aligned_cols=31  Identities=26%  Similarity=0.472  Sum_probs=24.5

Q ss_pred             ecCCcEEEEEEecc-cCCC-eEEEEeCCCccccc
Q psy5838         176 REQANVTLNCKAQG-YPEP-YVMWRREDGANLSY  207 (215)
Q Consensus       176 ~~g~~~~l~C~~~~-~p~~-~i~W~~~~~~~~~~  207 (215)
                      ..|....|.|.+.| +|.. .++|++ ||+.+..
T Consensus        12 ~~~~~~~L~C~~~gFyP~~i~v~W~~-~g~~~~~   44 (94)
T cd05766          12 SLSHPHLLVCHVWGFYPPEITVKWFK-NGQEETE   44 (94)
T ss_pred             cCCCCeEEEEEEeeecCCCCEEEEEE-CCeecCC
Confidence            36889999999999 5665 789999 7776543


No 333
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=95.44  E-value=0.025  Score=34.90  Aligned_cols=25  Identities=28%  Similarity=0.682  Sum_probs=20.6

Q ss_pred             EEEEEEecc-cCCCeEEEEeCCCcccc
Q psy5838         181 VTLNCKAQG-YPEPYVMWRREDGANLS  206 (215)
Q Consensus       181 ~~l~C~~~~-~p~~~i~W~~~~~~~~~  206 (215)
                      +.|.|.+.+ +|.+.++|++ +|..+.
T Consensus         2 ~~L~C~~~~~~P~~~v~W~~-~~~~l~   27 (82)
T cd05761           2 VELTCTSSGSKPAATIRWFK-GDKELK   27 (82)
T ss_pred             EEEEEEecCcCcCCeEEEEE-CCEEcc
Confidence            579999977 5888999999 777654


No 334
>smart00406 IGv Immunoglobulin V-Type.
Probab=95.42  E-value=0.022  Score=34.53  Aligned_cols=23  Identities=35%  Similarity=0.579  Sum_probs=20.1

Q ss_pred             CCeEEEEEcccCCCCCeEEEEEe
Q psy5838         122 HRSWFLNIKNVQESDRGWYMCQV  144 (215)
Q Consensus       122 ~~~~~l~i~~~~~~d~G~Y~C~~  144 (215)
                      .....|+|.+++.+|+|.|.|.+
T Consensus        59 ~~~~~L~i~~~~~~D~G~Y~C~v   81 (81)
T smart00406       59 KNDVSLTISNLRVEDTGTYYCAV   81 (81)
T ss_pred             CCEEEEEEcCCCHHHCEEEEEcC
Confidence            45677999999999999999964


No 335
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=95.41  E-value=0.049  Score=34.61  Aligned_cols=29  Identities=24%  Similarity=0.509  Sum_probs=22.6

Q ss_pred             cCCcEEEEEEecc-cCCC-eEEEEeCCCcccc
Q psy5838         177 EQANVTLNCKAQG-YPEP-YVMWRREDGANLS  206 (215)
Q Consensus       177 ~g~~~~l~C~~~~-~p~~-~i~W~~~~~~~~~  206 (215)
                      .+...+|.|.+.| +|.. .+.|.+ ||..+.
T Consensus        14 ~~~~~tL~C~a~gFyP~~I~v~W~~-~g~~~~   44 (94)
T cd05767          14 LGEPNTLICFVDNFFPPVLNVTWLK-NGVPVT   44 (94)
T ss_pred             CCCCeEEEEEEEEEECCcCEEEEEE-CCeEcc
Confidence            4666899999999 5654 689999 777654


No 336
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=95.24  E-value=0.029  Score=35.82  Aligned_cols=31  Identities=19%  Similarity=0.454  Sum_probs=23.5

Q ss_pred             eecCCcEEEEEEecc-cCCC-eEEEEeCCCcccc
Q psy5838         175 VREQANVTLNCKAQG-YPEP-YVMWRREDGANLS  206 (215)
Q Consensus       175 ~~~g~~~~l~C~~~~-~p~~-~i~W~~~~~~~~~  206 (215)
                      ...+..+.|.|.+.+ +|.. .++|.+ ||..+.
T Consensus        13 ~~~~~~~tL~C~a~gFyP~~I~v~W~k-ng~~~~   45 (96)
T cd07697          13 IEKQGQGIYLCLLENFFPDVIQVHWRE-GNSPSI   45 (96)
T ss_pred             HccCCCEEEEEEEEEEeCCCeEEEEEE-CCEECc
Confidence            334677899999999 5655 689999 777653


No 337
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=95.20  E-value=0.039  Score=35.17  Aligned_cols=19  Identities=32%  Similarity=1.004  Sum_probs=9.6

Q ss_pred             EEEcccCCCCCeEEEEEee
Q psy5838         127 LNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       127 l~i~~~~~~d~G~Y~C~~~  145 (215)
                      |.|.+++.+|+|.|.|.+.
T Consensus        66 L~I~~v~~~DsG~Y~C~~~   84 (98)
T cd05716          66 VTLNQLRKEDAGWYWCGVG   84 (98)
T ss_pred             EEEcCCCHHHCEEEEEEcc
Confidence            4455555555555555443


No 338
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=95.17  E-value=0.06  Score=34.16  Aligned_cols=30  Identities=20%  Similarity=0.405  Sum_probs=23.2

Q ss_pred             ecCCcEEEEEEecc-cCCC-eEEEEeCCCcccc
Q psy5838         176 REQANVTLNCKAQG-YPEP-YVMWRREDGANLS  206 (215)
Q Consensus       176 ~~g~~~~l~C~~~~-~p~~-~i~W~~~~~~~~~  206 (215)
                      ..|....|.|.+.| +|+. .+.|++ ||..+.
T Consensus        13 ~~g~~~~L~C~a~gFyP~~i~v~W~~-dg~~~~   44 (93)
T cd05770          13 ENGKPNVLNCYVTGFHPPDIEIRLLK-NGVKIP   44 (93)
T ss_pred             cCCCceEEEEEEEEEeCCCCEEEEEE-CCEECC
Confidence            34666789999999 5654 689999 887654


No 339
>PHA02633 hypothetical protein; Provisional
Probab=95.15  E-value=0.021  Score=32.78  Aligned_cols=25  Identities=32%  Similarity=0.461  Sum_probs=21.5

Q ss_pred             ceEEEEEccceecCCEEEEEEccCC
Q psy5838          88 RSWFLNIKNVQESDRGWYMCQVNTN  112 (215)
Q Consensus        88 ~~~~l~i~~~~~~d~G~Y~C~~~~~  112 (215)
                      +...|.|-++..+|+|.|.|...+.
T Consensus        16 ~~~nLwilpa~~sDSGiYiC~~rn~   40 (63)
T PHA02633         16 NCNNMLILNPTQSDSGIYMCITKNE   40 (63)
T ss_pred             ccccEEEeccccccCcEEEEEEcCC
Confidence            4458999999999999999988764


No 340
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=95.13  E-value=0.15  Score=32.44  Aligned_cols=26  Identities=12%  Similarity=0.277  Sum_probs=18.6

Q ss_pred             eCCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          31 VGRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      .++.++|.|.+.+..+.. .    .+.|+|+
T Consensus        15 ~~~~~~L~C~a~gFyP~~-i----~vtW~k~   40 (95)
T cd04985          15 SSDSVTLGCLATGFLPEP-V----TFTWNSG   40 (95)
T ss_pred             CCCcEEEEEEEeeEECCC-c----EEEEeEC
Confidence            356799999999864433 2    2899994


No 341
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=95.11  E-value=0.065  Score=33.88  Aligned_cols=25  Identities=44%  Similarity=0.974  Sum_probs=20.8

Q ss_pred             CCcEEEEEEeccc-CCC-eEEEEeCCCc
Q psy5838         178 QANVTLNCKAQGY-PEP-YVMWRREDGA  203 (215)
Q Consensus       178 g~~~~l~C~~~~~-p~~-~i~W~~~~~~  203 (215)
                      ++.+.|.|.+.|+ |.+ .+.|++ +|.
T Consensus        14 ~~~~~L~C~a~gF~P~~i~v~W~~-~g~   40 (93)
T cd07698          14 DGSLTLSCHATGFYPRDIEVTWLR-DGE   40 (93)
T ss_pred             CCcEEEEEEEEEEeCCCcEEEEEE-CCE
Confidence            6789999999995 655 799999 664


No 342
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=95.07  E-value=0.036  Score=34.95  Aligned_cols=31  Identities=35%  Similarity=0.670  Sum_probs=25.0

Q ss_pred             ecCCcEEEEEEeccc-CC-CeEEEEeCCCccccc
Q psy5838         176 REQANVTLNCKAQGY-PE-PYVMWRREDGANLSY  207 (215)
Q Consensus       176 ~~g~~~~l~C~~~~~-p~-~~i~W~~~~~~~~~~  207 (215)
                      ..|..+.|.|.+.|+ |. ..++|++ ||..+..
T Consensus        11 ~~~~~~~L~C~a~g~~P~~~~i~W~~-~g~~~~~   43 (95)
T cd00098          11 LLGGSVTLTCLATGFYPPDITVTWLK-NGKELTS   43 (95)
T ss_pred             HcCCCeEEEEEEeeEECCCcEEEEEE-CCEECCC
Confidence            468999999999996 64 5799999 7776643


No 343
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=94.73  E-value=0.3  Score=31.21  Aligned_cols=29  Identities=17%  Similarity=0.422  Sum_probs=21.1

Q ss_pred             EeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          30 TVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        30 ~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      .+|..+++.|.+.+-.......    +.|++++
T Consensus        13 ~~G~~vtv~C~v~~v~P~~~l~----v~LlkG~   41 (99)
T cd07689          13 EEGKPVTVKCEVPDVYPFDRLE----IELLKGE   41 (99)
T ss_pred             cCCceEEEEEEecCcccCCceE----EEEecCc
Confidence            6899999999998654433332    8898843


No 344
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=94.73  E-value=0.066  Score=34.96  Aligned_cols=32  Identities=25%  Similarity=0.490  Sum_probs=26.2

Q ss_pred             CCcceeeecCCcEEEEEEecccCCCeEEEEeCC
Q psy5838         169 TSTDLVVREQANVTLNCKAQGYPEPYVMWRRED  201 (215)
Q Consensus       169 ~~~~~~~~~g~~~~l~C~~~~~p~~~i~W~~~~  201 (215)
                      .+..+.+.+|++++|.|...+ +.+.+.|++..
T Consensus         4 ~p~~~~v~~G~~v~l~C~~~~-~~~~v~Wykq~   35 (110)
T cd05899           4 SPRYLIKGRGQSVTLRCSQTS-GHDNMYWYRQD   35 (110)
T ss_pred             CCCceEEcCCCcEEEEEEECC-CCCEEEEEEEC
Confidence            345667899999999999987 66789999953


No 345
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=94.62  E-value=0.038  Score=34.51  Aligned_cols=27  Identities=41%  Similarity=0.938  Sum_probs=21.3

Q ss_pred             CCcEEEEEEec-ccCCCeEEEEeCCCccc
Q psy5838         178 QANVTLNCKAQ-GYPEPYVMWRREDGANL  205 (215)
Q Consensus       178 g~~~~l~C~~~-~~p~~~i~W~~~~~~~~  205 (215)
                      |+.+.+.|.+. ++|.|.++|+. ++..+
T Consensus        14 ~~~~~~~C~s~~~~P~~~i~W~~-~~~~~   41 (89)
T PF08205_consen   14 GEEVTLTCSSSGGYPPPQITWYL-DGGPV   41 (89)
T ss_dssp             TEEEEEEEEEEEEBS-EEEEEEE-TTCEE
T ss_pred             ceEEEEEEEeCCeECCeEEEEEE-CCCce
Confidence            67999999875 58999999999 55544


No 346
>PF11465 Receptor_2B4:  Natural killer cell receptor 2B4;  InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells. It plays a role in activating NK-mediated cytotoxicity through its interaction with CD48 on target cells in a subset of CD8 T cells []. The structure of 2B4 consists of an immunoglobulin variable domain fold and contains two beta-sheets. One of the beta-sheets, the six-stranded sheet, contains structural features that may have a role in ligand recognition and receptor function []. This entry represents the 2B4 immunoglobulin domain.; GO: 0005488 binding; PDB: 2PTU_D 2PTT_B 1Z2K_A.
Probab=94.52  E-value=0.77  Score=29.67  Aligned_cols=24  Identities=33%  Similarity=0.451  Sum_probs=14.0

Q ss_pred             EEEEEcccCCCCCeEEEEEeecCC
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNTDP  148 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~~~  148 (215)
                      ..|.|..++..|+|.|.-++.+..
T Consensus        71 laLlIkaAq~qDSG~Y~LEvT~~s   94 (108)
T PF11465_consen   71 LALLIKAAQPQDSGLYCLEVTNES   94 (108)
T ss_dssp             TEEEESS-SGGG-EEEEEEEEETT
T ss_pred             ceEEEeecCcccCceEEEEEEcCC
Confidence            346677777777777766665433


No 347
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=94.28  E-value=0.23  Score=28.17  Aligned_cols=24  Identities=38%  Similarity=0.511  Sum_probs=20.0

Q ss_pred             eEEEEEcccCCCCCeEEEEEeecC
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ...|.+..++..|.|.|.|.+...
T Consensus        42 ~~~l~i~~~~~~d~g~y~C~~~~~   65 (74)
T cd00096          42 SSTLTISNVTLEDSGTYTCVASNS   65 (74)
T ss_pred             EEEEEECccCcccCcEEEEEEecC
Confidence            355889999999999999998654


No 348
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=94.19  E-value=0.07  Score=40.11  Aligned_cols=43  Identities=28%  Similarity=0.444  Sum_probs=34.0

Q ss_pred             EEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEccceecCCEEEEEEcc
Q psy5838          56 VAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVN  110 (215)
Q Consensus        56 v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~  110 (215)
                      +.|...+++.+        ..+.+++++..    |.|.+.+...+++|.|+|...
T Consensus        15 y~W~GP~g~~l--------~gn~~~nIT~T----G~L~~~~F~esmSG~YTCtLs   57 (271)
T PF07354_consen   15 YLWTGPNGKPL--------SGNSYVNITET----GKLMFKNFQESMSGSYTCTLS   57 (271)
T ss_pred             eEEECCCCccc--------CCCCeEEEccC----ceEEeeccccccCCceEEEEE
Confidence            78988777765        34566666654    489999999999999999865


No 349
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=94.16  E-value=0.033  Score=35.65  Aligned_cols=36  Identities=33%  Similarity=0.480  Sum_probs=26.3

Q ss_pred             CceEEEEc--CCceEEEEEccceecCCEEEEEEccCCC
Q psy5838          78 PRISLTYN--DHRSWFLNIKNVQESDRGWYMCQVNTNP  113 (215)
Q Consensus        78 ~~~~~~~~--~~~~~~l~i~~~~~~d~G~Y~C~~~~~~  113 (215)
                      +|+.+...  .....+|.|.+++.+|+|.|+|.+.+.+
T Consensus        51 ~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~v~~~~   88 (100)
T cd05713          51 GRTELLKDAIAEGSVALRIHNVRASDEGLYTCFFQSDG   88 (100)
T ss_pred             ceEEeecccccCCcEEEEEEcCChhhCEEEEEEEecCC
Confidence            46655432  2356799999999999999999877543


No 350
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=94.13  E-value=0.19  Score=33.06  Aligned_cols=34  Identities=29%  Similarity=0.506  Sum_probs=25.7

Q ss_pred             CceEEEEc-cCCeEEEEEcccCCCCCeEEEEEeec
Q psy5838         113 PRISLTYN-DHRSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       113 ~~~~~~~~-~~~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .++.+... ......|.|.+++.+|+|.|.|.+..
T Consensus        59 ~R~~~~~~~~~~~~sL~I~~~~~~Dsg~Y~C~~~~   93 (116)
T cd07706          59 GRYSVNFQKAQKSISLTISALQLEDSAKYFCALST   93 (116)
T ss_pred             CeEEEEEeccCCEEEEEECCCCHHHCEEEEEEEEC
Confidence            34555432 34567899999999999999999864


No 351
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=93.80  E-value=0.24  Score=35.46  Aligned_cols=39  Identities=31%  Similarity=0.294  Sum_probs=27.1

Q ss_pred             CCeEEEEEcccCCCCCeEEEEEeecCC---CcceeeEEEEEc
Q psy5838         122 HRSWFLNIKNVQESDRGWYMCQVNTDP---MRSRQGYLQVVV  160 (215)
Q Consensus       122 ~~~~~l~i~~~~~~d~G~Y~C~~~~~~---~~~~~~~l~v~~  160 (215)
                      .....|.|.+++.+|+|.|.|.....+   ..+...-|.|..
T Consensus        82 ~~~StItIknVt~sDeGcY~C~F~tfp~G~~~~gt~CLtVt~  123 (189)
T PHA02987         82 FNESTILIKNVSLKDNGCYTCIFNTLLSKNNEKGVVCLNVTT  123 (189)
T ss_pred             CCcceEEEEeCChhhCeEEEEEEEecCCCCCceeEEEEEEEc
Confidence            345678899999999999999986543   334444466653


No 352
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins. Ig2_Nectin-3-4_like: domain similar to the second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and nectin-4 (poliovirus receptor related protein 4). Nectin-3 and nectin-4 belong to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.  Nect
Probab=93.79  E-value=0.83  Score=29.18  Aligned_cols=30  Identities=23%  Similarity=0.484  Sum_probs=22.8

Q ss_pred             CceEEEeCCcEEE-EEEeec-cCCccceeeeEEEEEEec
Q psy5838          25 PNVTVTVGRDALL-ACVVDN-LKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        25 ~~~~~~~G~~v~L-~C~~~~-~~~~~~~~~~~~v~W~~~   61 (215)
                      ..+.+.+|+.+.+ .|...+ .|...       +.|+.+
T Consensus         9 ~~~~~~~g~~~~vA~C~sa~gkPaa~-------IsW~~~   40 (97)
T cd07704           9 PSLLIDGGNGTTLAACCAAEGRPAAD-------VTWETN   40 (97)
T ss_pred             CeeEeecCcceeEEEEEccCCccCCE-------eEEeCC
Confidence            3566778999999 888774 56666       999974


No 353
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=93.64  E-value=0.13  Score=31.09  Aligned_cols=24  Identities=38%  Similarity=0.848  Sum_probs=19.0

Q ss_pred             EEEEEEeccc-CCC-eEEEEeCCCccc
Q psy5838         181 VTLNCKAQGY-PEP-YVMWRREDGANL  205 (215)
Q Consensus       181 ~~l~C~~~~~-p~~-~i~W~~~~~~~~  205 (215)
                      +.|.|.+.|+ |+. .+.|++ ||+.+
T Consensus         2 ~~L~C~a~gf~P~~i~v~W~k-~g~~~   27 (75)
T smart00407        2 ATLVCLVSGFYPPDITVTWLR-NGQEV   27 (75)
T ss_pred             eEEEEEEEeEeCCCCEEEEEE-CCEEC
Confidence            5799999984 664 799999 77753


No 354
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=93.61  E-value=0.16  Score=33.37  Aligned_cols=31  Identities=29%  Similarity=0.753  Sum_probs=25.4

Q ss_pred             CcceeeecCCcEEEEEEecc--cCCCeEEEEeC
Q psy5838         170 STDLVVREQANVTLNCKAQG--YPEPYVMWRRE  200 (215)
Q Consensus       170 ~~~~~~~~g~~~~l~C~~~~--~p~~~i~W~~~  200 (215)
                      +..+.+.+|++++|.|...+  .+.+.+.|++.
T Consensus         5 p~~~~~~~G~~v~l~C~~~~~~~~~~~v~Wyrq   37 (116)
T cd04982           5 QLSITREESKSVTISCKVSGIDFSTTYIHWYRQ   37 (116)
T ss_pred             CCeEEeCCCCCEEEEEEEeCCCccccEEEEEEE
Confidence            44556789999999999876  56778999995


No 355
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=93.60  E-value=0.098  Score=34.75  Aligned_cols=25  Identities=28%  Similarity=0.413  Sum_probs=21.6

Q ss_pred             CCeEEEEEcccCCCCCeEEEEEeec
Q psy5838         122 HRSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       122 ~~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ..+..|.|.+++.+|+|.|.|.+..
T Consensus        77 ~~~~sL~I~~l~~~Dsg~Y~C~~~~  101 (119)
T cd05712          77 KKNCSLLISDAQPEDSGKYFFRVEL  101 (119)
T ss_pred             CCEEEEEEccCChhhCeEEEEEEEc
Confidence            4557799999999999999999854


No 356
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=93.38  E-value=1  Score=28.10  Aligned_cols=42  Identities=19%  Similarity=0.340  Sum_probs=29.4

Q ss_pred             EEEEccCC--CceEEEEccC----------CeEEEEEcccCCCCCeEEEEEeec
Q psy5838         105 YMCQVNTN--PRISLTYNDH----------RSWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       105 Y~C~~~~~--~~~~~~~~~~----------~~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      -+|.....  |.+.+.|...          .+..|.+..+...|+|..+|.+..
T Consensus        19 Ltl~~~s~s~p~~~i~w~~P~n~~~~~~~~~~ktL~~~qv~~qdSG~WtC~V~~   72 (88)
T cd07694          19 LTLHGSSNSLPAFKVEWRGPGNKSKQILNQDKKTLNLVQLGPNDSGTWDCIVSV   72 (88)
T ss_pred             EEEecCCCCCCCccEEEeCCCCccceeccCCccEEEeceeCcccCCEEEEEEEE
Confidence            34555432  3347777432          446689999999999999999964


No 357
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=93.36  E-value=0.26  Score=31.37  Aligned_cols=27  Identities=37%  Similarity=0.822  Sum_probs=21.5

Q ss_pred             cCCcEEEEEEeccc-CCC-eEEEEeCCCcc
Q psy5838         177 EQANVTLNCKAQGY-PEP-YVMWRREDGAN  204 (215)
Q Consensus       177 ~g~~~~l~C~~~~~-p~~-~i~W~~~~~~~  204 (215)
                      .++.+.|.|.+.++ |.. .++|++ ||+.
T Consensus        15 ~~~~~~L~C~a~gFyP~~i~vtW~k-~g~~   43 (95)
T cd04985          15 SSDSVTLGCLATGFLPEPVTFTWNS-GSNS   43 (95)
T ss_pred             CCCcEEEEEEEeeEECCCcEEEEeE-CCEE
Confidence            46779999999994 654 689999 7765


No 358
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=93.20  E-value=0.17  Score=31.15  Aligned_cols=29  Identities=34%  Similarity=0.786  Sum_probs=23.1

Q ss_pred             cCCcEEEEEEecc-cCCC-eEEEEeCCCcccc
Q psy5838         177 EQANVTLNCKAQG-YPEP-YVMWRREDGANLS  206 (215)
Q Consensus       177 ~g~~~~l~C~~~~-~p~~-~i~W~~~~~~~~~  206 (215)
                      .+..+.|.|.+.+ +|.. .+.|++ +|..+.
T Consensus         7 ~~~~~~L~C~v~~f~P~~i~v~W~~-~~~~~~   37 (83)
T PF07654_consen    7 LGGSVTLTCLVSGFYPKDITVTWLK-NGKEVT   37 (83)
T ss_dssp             STSEEEEEEEEEEEBSSTEEEEEEE-TTEEET
T ss_pred             CCCCEEEEEEEEEEECCCcEEEEEe-ccceee
Confidence            4899999999998 5655 699999 776554


No 359
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=93.14  E-value=1.4  Score=27.98  Aligned_cols=23  Identities=13%  Similarity=0.306  Sum_probs=17.1

Q ss_pred             CCcEEEEEEee-ccCCccceeeeEEEEEEec
Q psy5838          32 GRDALLACVVD-NLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        32 G~~v~L~C~~~-~~~~~~~~~~~~~v~W~~~   61 (215)
                      .....+.|... +.|.+.       +.|+++
T Consensus        15 ~~~~va~C~s~~gkP~a~-------ItW~~~   38 (95)
T cd05719          15 EPVTVATCVSANGKPPAT-------ISWETT   38 (95)
T ss_pred             CccEEEEEECCCCcCCCE-------EEEEeC
Confidence            34567889985 567776       999994


No 360
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=93.03  E-value=0.13  Score=32.83  Aligned_cols=29  Identities=31%  Similarity=0.589  Sum_probs=22.5

Q ss_pred             eecCCcEEEEEEeccc--CCC-eEEEEeCCCc
Q psy5838         175 VREQANVTLNCKAQGY--PEP-YVMWRREDGA  203 (215)
Q Consensus       175 ~~~g~~~~l~C~~~~~--p~~-~i~W~~~~~~  203 (215)
                      +..|+.++|.|.+.|+  |+. .++|.++++.
T Consensus        11 l~~~~~~tLtC~v~gf~yP~~i~v~W~r~~~~   42 (96)
T cd07696          11 LLLTKSVKLTCLVTNLTSPEGVNVTWTRGSGE   42 (96)
T ss_pred             hccCCCeEEEEEEeCCCCCCCcEEEEEECCeE
Confidence            5568999999999988  544 6899994333


No 361
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=93.01  E-value=0.14  Score=32.53  Aligned_cols=28  Identities=29%  Similarity=0.495  Sum_probs=22.1

Q ss_pred             cCCcEEEEEEecc-cCCC-eEEEEeCCCccc
Q psy5838         177 EQANVTLNCKAQG-YPEP-YVMWRREDGANL  205 (215)
Q Consensus       177 ~g~~~~l~C~~~~-~p~~-~i~W~~~~~~~~  205 (215)
                      .+..+.|.|.+.| +|.. .+.|++ ||..+
T Consensus        13 ~~~~~~L~C~a~gFyP~~I~vtW~~-dg~~~   42 (94)
T cd05847          13 TSETIQLLCLISGYTPGTIEVEWLV-DGQVA   42 (94)
T ss_pred             CCCCEEEEEEEEeEECCCCEEEEEE-CCEEC
Confidence            4567899999999 5653 799999 77765


No 362
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=92.58  E-value=0.2  Score=32.34  Aligned_cols=23  Identities=39%  Similarity=0.901  Sum_probs=20.4

Q ss_pred             CeEEEEEcccCCCCCeEEEEEee
Q psy5838         123 RSWFLNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       123 ~~~~l~i~~~~~~d~G~Y~C~~~  145 (215)
                      ....|.|.+++.+|+|.|.|.+.
T Consensus        67 ~~~~L~I~~~~~sDsgtY~Ca~~   89 (104)
T cd05720          67 NSFVLTLKNFQKENEGYYFCSVA   89 (104)
T ss_pred             CEEEEEECCCCHHHCEEEEEEEc
Confidence            55679999999999999999874


No 363
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=92.48  E-value=1.1  Score=28.27  Aligned_cols=22  Identities=18%  Similarity=0.246  Sum_probs=18.6

Q ss_pred             eEEEEEcccCCCCCeEEEEEee
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~  145 (215)
                      ...+.|..++.+|+|.|.|...
T Consensus        54 ~a~f~I~~~~~~~~G~Y~C~~~   75 (94)
T cd05711          54 QASFPLGPVTPAHAGTYRCYGS   75 (94)
T ss_pred             EEEEEecCCCcccCEEEEEEEE
Confidence            3457899999999999999974


No 364
>KOG1480|consensus
Probab=91.93  E-value=0.11  Score=44.75  Aligned_cols=106  Identities=17%  Similarity=0.229  Sum_probs=63.5

Q ss_pred             CCcccCCCCceEEEeCCcEEEEEEee-ccCCccceeeeEEEEEEecCCccEEEeeeceeeeCCceEEEEcCCceEEEEEc
Q psy5838          17 MPHFAEPIPNVTVTVGRDALLACVVD-NLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIK   95 (215)
Q Consensus        17 ~p~~~~~~~~~~~~~G~~v~L~C~~~-~~~~~~~~~~~~~v~W~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~   95 (215)
                      +-.|...+.--.|..+..+.|.|+.. +.+...       +.|++++ ..+        ..+.....    .....+.+.
T Consensus       129 rk~f~~~p~~q~V~~~s~~~l~cr~pe~~paae-------~~w~k~e-~~~--------~pd~n~~~----~~d~~li~~  188 (909)
T KOG1480|consen  129 RKHFEQSPVGQEVQEETTLQLPCRPPEGDPKAE-------VEWLKNE-VVI--------DPDANVIR----ASDHNLIIS  188 (909)
T ss_pred             HHhhccChhhheecccccccccccCcccchhhh-------hhccccC-CCC--------Cccccchh----hhcCCcccc
Confidence            34566777777888899999999975 334444       8999954 322        11111111    123478899


Q ss_pred             cceecCCEEEEEEccCCCceEEEEccCCeEEEEEcccCCCCCeEEEEEe
Q psy5838          96 NVQESDRGWYMCQVNTNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQV  144 (215)
Q Consensus        96 ~~~~~d~G~Y~C~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~  144 (215)
                      .+...|+|+|+|++.+--.-.-++  .....+.+.....++..+|.|.+
T Consensus       189 ~arlsd~~nytc~a~ni~~~r~~~--~~~v~vyv~ggwsswt~w~~c~~  235 (909)
T KOG1480|consen  189 QARLSDSGNYTCEATNIVAKRKSD--PATVQVYVNGGWSEWTEWSTCNV  235 (909)
T ss_pred             chhhhhcccceeeeehhhcccccc--ceEEEEEEcCcccccccceeeee
Confidence            999999999999998632111111  11223445555556666665554


No 365
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=91.78  E-value=0.39  Score=30.84  Aligned_cols=28  Identities=25%  Similarity=0.572  Sum_probs=21.6

Q ss_pred             eecCCcEEEEEEecc-c-CCC-eEEEEeCCCc
Q psy5838         175 VREQANVTLNCKAQG-Y-PEP-YVMWRREDGA  203 (215)
Q Consensus       175 ~~~g~~~~l~C~~~~-~-p~~-~i~W~~~~~~  203 (215)
                      ...+..++|.|.+.+ + |.. .+.|.+ +|.
T Consensus        16 l~~~~~atLtClV~~f~~P~~i~V~W~~-~g~   46 (99)
T cd04986          16 LLLGSSASLTCTLSGLRDPEGAVFTWTP-SGG   46 (99)
T ss_pred             hCcCCccEEEEEEeccCCCCCeEEEEEE-CCc
Confidence            446889999999988 5 543 699999 544


No 366
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=91.74  E-value=1.5  Score=35.20  Aligned_cols=83  Identities=14%  Similarity=0.258  Sum_probs=48.5

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCCcc---EEEee------eceeeeCCceEEEE-----cCCce
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQT---ILSIH------HNVITQNPRISLTY-----NDHRS   89 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~~~---~~~~~------~~~~~~~~~~~~~~-----~~~~~   89 (215)
                      .+++.+..|..|.|.|.+..-......    ...|+.. +.+   +....      ......++.+.+..     .+-..
T Consensus       271 ~~~~~~~~g~~v~~~c~~s~~~~e~i~----~~~w~~t-~~~~~~~~g~~~~~~~v~~~~~~~~~~~i~~~~~~s~dlk~  345 (500)
T PHA02914        271 FDEVMLEVGKRVDIECFFSMCGNENIS----NAKWIDT-GFEIGPLIGTVKSKDIVEGDFAEDDDFMISAHANYSDDLKN  345 (500)
T ss_pred             cceeEeccCcEEEEEEEEeecCCcccc----cceEEec-CCcccceeEEEEecceeecccccCCceEEEEecccccchhh
Confidence            457778889999999998852222211    1788773 222   21110      00112223333331     22345


Q ss_pred             EEEEEccceecCCEEEEEEccC
Q psy5838          90 WFLNIKNVQESDRGWYMCQVNT  111 (215)
Q Consensus        90 ~~l~i~~~~~~d~G~Y~C~~~~  111 (215)
                      .+|.|.+++.+.+|.|.|++..
T Consensus       346 STLTIkka~I~N~GCY~~~a~~  367 (500)
T PHA02914        346 STLTIKKAHINNAGCYEAQAFM  367 (500)
T ss_pred             ceEEeeeEEEEcCCceEEEEec
Confidence            6888888888888888888864


No 367
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=91.68  E-value=0.12  Score=34.18  Aligned_cols=78  Identities=24%  Similarity=0.453  Sum_probs=49.0

Q ss_pred             eCCcEEEEEEeeccC--------CccceeeeEEEEEEec----C-----CccEEEeeece----eeeCCceEEEEc--CC
Q psy5838          31 VGRDALLACVVDNLK--------GFKGLRIGWQVAWVRV----D-----TQTILSIHHNV----ITQNPRISLTYN--DH   87 (215)
Q Consensus        31 ~G~~v~L~C~~~~~~--------~~~~~~~~~~v~W~~~----~-----~~~~~~~~~~~----~~~~~~~~~~~~--~~   87 (215)
                      .|++|+|+|.+...|        .+.+++    |.|.+-    +     ...++......    -...+|+.+...  ..
T Consensus         1 ~~g~v~LPC~f~~~p~~p~~~~~~~~~~r----IkW~~~~~~~~g~~~~e~~Vlv~~~g~~~~~~~y~gRv~l~~~~~~~   76 (117)
T cd05901           1 LSGSVVLPCRFSTLPTLPPSVITTSEFLR----IKWTKIEVDKNGKDHKETTVLVAQNGIIKIGQEYMGRVSVPSHPEDQ   76 (117)
T ss_pred             CCCCEEEeeEEEecCCCCCcccCCCCCcE----EEEEEecccccccCCCccEEEEEECCEEEECCcccCcEEeeccCCcC
Confidence            378999999999543        234566    555442    1     12222222211    123456666533  23


Q ss_pred             ceEEEEEccceecCCEEEEEEccCC
Q psy5838          88 RSWFLNIKNVQESDRGWYMCQVNTN  112 (215)
Q Consensus        88 ~~~~l~i~~~~~~d~G~Y~C~~~~~  112 (215)
                      ...+|.|.+++.+|+|.|.|.+...
T Consensus        77 g~asL~i~~v~~sD~G~Y~C~V~~g  101 (117)
T cd05901          77 GDASLTIVKLRASDAGVYRCEVMHG  101 (117)
T ss_pred             CceEEEEcccccccCEEEEEEEEEC
Confidence            5789999999999999999987643


No 368
>PHA03240 envelope glycoprotein M; Provisional
Probab=91.65  E-value=0.38  Score=34.93  Aligned_cols=29  Identities=24%  Similarity=0.220  Sum_probs=20.1

Q ss_pred             CceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEe
Q psy5838          25 PNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVR   60 (215)
Q Consensus        25 ~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~   60 (215)
                      .++.+.+|++|+|.-.-...+...       +.|++
T Consensus        31 ievt~r~G~nVTLga~~~lhpgq~-------v~Wy~   59 (258)
T PHA03240         31 EEHTTREGDPLLLGGGHGLGAGQK-------AHWYK   59 (258)
T ss_pred             eecccccCCceeeCCcccCCCCCE-------EEEEe
Confidence            367788999999874433233333       99999


No 369
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=91.54  E-value=0.2  Score=32.54  Aligned_cols=21  Identities=33%  Similarity=0.653  Sum_probs=15.0

Q ss_pred             EEEEEcccCCCCCeEEEEEee
Q psy5838         125 WFLNIKNVQESDRGWYMCQVN  145 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~  145 (215)
                      ..|.|.+++.+|+|.|.|...
T Consensus        72 ~~L~I~~~~~~Dsg~YyCa~~   92 (107)
T cd07700          72 YRLHINRVKPEDSGTYFCMTV   92 (107)
T ss_pred             EEEEECCCCHHHCEEEEEeEc
Confidence            446777777777777777763


No 370
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=91.16  E-value=6.5  Score=31.82  Aligned_cols=21  Identities=14%  Similarity=0.294  Sum_probs=15.7

Q ss_pred             CCceEEEeCCcE-EEEEEeecc
Q psy5838          24 IPNVTVTVGRDA-LLACVVDNL   44 (215)
Q Consensus        24 ~~~~~~~~G~~v-~L~C~~~~~   44 (215)
                      +-.+.+..|+.+ .|.|.+...
T Consensus        18 SynIi~~~gd~~~nlTCiLP~~   39 (500)
T PHA02914         18 SYNIFLRNEDEELALTCILPAA   39 (500)
T ss_pred             cceEEEecCceEEeeEEEcCCC
Confidence            346777788887 999998643


No 371
>KOG4597|consensus
Probab=91.15  E-value=0.48  Score=38.77  Aligned_cols=80  Identities=20%  Similarity=0.238  Sum_probs=51.8

Q ss_pred             CcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEec--CCccEEEeeeceeeeCCceEEEEcCCceEEEEEc
Q psy5838          18 PHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRV--DTQTILSIHHNVITQNPRISLTYNDHRSWFLNIK   95 (215)
Q Consensus        18 p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~i~   95 (215)
                      +.+..-|....+..|++..+.|.+.|.+.+.       |+|-+.  ++..++- .++....+..      -.+...|.|-
T Consensus       197 c~l~~cpa~w~vg~wetcS~tCg~~G~q~r~-------V~c~qv~anr~~vv~-~~nq~~e~p~------vtstcql~ic  262 (560)
T KOG4597|consen  197 CALVDCPAEWFVGDWETCSSTCGVQGRQYRV-------VTCEQVFANRENVVM-RPNQTVENPV------VTSTCQLVIC  262 (560)
T ss_pred             cccccCcchhhcccchhhcccccccCCcCce-------eeeehhhccccceee-cCccccCCcc------eeeeeeEEEc
Confidence            3444446667778899999999999888776       999553  1221110 0110011111      1145689999


Q ss_pred             cceecCCEEEEEEccC
Q psy5838          96 NVQESDRGWYMCQVNT  111 (215)
Q Consensus        96 ~~~~~d~G~Y~C~~~~  111 (215)
                      |....|+|.|+|.+.+
T Consensus       263 ~ewq~~a~w~tCs~rc  278 (560)
T KOG4597|consen  263 NEWQADAGWYTCSARC  278 (560)
T ss_pred             chhhcCCCceeecccc
Confidence            9999999999999875


No 372
>KOG1480|consensus
Probab=90.72  E-value=0.44  Score=41.38  Aligned_cols=43  Identities=19%  Similarity=0.395  Sum_probs=30.9

Q ss_pred             CCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          16 LMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        16 ~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      ..|.|+..+++..+..|.++.|.|.....+   ...++..-+|..+
T Consensus        23 ~l~~~~~~p~~~yii~~~p~~l~c~a~~a~---~i~~kc~~~wv~~   65 (909)
T KOG1480|consen   23 DLPHFTTEPKSAYIIKNKPLRLQCKANPAT---QIRFKCNSEWVHQ   65 (909)
T ss_pred             CcceeeecCCccceecCCCccceecCCccc---ccccccChhhhcC
Confidence            578899999999999999999999976322   1222233467664


No 373
>PHA03042 CD47-like protein; Provisional
Probab=90.49  E-value=0.96  Score=34.36  Aligned_cols=33  Identities=15%  Similarity=0.482  Sum_probs=20.5

Q ss_pred             EEeCCcEEEEEEeeccCCc--cceeeeEEEEEEecCCccE
Q psy5838          29 VTVGRDALLACVVDNLKGF--KGLRIGWQVAWVRVDTQTI   66 (215)
Q Consensus        29 ~~~G~~v~L~C~~~~~~~~--~~~~~~~~v~W~~~~~~~~   66 (215)
                      -...++|.++|.+......  ...    .+.|.. ++..+
T Consensus        28 T~CN~TV~IpC~v~n~~~~ni~~~----~V~Wkf-~~~~I   62 (286)
T PHA03042         28 TTCNKTIVIVCNLNLLIYYNISNI----HINWKF-NNKVI   62 (286)
T ss_pred             EecCceEEEEeecCChhhcCccce----EEEEEe-CCeeE
Confidence            3468899999999864211  111    288988 44433


No 374
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=90.20  E-value=3.3  Score=26.29  Aligned_cols=21  Identities=14%  Similarity=0.395  Sum_probs=16.1

Q ss_pred             cEEEEEEee-ccCCccceeeeEEEEEEec
Q psy5838          34 DALLACVVD-NLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        34 ~v~L~C~~~-~~~~~~~~~~~~~v~W~~~   61 (215)
                      .+.+.|... +.|...       +.|+++
T Consensus        17 ~~va~C~s~~gkPaa~-------IsW~~~   38 (95)
T cd07703          17 VPVAKCVSANGRPPAR-------ISWSST   38 (95)
T ss_pred             cEEEEEEcCCCCCCcE-------EEEEcC
Confidence            578899877 456666       999985


No 375
>PHA03052 Hypothetical protein; Provisional
Probab=89.77  E-value=1.7  Score=25.45  Aligned_cols=35  Identities=14%  Similarity=0.307  Sum_probs=25.3

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      |+.+.+..|..+++.|.+.-.+......    |.|.-++
T Consensus         4 P~~i~~slGs~ltI~Ckv~lg~g~~~a~----V~W~~N~   38 (69)
T PHA03052          4 PEGIVTSLGSNLTITCKVSLRPPTTDAD----VFWISNG   38 (69)
T ss_pred             CccEEEEccCCceEeEEEEecCCCcceE----EEEEeCC
Confidence            4778899999999999988433332332    8887743


No 376
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins. Ig2_Nectin-3-4_like: domain similar to the second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and nectin-4 (poliovirus receptor related protein 4). Nectin-3 and nectin-4 belong to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.  Nect
Probab=88.94  E-value=1  Score=28.81  Aligned_cols=30  Identities=30%  Similarity=0.606  Sum_probs=23.9

Q ss_pred             cceeeecCCcEEE-EEEe-cccCCCeEEEEeC
Q psy5838         171 TDLVVREQANVTL-NCKA-QGYPEPYVMWRRE  200 (215)
Q Consensus       171 ~~~~~~~g~~~~l-~C~~-~~~p~~~i~W~~~  200 (215)
                      ....+.+|..+.+ .|.+ .|.|.+.|+|+.+
T Consensus         9 ~~~~~~~g~~~~vA~C~sa~gkPaa~IsW~~~   40 (97)
T cd07704           9 PSLLIDGGNGTTLAACCAAEGRPAADVTWETN   40 (97)
T ss_pred             CeeEeecCcceeEEEEEccCCccCCEeEEeCC
Confidence            3445778888888 8988 5689999999984


No 377
>PHA03052 Hypothetical protein; Provisional
Probab=87.17  E-value=2.9  Score=24.56  Aligned_cols=33  Identities=27%  Similarity=0.574  Sum_probs=25.2

Q ss_pred             ceeeecCCcEEEEEEec-ccC--CCeEEEEeCCCccc
Q psy5838         172 DLVVREQANVTLNCKAQ-GYP--EPYVMWRREDGANL  205 (215)
Q Consensus       172 ~~~~~~g~~~~l~C~~~-~~p--~~~i~W~~~~~~~~  205 (215)
                      ...+..|..+++.|.+. +.|  .+.+.|.. |++.+
T Consensus         6 ~i~~slGs~ltI~Ckv~lg~g~~~a~V~W~~-N~~~~   41 (69)
T PHA03052          6 GIVTSLGSNLTITCKVSLRPPTTDADVFWIS-NGMYY   41 (69)
T ss_pred             cEEEEccCCceEeEEEEecCCCcceEEEEEe-CCcEE
Confidence            44578899999999984 333  45789999 77777


No 378
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=85.98  E-value=1.8  Score=28.56  Aligned_cols=31  Identities=29%  Similarity=0.532  Sum_probs=23.0

Q ss_pred             cceeeecCCcEEEEEEecccC--CCeEEEEeCC
Q psy5838         171 TDLVVREQANVTLNCKAQGYP--EPYVMWRRED  201 (215)
Q Consensus       171 ~~~~~~~g~~~~l~C~~~~~p--~~~i~W~~~~  201 (215)
                      ....+.+|++++|.|.....-  ...+.|++..
T Consensus         5 ~~~~v~~G~~vtL~C~~~~~~~~~~~~~WYkQ~   37 (117)
T cd04981           5 GPGLVKPGQSLKLSCKASGFTFTSYGVNWVRQA   37 (117)
T ss_pred             CCeEEcCCCCEEEEEEEeCCCcccceEEEEEEC
Confidence            345688999999999875432  3568999863


No 379
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=85.40  E-value=5.5  Score=23.59  Aligned_cols=34  Identities=24%  Similarity=0.397  Sum_probs=23.2

Q ss_pred             eEEEEEcccCCCCCeEEEEEeecCCCcceeeEEEEEc
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNTDPMRSRQGYLQVVV  160 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~~~~~~~~~~l~v~~  160 (215)
                      +..|.+-....+-.|.|.|.+..   ......|+|.+
T Consensus        32 ~~tlnLGs~~~DPRG~Y~C~~s~---~~~~~~LQVyY   65 (69)
T cd07691          32 NTLLDLGSRINDPRGTYSCKESE---PNKEKTLQVYY   65 (69)
T ss_pred             ccEEeccCcccCCCcceEecCcc---CCCcEEEEEEE
Confidence            34577778887889999998754   33445566653


No 380
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=84.73  E-value=1.1  Score=26.19  Aligned_cols=27  Identities=19%  Similarity=0.449  Sum_probs=19.5

Q ss_pred             ecCCcEEEEEEecccCCCeEEEEeCCCcccc
Q psy5838         176 REQANVTLNCKAQGYPEPYVMWRREDGANLS  206 (215)
Q Consensus       176 ~~g~~~~l~C~~~~~p~~~i~W~~~~~~~~~  206 (215)
                      ..|.+++|+|...+.   .+.|.+ |++.+.
T Consensus         5 isGTtVtlTCP~~~~---~i~W~~-n~~~~~   31 (65)
T cd07692           5 ISGTTVTVTCPLSGD---DIKWKK-NDQVSQ   31 (65)
T ss_pred             EeccEEEEECCCCCC---CceEEe-CCccCC
Confidence            468999999987532   399999 554443


No 381
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=83.48  E-value=2.3  Score=27.26  Aligned_cols=28  Identities=21%  Similarity=0.382  Sum_probs=22.1

Q ss_pred             eecCCcEEEEEEecc-cCC--CeEEEEeCCCc
Q psy5838         175 VREQANVTLNCKAQG-YPE--PYVMWRREDGA  203 (215)
Q Consensus       175 ~~~g~~~~l~C~~~~-~p~--~~i~W~~~~~~  203 (215)
                      ..+|..+++.|.+.+ +|.  ..+.|++ +..
T Consensus        12 l~~G~~vtv~C~v~~v~P~~~l~v~Llk-G~~   42 (99)
T cd07689          12 LEEGKPVTVKCEVPDVYPFDRLEIELLK-GET   42 (99)
T ss_pred             ccCCceEEEEEEecCcccCCceEEEEec-Ccc
Confidence            468999999999976 676  4799988 443


No 382
>PHA03189 UL14 tegument protein; Provisional
Probab=80.56  E-value=25  Score=27.45  Aligned_cols=25  Identities=12%  Similarity=0.135  Sum_probs=19.8

Q ss_pred             CCceEEEeCCcEEEEEEeeccCCcc
Q psy5838          24 IPNVTVTVGRDALLACVVDNLKGFK   48 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~~~~~~   48 (215)
                      +.+..+..|+.|++.|.+..+.-+.
T Consensus        59 pAP~l~pyGdrvtVpC~fp~H~WPe   83 (348)
T PHA03189         59 PAPLLVPYGDRVTVPCTFPTHDWPE   83 (348)
T ss_pred             CCccccCCCceeeeeeeecCCCCce
Confidence            5567788999999999998665443


No 383
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=80.41  E-value=2.9  Score=26.56  Aligned_cols=23  Identities=17%  Similarity=0.533  Sum_probs=18.7

Q ss_pred             CCcEEEEEEe-cccCCCeEEEEeC
Q psy5838         178 QANVTLNCKA-QGYPEPYVMWRRE  200 (215)
Q Consensus       178 g~~~~l~C~~-~~~p~~~i~W~~~  200 (215)
                      .....+.|.+ .|.|.+.|+|+++
T Consensus        15 ~~~~va~C~s~~gkP~a~ItW~~~   38 (95)
T cd05719          15 EPVTVATCVSANGKPPATISWETT   38 (95)
T ss_pred             CccEEEEEECCCCcCCCEEEEEeC
Confidence            3567778999 5689999999994


No 384
>PF05790 C2-set:  Immunoglobulin C2-set domain;  InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C2-set domains, which are Ig-like domains resembling the antibody constant domain. C2-set domains are found primarily in the mammalian T-cell surface antigens CD2 (Cluster of Differentiation 2), CD4 and CD80, as well as in vascular (VCAM) and intercellular (ICAM) cell adhesion molecules. CD2 mediates T-cell adhesion via its ectodomain, and signal transduction utilising its 117-amino acid cytoplasmic tail []. CD2 displays structural and functional similarities with African swine fever virus (ASFV) LMW8-DR, a protein that is involved in cell-cell adhesion and immune response modulation, suggesting a possible role in the pathogenesis of ASFV infection []. CD4 is the primary receptor for HIV-1. CD4 has four immunoglobulin-like domains in its extracellular region that share the same structure, but can differ in sequence. Certain extracellular domains may be involved in dimerisation [].; GO: 0007155 cell adhesion, 0016021 integral to membrane; PDB: 1CID_A 1CDU_A 1WIQ_B 2NY4_B 2NY2_B 1WIP_B 1WIO_A 3S4S_G 1CDY_A 3S5L_G ....
Probab=80.15  E-value=11  Score=23.06  Aligned_cols=27  Identities=15%  Similarity=0.396  Sum_probs=18.4

Q ss_pred             EEEcccCCCCCeEEEEEeecCCCccee
Q psy5838         127 LNIKNVQESDRGWYMCQVNTDPMRSRQ  153 (215)
Q Consensus       127 l~i~~~~~~d~G~Y~C~~~~~~~~~~~  153 (215)
                      +.+......|+|...|.|.........
T Consensus        45 ~~~~~~~~~d~G~w~C~a~~~~~k~~~   71 (80)
T PF05790_consen   45 VSTFTPTTEDSGTWVCTASDNEPKERE   71 (80)
T ss_dssp             EEEESBTCGGSEEEEEEEEECTTEEEE
T ss_pred             EEEecCCCCCCEEEEEEEcCCceEEEE
Confidence            456677779999999999533333333


No 385
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=79.28  E-value=3  Score=26.51  Aligned_cols=22  Identities=18%  Similarity=0.492  Sum_probs=18.1

Q ss_pred             CcEEEEEEec-ccCCCeEEEEeC
Q psy5838         179 ANVTLNCKAQ-GYPEPYVMWRRE  200 (215)
Q Consensus       179 ~~~~l~C~~~-~~p~~~i~W~~~  200 (215)
                      ....+.|.+. |.|.+.|+|+.+
T Consensus        16 ~~~va~C~s~~gkPaa~IsW~~~   38 (95)
T cd07703          16 PVPVAKCVSANGRPPARISWSST   38 (95)
T ss_pred             ccEEEEEEcCCCCCCcEEEEEcC
Confidence            4577899885 589999999994


No 386
>PHA03376 BARF1; Provisional
Probab=77.46  E-value=1.6  Score=31.57  Aligned_cols=36  Identities=17%  Similarity=0.403  Sum_probs=27.4

Q ss_pred             CCceEEEEcCCceEEEEEccceecCCEEEEEEccCCC
Q psy5838          77 NPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTNP  113 (215)
Q Consensus        77 ~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~~~  113 (215)
                      ..++.+..+. ++.+|.|.+++.+|.|.|+|......
T Consensus        75 RGrtD~~~~~-gnvsLvI~~l~lSDdGtY~C~fQkge  110 (221)
T PHA03376         75 RGFFDIHRSA-NTFFLVVTAANISHDGNYLCRMKLGE  110 (221)
T ss_pred             ccEEEEEecC-CeEEEEEEeeeecCCceEEEEEEcCC
Confidence            3444444333 78899999999999999999887543


No 387
>PHA03270 envelope glycoprotein C; Provisional
Probab=76.11  E-value=43  Score=27.64  Aligned_cols=42  Identities=17%  Similarity=0.133  Sum_probs=28.3

Q ss_pred             CCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          16 LMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        16 ~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      ..|.+...++.  +..|+...-.|.+.....+...+    +.||+++.
T Consensus       220 r~Psvsv~~~P--vL~Ge~Y~AtC~va~YYPp~Sv~----lrWf~ng~  261 (466)
T PHA03270        220 RRPSLSIRPHA--VLEGEPFGATCVAANYYPGDRAA----FRWFEGGD  261 (466)
T ss_pred             cCCcccccCCc--cccCCCceEEEEeeeecCCCceE----EEEEeCCc
Confidence            35555554443  34799989999998766565554    89999543


No 388
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=72.22  E-value=4.3  Score=30.86  Aligned_cols=22  Identities=41%  Similarity=0.466  Sum_probs=19.3

Q ss_pred             EEEEEcccCCCCCeEEEEEeec
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      +.|.+.+..++++|.|+|....
T Consensus        37 G~L~~~~F~esmSG~YTCtLsY   58 (271)
T PF07354_consen   37 GKLMFKNFQESMSGSYTCTLSY   58 (271)
T ss_pred             ceEEeeccccccCCceEEEEEE
Confidence            3499999999999999999854


No 389
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=71.56  E-value=11  Score=24.97  Aligned_cols=29  Identities=7%  Similarity=0.039  Sum_probs=22.1

Q ss_pred             ceeeecCCcEEEEEEecccCCC---eEEEEeC
Q psy5838         172 DLVVREQANVTLNCKAQGYPEP---YVMWRRE  200 (215)
Q Consensus       172 ~~~~~~g~~~~l~C~~~~~p~~---~i~W~~~  200 (215)
                      ...+.+|++++|.|..+++-..   .+.|++.
T Consensus         7 ~~lv~p~~sv~LsC~~sg~~~s~e~~~~wvRq   38 (115)
T cd05721           7 PVLASSNGAASLVCEYTYNGFSKEFRASLLKG   38 (115)
T ss_pred             CeEEcCCCCEEEEEEecCCccccEEEEEEEEe
Confidence            4557889999999999775333   5789984


No 390
>PF06328 Lep_receptor_Ig:  Ig-like C2-type domain;  InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) []. The two cysteine residues form a disulphide bridge.; PDB: 3L5H_A 1P9M_A 1I1R_A 2D9Q_B.
Probab=71.06  E-value=23  Score=22.19  Aligned_cols=20  Identities=25%  Similarity=0.600  Sum_probs=14.6

Q ss_pred             CCceEEEeCCcEEEEEEeec
Q psy5838          24 IPNVTVTVGRDALLACVVDN   43 (215)
Q Consensus        24 ~~~~~~~~G~~v~L~C~~~~   43 (215)
                      ++...+..|++|+..|.+..
T Consensus        10 p~~pvv~lGS~vtasC~l~~   29 (89)
T PF06328_consen   10 PPSPVVSLGSNVTASCVLKQ   29 (89)
T ss_dssp             CSSSEEETTS-EEEEEEE-C
T ss_pred             cCCCEEeCCCCEEEEEEEEC
Confidence            34567789999999999984


No 391
>PHA03112 IL-18 binding protein; Provisional
Probab=67.94  E-value=28  Score=23.89  Aligned_cols=28  Identities=14%  Similarity=0.106  Sum_probs=19.6

Q ss_pred             EeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          30 TVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        30 ~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      ..|+++.|.|...+.-+.-.     .++|..++
T Consensus        36 k~~~~vvL~C~gcs~fp~fS-----~lYWl~gn   63 (141)
T PHA03112         36 KETEKVVLECRGCSYFPKFS-----YVYWLIGN   63 (141)
T ss_pred             CCCCEEEEEEECccCCCCce-----EEEEEcCC
Confidence            46999999999885432222     28999755


No 392
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=67.68  E-value=17  Score=28.90  Aligned_cols=23  Identities=17%  Similarity=0.287  Sum_probs=17.4

Q ss_pred             cEEEEEEeeccCCccceeeeEEEEEEec
Q psy5838          34 DALLACVVDNLKGFKGLRIGWQVAWVRV   61 (215)
Q Consensus        34 ~v~L~C~~~~~~~~~~~~~~~~v~W~~~   61 (215)
                      .++|.|.+.+..+....     +.|.|+
T Consensus       216 ~~tL~C~A~GFYP~~I~-----v~W~kd  238 (338)
T PHA02865        216 NTTLFCTFDSHYPSSVA-----AKWYNS  238 (338)
T ss_pred             CceEEEEEEeEeCCccE-----EEEEec
Confidence            58999999987554422     899995


No 393
>PF06328 Lep_receptor_Ig:  Ig-like C2-type domain;  InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) []. The two cysteine residues form a disulphide bridge.; PDB: 3L5H_A 1P9M_A 1I1R_A 2D9Q_B.
Probab=65.85  E-value=21  Score=22.35  Aligned_cols=33  Identities=24%  Similarity=0.494  Sum_probs=22.4

Q ss_pred             ceeeecCCcEEEEEEeccc-----CCCeEEEEeCCCccc
Q psy5838         172 DLVVREQANVTLNCKAQGY-----PEPYVMWRREDGANL  205 (215)
Q Consensus       172 ~~~~~~g~~~~l~C~~~~~-----p~~~i~W~~~~~~~~  205 (215)
                      ...+..|++++..|.....     +...|.|.. |+..+
T Consensus        12 ~pvv~lGS~vtasC~l~~~c~~~~~a~~I~Wkl-n~~~i   49 (89)
T PF06328_consen   12 SPVVSLGSNVTASCVLKQNCSHSVNASQIVWKL-NGEKI   49 (89)
T ss_dssp             SSEEETTS-EEEEEEE-CCCHCT-STTCEEEEC-SSCES
T ss_pred             CCEEeCCCCEEEEEEEECCCCCCcccceEEEEE-CCEEC
Confidence            3457899999999998532     334799999 66644


No 394
>PF06832 BiPBP_C:  Penicillin-Binding Protein C-terminus Family;  InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs). A variable length loop region separates this region from the transpeptidase unit (IPR001460 from INTERPRO). It is predicted to be a beta fold.
Probab=64.91  E-value=30  Score=21.33  Aligned_cols=25  Identities=36%  Similarity=0.400  Sum_probs=17.6

Q ss_pred             cEEEEEEecccCCCeEEEEeCCCcccc
Q psy5838         180 NVTLNCKAQGYPEPYVMWRREDGANLS  206 (215)
Q Consensus       180 ~~~l~C~~~~~p~~~i~W~~~~~~~~~  206 (215)
                      ...|.+.+.+. .+.+.|+. ||+.+.
T Consensus        31 ~~~l~l~a~~~-~~~~~W~v-dg~~~g   55 (89)
T PF06832_consen   31 RQPLVLKAAGG-RGPVYWFV-DGEPLG   55 (89)
T ss_pred             cceEEEEEeCC-CCcEEEEE-CCEEcc
Confidence            55566666554 44899999 888873


No 395
>PHA03269 envelope glycoprotein C; Provisional
Probab=63.34  E-value=92  Score=26.32  Aligned_cols=42  Identities=17%  Similarity=0.142  Sum_probs=28.2

Q ss_pred             CCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          16 LMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        16 ~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      .+|.+...++.  +.+|+...-.|.+.....+...+    +.|+++++
T Consensus       328 r~PsVsV~p~P--VL~Ge~YkAtC~vA~YYPp~Svr----lrWf~ng~  369 (566)
T PHA03269        328 KRPNITVIGDP--VLLGNPYAAYCKVNKYYPPHSVI----VKWTSNFG  369 (566)
T ss_pred             cCCCccccCCc--cccCCCceEEEEeeeecCCCceE----EEEEeCCc
Confidence            35555544433  34799999999998765555554    89999533


No 396
>PF02440 Adeno_E3_CR1:  Adenovirus E3 region protein CR1;  InterPro: IPR003471 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D virus) 49 Kd protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=58.63  E-value=34  Score=19.88  Aligned_cols=21  Identities=33%  Similarity=0.515  Sum_probs=13.6

Q ss_pred             EEeCCcEEEEEEeeccCCccceeeeEEEEEEe
Q psy5838          29 VTVGRDALLACVVDNLKGFKGLRIGWQVAWVR   60 (215)
Q Consensus        29 ~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~   60 (215)
                      |..|+.++|.    |++...       |.|++
T Consensus         2 v~~G~N~TL~----Gp~~~~-------V~Wy~   22 (63)
T PF02440_consen    2 VTVGSNVTLV----GPPDGP-------VTWYK   22 (63)
T ss_pred             EeEcCcEEEe----CCCCCc-------eEEEE
Confidence            5678888875    444334       88983


No 397
>PF05790 C2-set:  Immunoglobulin C2-set domain;  InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C2-set domains, which are Ig-like domains resembling the antibody constant domain. C2-set domains are found primarily in the mammalian T-cell surface antigens CD2 (Cluster of Differentiation 2), CD4 and CD80, as well as in vascular (VCAM) and intercellular (ICAM) cell adhesion molecules. CD2 mediates T-cell adhesion via its ectodomain, and signal transduction utilising its 117-amino acid cytoplasmic tail []. CD2 displays structural and functional similarities with African swine fever virus (ASFV) LMW8-DR, a protein that is involved in cell-cell adhesion and immune response modulation, suggesting a possible role in the pathogenesis of ASFV infection []. CD4 is the primary receptor for HIV-1. CD4 has four immunoglobulin-like domains in its extracellular region that share the same structure, but can differ in sequence. Certain extracellular domains may be involved in dimerisation [].; GO: 0007155 cell adhesion, 0016021 integral to membrane; PDB: 1CID_A 1CDU_A 1WIQ_B 2NY4_B 2NY2_B 1WIP_B 1WIO_A 3S4S_G 1CDY_A 3S5L_G ....
Probab=58.23  E-value=41  Score=20.57  Aligned_cols=23  Identities=17%  Similarity=0.518  Sum_probs=17.0

Q ss_pred             EEEEccceecCCEEEEEEc-cCCC
Q psy5838          91 FLNIKNVQESDRGWYMCQV-NTNP  113 (215)
Q Consensus        91 ~l~i~~~~~~d~G~Y~C~~-~~~~  113 (215)
                      ..........|+|.+.|.| .+++
T Consensus        44 ~~~~~~~~~~d~G~w~C~a~~~~~   67 (80)
T PF05790_consen   44 LVSTFTPTTEDSGTWVCTASDNEP   67 (80)
T ss_dssp             EEEEESBTCGGSEEEEEEEEECTT
T ss_pred             EEEEecCCCCCCEEEEEEEcCCce
Confidence            4455566779999999999 5543


No 398
>PHA03273 envelope glycoprotein C; Provisional
Probab=54.77  E-value=1.3e+02  Score=25.28  Aligned_cols=42  Identities=14%  Similarity=0.269  Sum_probs=28.1

Q ss_pred             CCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecCC
Q psy5838          16 LMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDT   63 (215)
Q Consensus        16 ~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~~   63 (215)
                      .+|.+...++.  +.+|+...-.|.+.....+...+    +.|+++++
T Consensus       236 r~Psvsv~~~P--vL~Ge~y~A~C~aa~YYPp~Sv~----~rWf~dg~  277 (486)
T PHA03273        236 NAPLVDLSVHP--SLKGENYRAVCVVASYFPHSSVK----LRWYKNAK  277 (486)
T ss_pred             cCCcccccCCc--cccCCCceEEEEeeeecCCCceE----EEEEeCCe
Confidence            35555554433  34799999999998765555554    89999543


No 399
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=54.32  E-value=25  Score=28.08  Aligned_cols=21  Identities=33%  Similarity=0.686  Sum_probs=17.2

Q ss_pred             cEEEEEEecc-cCCC-eEEEEeC
Q psy5838         180 NVTLNCKAQG-YPEP-YVMWRRE  200 (215)
Q Consensus       180 ~~~l~C~~~~-~p~~-~i~W~~~  200 (215)
                      .+.|.|.+.| +|.. .+.|.++
T Consensus       216 ~~tL~C~A~GFYP~~I~v~W~kd  238 (338)
T PHA02865        216 NTTLFCTFDSHYPSSVAAKWYNS  238 (338)
T ss_pred             CceEEEEEEeEeCCccEEEEEec
Confidence            5799999999 4655 6899993


No 400
>PHA03271 envelope glycoprotein C; Provisional
Probab=46.49  E-value=1.7e+02  Score=24.30  Aligned_cols=41  Identities=17%  Similarity=0.259  Sum_probs=27.9

Q ss_pred             CCCcccCCCCceEEEeCCcEEEEEEeeccCCccceeeeEEEEEEecC
Q psy5838          16 LMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVD   62 (215)
Q Consensus        16 ~~p~~~~~~~~~~~~~G~~v~L~C~~~~~~~~~~~~~~~~v~W~~~~   62 (215)
                      .+|.+...++.+  ..|+.-.-.|.+....++...+    +.|++++
T Consensus       246 RPPsVsV~a~PV--L~Ge~YkAtC~vAnYYPP~Svr----lrWf~nG  286 (490)
T PHA03271        246 RPASVDVLAPPV--LSGENYKASCIVRHFYPPGSVY----VSWRQNG  286 (490)
T ss_pred             cCCCccccCCcc--ccCCCceEEEEeeeecCCCceE----EEEEeCC
Confidence            345455544433  4799989999999766665554    8999953


No 401
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig2_Nectin-1_like: domain similar to the second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. Nectins also heterophilically trans-interact with other CAMs such as nectin-like molecules (necls); nectin-1 for example, has been shown to trans-interact with necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is associ
Probab=40.83  E-value=82  Score=20.14  Aligned_cols=17  Identities=18%  Similarity=0.499  Sum_probs=13.1

Q ss_pred             EEE-ccCCCceEEEEccC
Q psy5838         106 MCQ-VNTNPRISLTYNDH  122 (215)
Q Consensus       106 ~C~-~~~~~~~~~~~~~~  122 (215)
                      .|. +.|.|...++|...
T Consensus        26 ~CiSa~GrPpa~ItW~t~   43 (98)
T cd05890          26 TCVSANGKPPSVVRWDTR   43 (98)
T ss_pred             EEEcCCCcCCcEeEEEcc
Confidence            687 56889999999543


No 402
>PHA02982 hypothetical protein; Provisional
Probab=40.10  E-value=1.6e+02  Score=22.02  Aligned_cols=27  Identities=15%  Similarity=0.332  Sum_probs=22.8

Q ss_pred             CCeEEEEEcccCCCCCeEEEEEeecCC
Q psy5838         122 HRSWFLNIKNVQESDRGWYMCQVNTDP  148 (215)
Q Consensus       122 ~~~~~l~i~~~~~~d~G~Y~C~~~~~~  148 (215)
                      ...++|.|.++..+..|=|+|.+....
T Consensus        97 g~~STLTIkk~~i~N~GCYtc~~ks~~  123 (251)
T PHA02982         97 GNSSTFTMKKPDPQNLGCFTCEAKDAE  123 (251)
T ss_pred             ccceeEEeccCCcccCCceEEEEecCC
Confidence            455779999999999999999997644


No 403
>PF10572 UPF0556:  Uncharacterised protein family UPF0556;  InterPro: IPR018887  This family of proteins has no known function. 
Probab=37.18  E-value=1.5e+02  Score=20.86  Aligned_cols=14  Identities=29%  Similarity=0.622  Sum_probs=10.6

Q ss_pred             CCCCeEEEEEeecC
Q psy5838         134 ESDRGWYMCQVNTD  147 (215)
Q Consensus       134 ~~d~G~Y~C~~~~~  147 (215)
                      ..|.+.|+|.+.+.
T Consensus        69 s~d~~~~sC~I~RP   82 (158)
T PF10572_consen   69 SDDNGHYSCIIWRP   82 (158)
T ss_pred             cCCCCceEEEEECC
Confidence            35778999998654


No 404
>KOG4597|consensus
Probab=34.26  E-value=69  Score=26.91  Aligned_cols=55  Identities=22%  Similarity=0.292  Sum_probs=37.6

Q ss_pred             EEEEEEccCCCceEEEEcc---------------------CCeEEEEEcccCCCCCeEEEEEeecC-CCcceeeEEE
Q psy5838         103 GWYMCQVNTNPRISLTYND---------------------HRSWFLNIKNVQESDRGWYMCQVNTD-PMRSRQGYLQ  157 (215)
Q Consensus       103 G~Y~C~~~~~~~~~~~~~~---------------------~~~~~l~i~~~~~~d~G~Y~C~~~~~-~~~~~~~~l~  157 (215)
                      -..+|-+.|.+...++|..                     .....|.|.+....|+|+|+|.+... +...+.+.+.
T Consensus       214 cS~tCg~~G~q~r~V~c~qv~anr~~vv~~~nq~~e~p~vtstcql~ic~ewq~~a~w~tCs~rcg~g~~~rdv~c~  290 (560)
T KOG4597|consen  214 CSSTCGVQGRQYRVVTCEQVFANRENVVMRPNQTVENPVVTSTCQLVICNEWQADAGWYTCSARCGAGFLRRDVPCS  290 (560)
T ss_pred             hcccccccCCcCceeeeehhhccccceeecCccccCCcceeeeeeEEEcchhhcCCCceeeccccccceeeccceee
Confidence            3556777788888888832                     12344889999999999999999653 3333334433


No 405
>PF15096 G6B:  G6B family
Probab=33.80  E-value=49  Score=23.88  Aligned_cols=15  Identities=27%  Similarity=0.310  Sum_probs=11.5

Q ss_pred             EeCCcEEEEEEeecc
Q psy5838          30 TVGRDALLACVVDNL   44 (215)
Q Consensus        30 ~~G~~v~L~C~~~~~   44 (215)
                      ..|+.|+|.|.--.+
T Consensus         9 rPGDRVnlSCvGVs~   23 (224)
T PF15096_consen    9 RPGDRVNLSCVGVSH   23 (224)
T ss_pred             CCCCeeeeeeccCCC
Confidence            468999999986543


No 406
>PHA02935 Hypothetical protein; Provisional
Probab=32.74  E-value=94  Score=22.78  Aligned_cols=64  Identities=20%  Similarity=0.324  Sum_probs=29.8

Q ss_pred             EEEcccCCCCCeEEEEEeecCCCcceeeEEEEEcCCeEEecCCCcceeeecCCcEEEEEEeccc
Q psy5838         127 LNIKNVQESDRGWYMCQVNTDPMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQGY  190 (215)
Q Consensus       127 l~i~~~~~~d~G~Y~C~~~~~~~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~~l~C~~~~~  190 (215)
                      |.|..++-+|+|.|.-..+-....--..++.+.+...+.-.........+--..+.+.|+.+.+
T Consensus       104 lnisslryedsgsykgvshlkdgvivtttmnisvkaniidltgrvryltrnycevkirceiksf  167 (349)
T PHA02935        104 LNISSLRYEDSGSYKGVSHLKDGVIVTTTMNISVKANIIDLTGRVRYLTRNYCEVKIRCEIKSF  167 (349)
T ss_pred             eeccceeeccCCcccCchhhcCceEEEEEEEEEEEeeeEeccceeeeeccccEEEEEEEEEeee
Confidence            6677778888888864432111111122233333333332211111112333567778877543


No 407
>KOG0613|consensus
Probab=31.53  E-value=2.8e+02  Score=26.61  Aligned_cols=108  Identities=11%  Similarity=0.002  Sum_probs=54.4

Q ss_pred             EEEEccceecCCEEEEEEccCCCceEEEEccCCeEEEEEcccCCCCCeEEEEEeecCCCc-ceeeEEEEE----------
Q psy5838          91 FLNIKNVQESDRGWYMCQVNTNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTDPMR-SRQGYLQVV----------  159 (215)
Q Consensus        91 ~l~i~~~~~~d~G~Y~C~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~~~~~-~~~~~l~v~----------  159 (215)
                      .+.|.+.-..+.|.|.....+.-...-.  ........+.+....+.+.|+|.....+.. ...+...+.          
T Consensus       246 ~~~i~~~l~~~~G~~~~~~~~~l~e~~~--~~~~~t~~i~~~~~~~~~s~t~~~~~~~~q~~~~v~~~~~i~~~~~~p~~  323 (1205)
T KOG0613|consen  246 DRKIQLTLRAPRGPYSAHILGYLIEQRK--HKGGNTKTIQNDGPEPELSWTVADKRQGCQDRFKVTEEAPIGKGKPGPES  323 (1205)
T ss_pred             heeeeEEeecCCCchHHHHhcchhhhcc--cCCCccccccccCCccccceeeecccCCcccceeeeEEeeccccccCchh
Confidence            4556666666777775443321100000  111122344555555667777776543322 111211111          


Q ss_pred             ------cCCeEEecC-CCcceeeecCCcEEEEEEecccCCCe-EEEEeC
Q psy5838         160 ------VPPSIIDKD-TSTDLVVREQANVTLNCKAQGYPEPY-VMWRRE  200 (215)
Q Consensus       160 ------~~p~~~~~~-~~~~~~~~~g~~~~l~C~~~~~p~~~-i~W~~~  200 (215)
                            .++...+.. ....+....+..+++.|...+.+.+. +.|+++
T Consensus       324 ~~~aaa~~~~~~v~~~~~~~v~a~d~~~v~m~~~~~~~~~p~~~~~~~~  372 (1205)
T KOG0613|consen  324 LQAAAARPPEVPVGLVRNLSVTARDNTLVEMPTALSGTQKPDEAQGYHG  372 (1205)
T ss_pred             hhhhccCCccccccccccceeccccCcceeecccccCCcCCchheeecc
Confidence                  122222111 22344566788899999999887775 999994


No 408
>TIGR00864 PCC polycystin cation channel protein. Note: this model has been restricted to the amino half because for technical reasons.
Probab=27.68  E-value=7.9e+02  Score=26.42  Aligned_cols=99  Identities=9%  Similarity=-0.024  Sum_probs=58.4

Q ss_pred             EEccCCCceEEEEccCCeEEEE--EcccCCCCCeEEEEEee--c-CCCcceeeEEEEEcCCeEEecCCCcceeeecCCcE
Q psy5838         107 CQVNTNPRISLTYNDHRSWFLN--IKNVQESDRGWYMCQVN--T-DPMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANV  181 (215)
Q Consensus       107 C~~~~~~~~~~~~~~~~~~~l~--i~~~~~~d~G~Y~C~~~--~-~~~~~~~~~l~v~~~p~~~~~~~~~~~~~~~g~~~  181 (215)
                      -.+.......|.|.-.......  =...+..+.|.|+-.+.  + .+.......+.|+.+..-.... .....+..|+.+
T Consensus      1807 a~vstGsnVsw~W~f~~g~s~~gk~v~~Tf~~aG~ytV~L~AsN~vs~~~~s~~~~VQe~I~~L~L~-as~~~~~~n~~v 1885 (2740)
T TIGR00864      1807 GELATGTNVSWCWAIDGGSSKMGKHACMTFPDAGTFAIRLNASNAVSGKSASREFFAEEPIFGLELK-ASKKIAAIGEKV 1885 (2740)
T ss_pred             EEccCCCeeEEEEEeCCCCccccceeEEecCCCeEEEEEEEEEcccCcceeeeeEEEEEecceEEEe-cccccccCCCEE
Confidence            3444556677887332221111  11244567899987653  2 2334445557777666433222 223346789999


Q ss_pred             EEEEEecccCCCeEEEEeCCCcccc
Q psy5838         182 TLNCKAQGYPEPYVMWRREDGANLS  206 (215)
Q Consensus       182 ~l~C~~~~~p~~~i~W~~~~~~~~~  206 (215)
                      +|.+.....+...+.|-..++....
T Consensus      1886 ~fsa~l~~GS~Vtf~w~fGdgs~~~ 1910 (2740)
T TIGR00864      1886 EFQILLAAGSAVNFRLQIGGAAPEV 1910 (2740)
T ss_pred             EEEEEecCCCceEEEEEeCCCCcee
Confidence            9999887666678899997766543


No 409
>PHA03282 envelope glycoprotein E; Provisional
Probab=27.39  E-value=1.3e+02  Score=25.37  Aligned_cols=23  Identities=26%  Similarity=0.463  Sum_probs=18.1

Q ss_pred             eEEEEEcccCCCCCeEEEEEeec
Q psy5838         124 SWFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       124 ~~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      +.+|.|.+++++|+|.|+-.+..
T Consensus       123 n~tl~l~~a~~~DsG~Y~L~~~~  145 (540)
T PHA03282        123 NGTLVLREARETDSGMYVLSVSR  145 (540)
T ss_pred             cceEEEeeccccCCceEEEEecC
Confidence            45588889999999999887743


No 410
>PHA03282 envelope glycoprotein E; Provisional
Probab=27.20  E-value=1.3e+02  Score=25.38  Aligned_cols=22  Identities=27%  Similarity=0.584  Sum_probs=19.5

Q ss_pred             EEEEEcccCCCCCeEEEEEeec
Q psy5838         125 WFLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       125 ~~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      ..|++.++..+++|.|.|++..
T Consensus       333 VdL~F~nAp~saSGLYVfVl~y  354 (540)
T PHA03282        333 VNLQLRDASEASGGLYVCVVYV  354 (540)
T ss_pred             cceEecCCCcccCceEEEEEEE
Confidence            3699999999999999999854


No 411
>PF01688 Herpes_gI:  Alphaherpesvirus glycoprotein I;  InterPro: IPR002874 This family consists of glycoprotein I from various members of the alphaherpesvirinae. These include Human herpesvirus 1 (HHV-1), Human herpesvirus 3 (HHV-3) and Suid herpesvirus 1 (Pseudorabies virus). Glycoprotein I (gI) is important during natural infection, mutants lacking gI produce smaller lesions at the site of infection and show reduced neuronal spread []. gI forms a heterodimeric complex with gE; this complex displays Fc receptor activity (binds to the Fc region of immunoglobulin) []. Glycoproteins are also important in the production of virus-neutralizing antibodies and cell mediated immunity []. The alphaherpesviridae have a dsDNA genome and have no RNA stage during viral replication.; GO: 0033643 host cell part
Probab=25.05  E-value=2.3e+02  Score=20.06  Aligned_cols=26  Identities=31%  Similarity=0.447  Sum_probs=20.6

Q ss_pred             CCeEEEEEcccCCCCCeEEEEEeecC
Q psy5838         122 HRSWFLNIKNVQESDRGWYMCQVNTD  147 (215)
Q Consensus       122 ~~~~~l~i~~~~~~d~G~Y~C~~~~~  147 (215)
                      ....-|+|.+.+.+|+|.|.-++.-.
T Consensus       121 ~~~~lL~i~~p~~~dsG~Y~lRV~l~  146 (161)
T PF01688_consen  121 ENGVLLRIRNPRPEDSGIYYLRVWLD  146 (161)
T ss_pred             CcceEEEeCCCCcccceEEEEEEEEC
Confidence            34455899999999999999888543


No 412
>PF06214 SLAM:  Signaling lymphocytic activation molecule (SLAM) protein;  InterPro: IPR010407 This entry is found in several mammalian signalling lymphocytic activation molecule (SLAM) proteins. Optimal T cell activation and expansion require engagement of the TCR plus co-stimulatory signals delivered through accessory molecules. SLAM, a 70 kDa co-stimulatory molecule belonging to the Ig superfamily, is defined as a human cell surface molecule that mediates CD28-independent proliferation of human T cells and IFN-gamma production by human Th1 and Th2 clones []. SLAM has also been recognised as a receptor for Measles virus [].; GO: 0004872 receptor activity, 0046649 lymphocyte activation, 0009986 cell surface, 0016021 integral to membrane; PDB: 3ALX_D 3ALZ_B 3ALW_A.
Probab=24.80  E-value=1.2e+02  Score=19.92  Aligned_cols=17  Identities=18%  Similarity=0.354  Sum_probs=10.2

Q ss_pred             eEEEeCCcEEEEEEeec
Q psy5838          27 VTVTVGRDALLACVVDN   43 (215)
Q Consensus        27 ~~~~~G~~v~L~C~~~~   43 (215)
                      +....|.++-|+-...+
T Consensus        35 i~~~LGs~vlLpLt~eg   51 (126)
T PF06214_consen   35 ILQQLGSSVLLPLTSEG   51 (126)
T ss_dssp             EEEETTS-EEEESSSTS
T ss_pred             HHHHhCcceeeecchhh
Confidence            44567888887755543


No 413
>PHA03286 envelope glycoprotein E; Provisional
Probab=24.06  E-value=1.1e+02  Score=25.50  Aligned_cols=44  Identities=18%  Similarity=0.238  Sum_probs=0.0

Q ss_pred             EEEEccCCCceEEEEccCCeEEEEEcccCCCCCeEEEEEeecCC
Q psy5838         105 YMCQVNTNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTDP  148 (215)
Q Consensus       105 Y~C~~~~~~~~~~~~~~~~~~~l~i~~~~~~d~G~Y~C~~~~~~  148 (215)
                      |.-......+..+.|-....-.|++.++..+++|.|-|++...+
T Consensus       287 ~~~~ides~~~~la~l~~~i~nL~f~nA~~s~SGLYVfVl~yNG  330 (492)
T PHA03286        287 YDTSVDESVQGRLAFLESDIPSFRLANAQPTDAGLYVVVALYNG  330 (492)
T ss_pred             cccccCccccccceeeccCCCceeecCCCcccCceEEEEEEECC


No 414
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=21.02  E-value=81  Score=26.37  Aligned_cols=21  Identities=33%  Similarity=0.373  Sum_probs=15.7

Q ss_pred             EEEEcccCCCCCeEEEEEeec
Q psy5838         126 FLNIKNVQESDRGWYMCQVNT  146 (215)
Q Consensus       126 ~l~i~~~~~~d~G~Y~C~~~~  146 (215)
                      .|++.++..+++|.|.|++..
T Consensus       270 ~l~f~~a~~~~sGLYv~V~~~  290 (439)
T PF02480_consen  270 DLQFTNAPESASGLYVFVVYY  290 (439)
T ss_dssp             SEEESS--GGG-EEEEEEEEE
T ss_pred             ceEecCCCcccCceEEEEEEE
Confidence            389999999999999999853


No 415
>PF03921 ICAM_N:  Intercellular adhesion molecule (ICAM), N-terminal domain;  InterPro: IPR013768 Intercellular adhesion molecules (ICAMs) and vascular cell adhesion molecule-1 (VCAM-1) are part of the immunoglobulin superfamily. They are important in inflammation, immune responses and in intracellular signalling events []. The ICAM family consists of five members, designated ICAM-1 to ICAM-5. They are known to bind to leucocyte integrins CD11/CD18 during inflammation and in immune responses. In addition, ICAMs may exist in soluble forms in human plasma, due to activation and proteolysis mechanisms at cell surfaces. ICAM-1 (CD54) contains five Ig-like domains. It is expressed on leucocytes, endothelial and epithelial cells, and is upregulated in response to bacterial invasion. The protein is a ligand for lymphocyte-function associated (LFA) antigens and also a receptor for CD11a,b/CD18, fibrinogen, human rhinovirus and Plasmodium falciparum-infected erythrocytes. ICAM-1 binding sites for CD11a/CD18 and its other binding partners are located in the first domain and are overlapping. ICAM-1 domain 2 seems to play an important role in maintaining the conformation of domain 1 and particularly the structural integrity of the LFA-1 ligand-binding site []. The 3-dimensional atomic structure of the tandem N-terminal Ig-like domains (D1 and D2) of ICAM-1 has been determined to 2.2A resolution and fitted into a cryoelectron microscopy reconstruction of a rhinovirus-ICAM-1 complex []. Extensive charge interactions between ICAM-1 and human rhinovirusesare largely conserved in major and minor receptor groups of rhinoviruses. The interaction of ICAMs with LFA-1 is mediated by a divalent cation bound to the insertion (I)-domain on the alpha chain of LFA-1 and the carboxyl group of a conserved glutamic acid residue on ICAMs. ICAM-2 (CD102) has two Ig-like domains. It is expressed on endothelial cells, leucocytes and platelets, and binds to CD11a'b/CD18. The protein is refractory to proinflammatory cytokines, and plays an important role in the adhesion of leucocytes to the uninduced endothelium []. ICAM-3 (CD50) contains five Ig-like domains and binds to leucocyte integrins CD11a'd/CD18. The protein plays an important role in the immune response and perhaps in signal transduction []. ICAM-4 (LW blood group Ag) is red blood cell (RBC) specific and binds to CD11a'b/CD18. It is associated with the RBC Rh antigens and could be important in retaining immature red cells in the bone marrow, or in the uptake of senescent cells into the spleen []. ICAM-5 (telencephalin) has nine Ig-like domains and is confined to the telencephalon of the brain. The role of this CD11a/CD18 binding molecule is not yet known []. VCAM-1 was first described as a cytokine-inducible endothelial adhesion molecule. It can bind to leucocyte integrin VL-4 (very late antigen-4) to recruit leucocytes to sites of inflammation []. The predominant form of VCAM-1 in vivo has an N-terminal extracellular region comprising seven Ig-like domains []. A conserved integrin-binding motif has been identified in domains 1 and 4, variants of which are present in the N-terminal domain of all members of the integrin-binding subgroup of the immunoglobulin superfamily. The structure of a VLA-4-binding fragment comprising the first two domains of VCAM-1 has been determined to 1.8A resolution. The integrin-binding motif is exposed and forms the N-terminal region of the loop between beta-strands C and D of domain 1 []. VCAM-1 domains 1 and 2 are structurally similar to ICAM-1 and ICAM-2 []. This entry represents the N-terminal domain of ICAM proteins such as ICAM-2, ICAM-3 and ICAM-4.; PDB: 3BN3_B 1T0P_B 1ZXQ_A 3TCX_A 1MQ8_A 1Z7Z_I 1IC1_A 1IAM_A.
Probab=20.52  E-value=2.4e+02  Score=17.81  Aligned_cols=22  Identities=14%  Similarity=0.208  Sum_probs=18.5

Q ss_pred             cCCCCceEEEeCCcEEEEEEee
Q psy5838          21 AEPIPNVTVTVGRDALLACVVD   42 (215)
Q Consensus        21 ~~~~~~~~~~~G~~v~L~C~~~   42 (215)
                      ...|....+..|+++.+.|+..
T Consensus         7 ~v~P~~~vV~~G~Sv~VNCSts   28 (91)
T PF03921_consen    7 RVSPEEPVVPPGGSVWVNCSTS   28 (91)
T ss_dssp             EEESSEEEEETTEEEEEEEEES
T ss_pred             EEECCccEECCCCCEEEEEcCC
Confidence            3456788999999999999975


Done!