Diaphorina citri psyllid: psy5838


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MVSYFPEPVSSVSESLMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTDPMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYNGDTELLT
ccccccccccccccccccCCccccccEEEEccccEEEEEEEcccccccccccccEEEEEEccccEEEEEcccEEEccccEEEEEccccEEEEEEEECcccccCEEEEEEcccccccEEECccccEEEEEEEEccccccCEEEEECccccccCEEEEEEEcccCEECccccccEEEcccccEEEEEEEEECcccEEEEEEccccEEEccccEEEEc
MVSYFP*PVS***ESLM*HFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTDPMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQGYPEPYVMWRREDGA************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSYFPEPVSSVSESLMPHFAEPIPNVTVTVGRDALLACVVDNLKGFKGLRIGWQVAWVRVDTQTILSIHHNVITQNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTNPRISLTYNDHRSWFLNIKNVQESDRGWYMCQVNTDPMRSRQGYLQVVVPPSIIDKDTSTDLVVREQANVTLNCKAQGYPEPYVMWRREDGANLSYNGDTELLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 18-67,87-210
View the alignment between query and template
View the model in PyMOL
Template: 3V2A, chain R
Confidence level:very confident
Coverage over the Query: 24-111
View the alignment between query and template
View the model in PyMOL
Template: 1NN8, chain R
Confidence level:probable
Coverage over the Query: 25-73,93-202
View the alignment between query and template
View the model in PyMOL