Query         psy5840
Match_columns 132
No_of_seqs    104 out of 196
Neff          4.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:24:56 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5840.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5840hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03066 Nucleoplasmin:  Nucleo 100.0 5.7E-40 1.2E-44  251.0   8.8   82    1-84     32-114 (149)
  2 PF06524 NOA36:  NOA36 protein;  72.6     1.8 3.9E-05   37.3   1.1    6   30-35    209-214 (314)
  3 PF03066 Nucleoplasmin:  Nucleo  66.4     1.9 4.1E-05   33.2   0.0   17   55-71     74-90  (149)
  4 PTZ00415 transmission-blocking  52.9     6.5 0.00014   41.7   1.1   12    5-16     28-39  (2849)
  5 KOG4264|consensus               39.4      14  0.0003   34.8   1.0   23   66-88     54-76  (694)
  6 PF05475 Chlam_vir:  Chlamydia   32.4      61  0.0013   27.4   3.5   31   35-73    204-237 (264)
  7 PF04889 Cwf_Cwc_15:  Cwf15/Cwc  32.3      28  0.0006   28.9   1.6   14   98-111   142-155 (244)
  8 TIGR00986 3a0801s05tom22 mitoc  25.6      36 0.00078   26.7   1.1   28   83-110    27-54  (145)
  9 KOG0772|consensus               25.2      35 0.00076   32.2   1.1    8   56-63     90-97  (641)
 10 cd02859 AMPKbeta_GBD_like AMP-  24.9      64  0.0014   21.6   2.1   19   56-74      2-20  (79)
 11 KOG3214|consensus               24.1      27 0.00059   26.2   0.1   14   91-104    94-107 (109)
 12 KOG0682|consensus               21.9      40 0.00086   31.2   0.8   12   64-75    188-199 (500)
 13 KOG2140|consensus               21.5      43 0.00094   31.9   0.9   13   91-103   427-439 (739)
 14 cd06265 RNase_A_canonical Cano  21.3 1.2E+02  0.0027   22.1   3.1   43   30-73     73-115 (115)
 15 PF02724 CDC45:  CDC45-like pro  21.3      46   0.001   30.9   1.1   16   56-71     74-89  (622)
 16 KOG0699|consensus               20.4      39 0.00085   30.9   0.4   18   89-106   296-313 (542)
 17 PF03153 TFIIA:  Transcription   20.3      58  0.0013   27.6   1.4   10  122-131   350-359 (375)

No 1  
>PF03066 Nucleoplasmin:  Nucleoplasmin;  InterPro: IPR004301 The nucleophosmin/nucleoplasmin family of chaperones includes nucleophosmin, nucleoplasmin and nucleoplasmin-like proteins. They function as nuclear chaperones which are needed for the proper assembly of nucleosomes and the attainment of proper higher order chromatin structures [].; GO: 0003676 nucleic acid binding; PDB: 2P1B_E 1XB9_I 1XE0_C 1NLQ_A 2VTX_E 1K5J_D 1EJY_N 1EE5_B 3T30_J.
Probab=100.00  E-value=5.7e-40  Score=250.97  Aligned_cols=82  Identities=44%  Similarity=0.631  Sum_probs=70.9

Q ss_pred             CeeeeeecCCCCCCCceEEEEEEecccCC-CeeeEEEEeecCcccceeccCccCCCCCeEEEEEecccceEeeeceeeee
Q psy5840           1 MFLFQAVIGANAKEGEVHVVEVEAMGFRA-DIKLPIVVLKAAGVNNHAPLDLLFPDPPVTFKLVKGSGPIYLFGNHSVGT   79 (132)
Q Consensus         1 L~Lr~vcLGa~AK~dE~nvVEvea~~~~~-~ikv~IAtLk~s~~~p~v~Ldl~f~~pPVtF~L~~GSGPVhIsGqhlv~~   79 (132)
                      |+|||||||++|| +|+|||||++|||++ ++++||||||+| ++||++|+++|++|||||||++|||||||||||++++
T Consensus        32 L~L~~v~Lga~AK-dE~~vVe~e~~~~eg~~~kv~lAtLk~s-~~~~vsL~~~~~~ppVtf~L~~GsGPVhisG~~~~~~  109 (149)
T PF03066_consen   32 LSLRQVCLGAGAK-DELNVVEVEAMNYEGKPIKVPLATLKMS-VQPMVSLDGFEITPPVTFRLKCGSGPVHISGQHLVAM  109 (149)
T ss_dssp             EEEEEEEE-TTS--SSEEEEEEEEEBTTSCEEEEEEEEEBTT-TBSEEEEEEEEESSSEEEEEEESSS-EEEEEEEEEE-
T ss_pred             EEEEEeecCCCcc-CceeEEEEEeccCCCCeeEEEEEEecCC-ccceEEcCCcccCCCEEEEEEecCCCEEeeCcccccc
Confidence            7899999999999 799999999999998 799999999999 9999999999989999999999999999999999998


Q ss_pred             cCCCC
Q psy5840          80 GEPMG   84 (132)
Q Consensus        80 ~e~~e   84 (132)
                      +++.+
T Consensus       110 ~~d~~  114 (149)
T PF03066_consen  110 EEDEE  114 (149)
T ss_dssp             -----
T ss_pred             ccccc
Confidence            87654


No 2  
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=72.59  E-value=1.8  Score=37.34  Aligned_cols=6  Identities=33%  Similarity=0.373  Sum_probs=2.5

Q ss_pred             CeeeEE
Q psy5840          30 DIKLPI   35 (132)
Q Consensus        30 ~ikv~I   35 (132)
                      +++.|=
T Consensus       209 ~~PCPK  214 (314)
T PF06524_consen  209 PIPCPK  214 (314)
T ss_pred             CCCCCC
Confidence            344443


No 3  
>PF03066 Nucleoplasmin:  Nucleoplasmin;  InterPro: IPR004301 The nucleophosmin/nucleoplasmin family of chaperones includes nucleophosmin, nucleoplasmin and nucleoplasmin-like proteins. They function as nuclear chaperones which are needed for the proper assembly of nucleosomes and the attainment of proper higher order chromatin structures [].; GO: 0003676 nucleic acid binding; PDB: 2P1B_E 1XB9_I 1XE0_C 1NLQ_A 2VTX_E 1K5J_D 1EJY_N 1EE5_B 3T30_J.
Probab=66.41  E-value=1.9  Score=33.17  Aligned_cols=17  Identities=18%  Similarity=0.327  Sum_probs=10.1

Q ss_pred             CCCeEEEEEecccceEe
Q psy5840          55 DPPVTFKLVKGSGPIYL   71 (132)
Q Consensus        55 ~pPVtF~L~~GSGPVhI   71 (132)
                      .|.|.+-+..-..||.+
T Consensus        74 ~~~vsL~~~~~~ppVtf   90 (149)
T PF03066_consen   74 QPMVSLDGFEITPPVTF   90 (149)
T ss_dssp             BSEEEEEEEEESSSEEE
T ss_pred             cceEEcCCcccCCCEEE
Confidence            45566655444667765


No 4  
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=52.88  E-value=6.5  Score=41.70  Aligned_cols=12  Identities=33%  Similarity=0.548  Sum_probs=6.9

Q ss_pred             eeecCCCCCCCc
Q psy5840           5 QAVIGANAKEGE   16 (132)
Q Consensus         5 ~vcLGa~AK~dE   16 (132)
                      +|-.|.+.++|+
T Consensus        28 ~~~~~~~~~~~~   39 (2849)
T PTZ00415         28 NAIIGNGICDDE   39 (2849)
T ss_pred             ceeecCCcccch
Confidence            455666666544


No 5  
>KOG4264|consensus
Probab=39.35  E-value=14  Score=34.84  Aligned_cols=23  Identities=26%  Similarity=0.413  Sum_probs=9.8

Q ss_pred             ccceEeeeceeeeecCCCCCCCC
Q psy5840          66 SGPIYLFGNHSVGTGEPMGEDDD   88 (132)
Q Consensus        66 SGPVhIsGqhlv~~~e~~ee~dd   88 (132)
                      .|-.|++-+..-.-.+..|+|||
T Consensus        54 tgalHlrrvesa~~~e~~Ed~de   76 (694)
T KOG4264|consen   54 TGALHLRRVESAKPAESVEDDDE   76 (694)
T ss_pred             cCccchhcccccCcccccccccc
Confidence            34556655443332222334444


No 6  
>PF05475 Chlam_vir:  Chlamydia virulence protein PGP3-D;  InterPro: IPR008444 This family consists of Chlamydia virulence proteins which are thought to be required for the growth of these bacteria in mammalian cells []. Humans mount a humoral and mucosal immune response to plasmid protein pGP3 from Chlamydia trachomatis infections [, ]. This immune response to pGP3 in humans and animal models of chlamydia-induced disease has potential uses in diagnostic assays and protective immunisation strategies [].
Probab=32.37  E-value=61  Score=27.39  Aligned_cols=31  Identities=35%  Similarity=0.629  Sum_probs=22.6

Q ss_pred             EEEeecCcccceeccCccCCCCCeEEEEEec---ccceEeee
Q psy5840          35 IVVLKAAGVNNHAPLDLLFPDPPVTFKLVKG---SGPIYLFG   73 (132)
Q Consensus        35 IAtLk~s~~~p~v~Ldl~f~~pPVtF~L~~G---SGPVhIsG   73 (132)
                      +|+||.+ +...   +    ..||||.|+.|   ||-|.+..
T Consensus       204 ~cSLrt~-v~Ns---g----~~PvtfSLRvGGmeSGVVWVNA  237 (264)
T PF05475_consen  204 VCSLRTC-VTNS---G----TTPVTFSLRVGGMESGVVWVNA  237 (264)
T ss_pred             eeeeEEE-eecC---C----CCceEEEEEecccccceEEEEc
Confidence            7888876 3322   2    46999999988   89888754


No 7  
>PF04889 Cwf_Cwc_15:  Cwf15/Cwc15 cell cycle control protein;  InterPro: IPR006973 This family represents Cwf15/Cwc15 (from Schizosaccharomyces pombe and Saccharomyces cerevisiae respectively) and their homologues. The function of these proteins is unknown, but they form part of the spliceosome and are thus thought to be involved in mRNA splicing [].; GO: 0000398 nuclear mRNA splicing, via spliceosome, 0005681 spliceosomal complex
Probab=32.33  E-value=28  Score=28.91  Aligned_cols=14  Identities=21%  Similarity=0.567  Sum_probs=6.7

Q ss_pred             ccccchhhHhhhhc
Q psy5840          98 EEEVDESEILSKNL  111 (132)
Q Consensus        98 ~ee~~e~~~~~~~~  111 (132)
                      ++++||.+.|-+.|
T Consensus       142 ~ddeDd~~~Ll~EL  155 (244)
T PF04889_consen  142 DDDEDDTAALLREL  155 (244)
T ss_pred             cccchHHHHHHHHH
Confidence            34445555554443


No 8  
>TIGR00986 3a0801s05tom22 mitochondrial import receptor subunit Tom22. translocase (Tom) import receptor, five proteins of the Tom channel complex, five proteins of the inner membrane translocase (Tim) and three "motor" proteins. This family is specific for the Tom22 proteins.
Probab=25.61  E-value=36  Score=26.70  Aligned_cols=28  Identities=25%  Similarity=0.093  Sum_probs=13.1

Q ss_pred             CCCCCCcccccccccccccchhhHhhhh
Q psy5840          83 MGEDDDEESIDEDFSEEEVDESEILSKN  110 (132)
Q Consensus        83 ~ee~dd~e~eee~~~~ee~~e~~~~~~~  110 (132)
                      .++|.|-+++++.+++.++.|.|-+...
T Consensus        27 ~~~~td~~se~~~d~~~~~~e~ETl~ER   54 (145)
T TIGR00986        27 DEDFTDVDSEDSVDSDFESLEEETFTDR   54 (145)
T ss_pred             ccccccccccccccccccccccCcHHHH
Confidence            3455554444443344444455555443


No 9  
>KOG0772|consensus
Probab=25.17  E-value=35  Score=32.22  Aligned_cols=8  Identities=25%  Similarity=0.397  Sum_probs=3.3

Q ss_pred             CCeEEEEE
Q psy5840          56 PPVTFKLV   63 (132)
Q Consensus        56 pPVtF~L~   63 (132)
                      |++++..+
T Consensus        90 ~~~~ss~~   97 (641)
T KOG0772|consen   90 PRVSSSIN   97 (641)
T ss_pred             CCCccccc
Confidence            34444443


No 10 
>cd02859 AMPKbeta_GBD_like AMP-activated protein kinase (AMPK) beta subunit glycogen binding  domain (GBD). AMPK is a metabolic stress sensing protein that senses AMP/ATP and has recently been found to act as a glycogen sensor as well. The protein functions as a alpha-beta-gamma heterotrimer. This domain is the glycogen binding domain of the beta subunit.
Probab=24.86  E-value=64  Score=21.60  Aligned_cols=19  Identities=32%  Similarity=0.586  Sum_probs=16.6

Q ss_pred             CCeEEEEEecccceEeeec
Q psy5840          56 PPVTFKLVKGSGPIYLFGN   74 (132)
Q Consensus        56 pPVtF~L~~GSGPVhIsGq   74 (132)
                      .||+|+...+...|.|.|.
T Consensus         2 ~~v~f~~~~~a~~V~v~G~   20 (79)
T cd02859           2 VPTTFVWPGGGKEVYVTGS   20 (79)
T ss_pred             eEEEEEEcCCCcEEEEEEE
Confidence            4899999988889999995


No 11 
>KOG3214|consensus
Probab=24.05  E-value=27  Score=26.20  Aligned_cols=14  Identities=43%  Similarity=0.499  Sum_probs=7.5

Q ss_pred             cccccccccccchh
Q psy5840          91 SIDEDFSEEEVDES  104 (132)
Q Consensus        91 ~eee~~~~ee~~e~  104 (132)
                      ++|++++|||+||+
T Consensus        94 d~e~~s~eee~ded  107 (109)
T KOG3214|consen   94 DEEEESEEEEDDED  107 (109)
T ss_pred             cccccCchhhcccc
Confidence            45555555555543


No 12 
>KOG0682|consensus
Probab=21.93  E-value=40  Score=31.19  Aligned_cols=12  Identities=33%  Similarity=0.595  Sum_probs=10.3

Q ss_pred             ecccceEeeece
Q psy5840          64 KGSGPIYLFGNH   75 (132)
Q Consensus        64 ~GSGPVhIsGqh   75 (132)
                      +|+|||||+|-+
T Consensus       188 AG~g~VHl~gG~  199 (500)
T KOG0682|consen  188 AGGGVVHLVGGV  199 (500)
T ss_pred             cCCceeEecccH
Confidence            699999999854


No 13 
>KOG2140|consensus
Probab=21.48  E-value=43  Score=31.94  Aligned_cols=13  Identities=46%  Similarity=0.406  Sum_probs=6.0

Q ss_pred             cccccccccccch
Q psy5840          91 SIDEDFSEEEVDE  103 (132)
Q Consensus        91 ~eee~~~~ee~~e  103 (132)
                      +|+|++++||++|
T Consensus       427 ~eee~e~~ee~~e  439 (739)
T KOG2140|consen  427 DEEEDESVEEDEE  439 (739)
T ss_pred             ccccccccccccc
Confidence            4444444444444


No 14 
>cd06265 RNase_A_canonical Canonical RNase A family includes all vertebrate homologues to the bovine pancreatic ribonuclease A (RNase A) that contain the catalytic site, necessary for RNase activity.  In the human genome 8 RNases , refered to as "canonical" RNases, have been identified, pancreatic RNase (RNase 1), Eosinophil Derived Neurotoxin (SEDN/RNASE 2), Eosinophil Cationic Protein (ECP/RNase 3), RNase 4, Angiogenin (RNase 5), RNase 6 or k6, the skin derived RNase (RNase 7) and RNase 8. The eight human genes are all located in a cluster on chromosome 14. Canonical RNase A enzymes have special biological activities; for example, some stimulate the development of vascular endothelial cells, dendritic cells, and neurons, are cytotoxic/anti-tumoral and/or anti-pathogenic. RNase A is involved in endonucleolytic cleavage of 3'-phosphomononucleotides and 3'-phosphooligonucleotides ending in C-P or U-P with 2',3'-cyclic phosphate intermediates. The catalytic mechanism is a transphosphoryla
Probab=21.30  E-value=1.2e+02  Score=22.08  Aligned_cols=43  Identities=9%  Similarity=0.013  Sum_probs=25.9

Q ss_pred             CeeeEEEEeecCcccceeccCccCCCCCeEEEEEecccceEeee
Q psy5840          30 DIKLPIVVLKAAGVNNHAPLDLLFPDPPVTFKLVKGSGPIYLFG   73 (132)
Q Consensus        30 ~ikv~IAtLk~s~~~p~v~Ldl~f~~pPVtF~L~~GSGPVhIsG   73 (132)
                      +.++|.|.|+.+...|.+.-...-..-.|.+.- .|.-|||+-|
T Consensus        73 ~~~iT~C~lt~g~~~p~C~Y~~~~~~k~i~VaC-~~~~PVH~d~  115 (115)
T cd06265          73 PFPVTDCNLTGGSRYPNCRYRGTPSTRKIVVAC-ENGVPVHLDG  115 (115)
T ss_pred             ccEeEEEEeCCCCCCCCCceeeecccceEEEEc-CCCcccccCC
Confidence            689999999986456665544222222344333 3456999754


No 15 
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=21.26  E-value=46  Score=30.92  Aligned_cols=16  Identities=25%  Similarity=0.347  Sum_probs=10.6

Q ss_pred             CCeEEEEEecccceEe
Q psy5840          56 PPVTFKLVKGSGPIYL   71 (132)
Q Consensus        56 pPVtF~L~~GSGPVhI   71 (132)
                      +.++|.+.-+.-|.||
T Consensus        74 ~~~~iyViDshRP~~L   89 (622)
T PF02724_consen   74 EDVTIYVIDSHRPWNL   89 (622)
T ss_pred             CceEEEEEeCCCCccH
Confidence            4667776666667665


No 16 
>KOG0699|consensus
Probab=20.38  E-value=39  Score=30.95  Aligned_cols=18  Identities=22%  Similarity=0.507  Sum_probs=7.6

Q ss_pred             cccccccccccccchhhH
Q psy5840          89 EESIDEDFSEEEVDESEI  106 (132)
Q Consensus        89 ~e~eee~~~~ee~~e~~~  106 (132)
                      ||+.+++.++||.+|...
T Consensus       296 Ded~e~e~ddEE~~e~~m  313 (542)
T KOG0699|consen  296 DEDAEDEQDDEEMVEGSM  313 (542)
T ss_pred             ccccccccchhhhhhhcc
Confidence            333344444444444443


No 17 
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=20.26  E-value=58  Score=27.59  Aligned_cols=10  Identities=30%  Similarity=0.414  Sum_probs=6.5

Q ss_pred             eeeeeeeeee
Q psy5840         122 LSFKVGIECL  131 (132)
Q Consensus       122 ~~~~~~~~~~  131 (132)
                      ..||-||-|+
T Consensus       350 ~~lk~g~~~~  359 (375)
T PF03153_consen  350 CTLKDGIMHI  359 (375)
T ss_dssp             EEEEEEEEEE
T ss_pred             EEeeeeEEEE
Confidence            4577777664


Done!