Query         psy5866
Match_columns 98
No_of_seqs    102 out of 1109
Neff          10.1
Searched_HMMs 46136
Date          Fri Aug 16 20:01:15 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5866.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5866hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd05771 IgC_Tapasin_R Tapasin-  99.5 2.9E-13 6.3E-18   78.4   9.0   75   17-97      2-77  (139)
  2 PHA02785 IL-beta-binding prote  99.3 1.1E-10 2.3E-15   76.2  10.4   79   17-97    178-260 (326)
  3 PHA02826 IL-1 receptor-like pr  99.2 1.9E-10 4.1E-15   71.7   9.4   71   15-97     97-171 (227)
  4 KOG3513|consensus               99.2 1.3E-10 2.8E-15   83.8   8.5   76   15-97    293-368 (1051)
  5 KOG4194|consensus               99.1 5.8E-10 1.3E-14   77.0   8.3   83    6-97    661-744 (873)
  6 PHA03376 BARF1; Provisional     99.0 7.2E-09 1.6E-13   62.4   9.3   87    2-96     73-160 (221)
  7 cd05762 Ig8_MLCK Eighth immuno  99.0 5.2E-09 1.1E-13   57.3   6.9   52    6-61     46-97  (98)
  8 KOG3513|consensus               98.9 1.8E-08 3.8E-13   73.1  10.1   75   16-97    479-555 (1051)
  9 KOG4194|consensus               98.9 6.2E-09 1.3E-13   72.1   6.5   75   17-97    575-649 (873)
 10 KOG4221|consensus               98.9 8.3E-09 1.8E-13   75.4   6.9   75   16-97    291-365 (1381)
 11 cd05854 Ig6_Contactin-2 Sixth   98.8 4.9E-08 1.1E-12   52.1   6.5   41   14-58     45-85  (85)
 12 cd05735 Ig8_DSCAM Eight immuno  98.8 4.3E-08 9.3E-13   52.6   6.1   42   16-61     47-88  (88)
 13 cd05853 Ig6_Contactin-4 Sixth   98.8   2E-08 4.3E-13   53.7   4.3   39   16-58     47-85  (85)
 14 KOG4221|consensus               98.8 1.4E-07   3E-12   69.3   9.8   85    6-97    186-274 (1381)
 15 PHA02785 IL-beta-binding prote  98.7 1.2E-07 2.5E-12   62.1   8.1   75   17-96     83-162 (326)
 16 cd05748 Ig_Titin_like Immunogl  98.7 1.4E-07 3.1E-12   48.7   6.3   45    5-53     29-73  (74)
 17 cd04970 Ig6_Contactin_like Six  98.7   1E-07 2.2E-12   50.7   5.6   40   15-58     46-85  (85)
 18 cd05892 Ig_Myotilin_C C-termin  98.7 1.6E-07 3.5E-12   49.0   6.1   46    5-54     29-75  (75)
 19 cd05888 Ig1_Nectin-4_like Frst  98.7   2E-07 4.4E-12   51.1   6.8   42   10-54     58-99  (100)
 20 cd05886 Ig1_Nectin-1_like Firs  98.7 1.9E-07 4.2E-12   51.2   6.5   49    4-55     50-99  (99)
 21 cd05713 Ig_MOG_like Immunoglob  98.6 2.2E-07 4.8E-12   50.7   6.3   39   12-54     61-99  (100)
 22 cd05881 Ig1_Necl-2 First (N-te  98.6 2.1E-07 4.5E-12   50.7   5.8   43    5-52     50-93  (95)
 23 cd05870 Ig5_NCAM-2 Fifth immun  98.6 1.9E-07 4.2E-12   50.9   5.6   44    6-53     54-97  (98)
 24 cd05866 Ig1_NCAM-2 First immun  98.6 2.3E-07   5E-12   50.3   5.7   47    5-54     45-91  (92)
 25 cd05887 Ig1_Nectin-3_like Firs  98.6 2.8E-07 6.1E-12   50.3   6.0   47    5-54     48-95  (96)
 26 cd05879 Ig_P0 Immunoglobulin (  98.6 2.7E-07 5.9E-12   52.0   6.0   30   10-40     74-103 (116)
 27 PF07679 I-set:  Immunoglobulin  98.6   2E-07 4.4E-12   49.6   5.3   45    6-54     46-90  (90)
 28 cd05893 Ig_Palladin_C C-termin  98.6 3.5E-07 7.6E-12   47.7   5.8   46    5-54     29-75  (75)
 29 cd05878 Ig_Aggrecan_like Immun  98.6 4.8E-07   1E-11   50.5   6.4   46    6-55     59-107 (110)
 30 cd05718 Ig1_PVR_like First imm  98.6 6.8E-07 1.5E-11   48.5   6.9   38   14-54     60-97  (98)
 31 cd05743 Ig_Perlecan_D2_like Im  98.5 3.4E-07 7.3E-12   47.9   5.4   33    6-39     32-64  (78)
 32 KOG4222|consensus               98.5 1.3E-07 2.9E-12   69.0   5.0   74   17-96    188-261 (1281)
 33 cd05894 Ig_C5_MyBP-C C5 immuno  98.5 6.3E-07 1.4E-11   47.9   6.3   44    6-53     42-85  (86)
 34 cd05775 Ig_SLAM-CD84_like_N N-  98.5 5.3E-07 1.1E-11   49.2   6.1   43    9-54     54-96  (97)
 35 cd05714 Ig_CSPGs_LP Immunoglob  98.5   6E-07 1.3E-11   49.5   6.1   41   11-55     63-103 (106)
 36 cd05732 Ig5_NCAM-1_like Fifth   98.5 7.1E-07 1.5E-11   48.2   6.2   43    7-53     53-95  (96)
 37 cd05861 Ig1_PDGFR-alphabeta Fr  98.5   1E-06 2.2E-11   46.8   6.6   40   14-55     44-83  (84)
 38 cd05900 Ig_Aggrecan Immunoglob  98.5 5.6E-07 1.2E-11   50.5   5.6   45    6-54     61-108 (112)
 39 cd05889 Ig1_DNAM-1_like First   98.5 9.8E-07 2.1E-11   48.2   6.2   46    5-55     48-94  (96)
 40 cd05882 Ig1_Necl-1 First (N-te  98.5 6.7E-07 1.5E-11   48.7   5.4   26   12-38     58-83  (95)
 41 cd07701 Ig1_Necl-3 First (N-te  98.5 8.9E-07 1.9E-11   48.2   5.8   33    6-39     51-84  (95)
 42 cd05902 Ig_Neurocan Immunoglob  98.5 1.1E-06 2.3E-11   49.2   6.1   47    5-55     58-107 (110)
 43 cd05863 Ig2_VEGFR-3 Second imm  98.4 1.1E-06 2.5E-11   44.9   5.6   38   14-55     29-66  (67)
 44 cd05717 Ig1_Necl-1-3_like Firs  98.4 8.5E-07 1.8E-11   48.0   5.4   27   12-39     58-84  (95)
 45 cd05744 Ig_Myotilin_C_like Imm  98.4 1.3E-06 2.9E-11   45.4   5.8   37   13-53     38-74  (75)
 46 cd05763 Ig_1 Subgroup of the i  98.4 1.5E-06 3.2E-11   45.0   5.9   34   17-54     41-74  (75)
 47 cd05715 Ig_P0-like Immunoglobu  98.4 1.3E-06 2.7E-11   49.1   5.8   30   10-40     74-103 (116)
 48 cd05846 Ig1_MRC-OX-2_like Firs  98.4 1.9E-06 4.1E-11   46.9   6.2   42   10-54     55-96  (97)
 49 cd05737 Ig_Myomesin_like_C C-t  98.4 1.4E-06   3E-11   47.0   5.6   25   14-39     56-80  (92)
 50 cd05858 Ig3_FGFR-2 Third immun  98.4 7.2E-07 1.6E-11   47.9   4.4   35   16-54     55-89  (90)
 51 cd05852 Ig5_Contactin-1 Fifth   98.4 1.3E-06 2.8E-11   45.3   5.1   33   17-53     40-72  (73)
 52 cd05877 Ig_LP_like Immunoglobu  98.4   2E-06 4.4E-11   47.4   6.1   45    6-54     57-102 (106)
 53 cd05869 Ig5_NCAM-1 Fifth immun  98.4   2E-06 4.3E-11   46.8   6.0   36   14-53     61-96  (97)
 54 cd05901 Ig_Versican Immunoglob  98.4 2.5E-06 5.5E-11   48.1   6.4   41   11-55     74-114 (117)
 55 cd05880 Ig_EVA1 Immunoglobulin  98.4 1.6E-06 3.5E-11   48.7   5.5   30   10-40     73-102 (115)
 56 cd05865 Ig1_NCAM-1 First immun  98.4 1.9E-06 4.2E-11   47.0   5.6   37   15-54     59-95  (96)
 57 cd05725 Ig3_Robo Third immunog  98.4 8.1E-07 1.8E-11   45.3   3.9   34   16-53     35-68  (69)
 58 cd04976 Ig2_VEGFR Second immun  98.4 1.4E-06   3E-11   44.8   4.7   37   15-55     34-70  (71)
 59 cd04974 Ig3_FGFR Third immunog  98.4 6.8E-07 1.5E-11   48.0   3.7   36   15-54     54-89  (90)
 60 cd05726 Ig4_Robo Fhird immunog  98.3 3.5E-06 7.6E-11   45.2   6.3   36   17-56     48-83  (90)
 61 cd05876 Ig3_L1-CAM Third immun  98.3 1.6E-06 3.5E-11   44.5   4.6   36   15-54     35-70  (71)
 62 cd05765 Ig_3 Subgroup of the i  98.3 1.5E-06 3.2E-11   45.5   4.5   34   16-53     47-80  (81)
 63 cd05742 Ig1_VEGFR_like First i  98.3 1.8E-06 3.9E-11   45.7   4.9   37   14-54     47-83  (84)
 64 cd04977 Ig1_NCAM-1_like First   98.3 4.2E-06 9.1E-11   45.1   6.3   27   12-39     53-79  (92)
 65 cd07690 Ig1_CD4 First immunogl  98.3 4.3E-07 9.4E-12   49.4   2.3   27   12-39     61-87  (94)
 66 cd05747 Ig5_Titin_like M5, fif  98.3 3.5E-06 7.6E-11   45.3   5.7   33    6-39     49-81  (92)
 67 cd05745 Ig3_Peroxidasin Third   98.3 1.3E-06 2.9E-11   45.1   3.9   34   16-53     40-73  (74)
 68 PF07686 V-set:  Immunoglobulin  98.3 6.4E-06 1.4E-10   45.2   6.8   46    6-54     69-114 (114)
 69 cd05730 Ig3_NCAM-1_like Third   98.3 3.6E-06 7.9E-11   45.4   5.6   36   16-55     58-93  (95)
 70 KOG4222|consensus               98.3 1.6E-06 3.5E-11   63.6   5.2   75   16-97    278-352 (1281)
 71 cd05895 Ig_Pro_neuregulin-1 Im  98.3 5.7E-06 1.2E-10   42.9   6.1   27   13-40     41-67  (76)
 72 cd04968 Ig3_Contactin_like Thi  98.3 2.7E-06 5.8E-11   45.4   4.9   36   15-54     52-87  (88)
 73 cd05741 Ig_CEACAM_D1_like Firs  98.3 4.3E-06 9.2E-11   44.8   5.7   23   16-39     57-79  (92)
 74 cd05760 Ig2_PTK7 Second immuno  98.3 3.2E-06 6.9E-11   44.1   5.0   37   16-54     38-74  (77)
 75 cd04969 Ig5_Contactin_like Fif  98.3 1.8E-06 3.9E-11   44.5   3.9   33   17-53     40-72  (73)
 76 cd05731 Ig3_L1-CAM_like Third   98.3 2.8E-06   6E-11   43.3   4.6   36   15-54     35-70  (71)
 77 cd04975 Ig4_SCFR_like Fourth i  98.3 3.3E-06 7.2E-11   46.5   5.1   37   15-55     64-100 (101)
 78 cd05864 Ig2_VEGFR-2 Second imm  98.3 3.4E-06 7.4E-11   43.4   4.8   23   16-39     34-56  (70)
 79 cd05857 Ig2_FGFR Second immuno  98.3 4.9E-06 1.1E-10   43.9   5.6   36   14-53     49-84  (85)
 80 cd05867 Ig4_L1-CAM_like Fourth  98.3 3.3E-06   7E-11   43.9   4.7   35   16-54     41-75  (76)
 81 cd05740 Ig_CEACAM_D4 Fourth im  98.2 3.6E-06 7.9E-11   45.4   4.9   37   15-54     54-90  (91)
 82 cd05851 Ig3_Contactin-1 Third   98.2 3.7E-06   8E-11   45.0   4.9   35   16-54     53-87  (88)
 83 cd05859 Ig4_PDGFR-alpha Fourth  98.2 3.6E-06 7.8E-11   46.3   4.8   36   16-55     65-100 (101)
 84 cd05891 Ig_M-protein_C C-termi  98.2 5.4E-06 1.2E-10   44.7   5.4   24   15-39     57-80  (92)
 85 cd04978 Ig4_L1-NrCAM_like Four  98.2 4.1E-06 8.8E-11   43.3   4.6   35   16-54     41-75  (76)
 86 cd05856 Ig2_FGFRL1-like Second  98.2 3.8E-06 8.3E-11   43.8   4.5   26   13-39     45-70  (82)
 87 cd05746 Ig4_Peroxidasin Fourth  98.2   6E-06 1.3E-10   42.1   5.0   23   16-39     36-58  (69)
 88 cd04983 IgV_TCR_alpha_like Imm  98.2 9.3E-06   2E-10   44.8   6.1   29   10-39     64-92  (109)
 89 cd04972 Ig_TrkABC_d4 Fourth do  98.2   1E-05 2.2E-10   43.3   6.0   37   13-53     53-89  (90)
 90 cd05723 Ig4_Neogenin Fourth im  98.2   1E-05 2.3E-10   41.4   5.7   33   17-53     38-70  (71)
 91 cd05736 Ig2_Follistatin_like S  98.2 5.4E-06 1.2E-10   43.0   4.6   35   16-54     39-73  (76)
 92 cd05868 Ig4_NrCAM Fourth immun  98.2 5.7E-06 1.2E-10   43.1   4.6   34   17-54     42-75  (76)
 93 cd05712 Ig_Siglec_N Immunoglob  98.2 1.1E-05 2.3E-10   45.6   6.0   32    6-38     68-101 (119)
 94 cd04973 Ig1_FGFR First immunog  98.2 9.2E-06   2E-10   42.5   5.2   22   17-39     46-67  (79)
 95 cd05862 Ig1_VEGFR First immuno  98.1 8.8E-06 1.9E-10   43.4   5.1   37   15-55     49-85  (86)
 96 cd04971 Ig_TrKABC_d5 Fifth dom  98.1 1.2E-05 2.7E-10   42.4   5.5   24   15-39     45-68  (81)
 97 cd07702 Ig2_VEGFR-1 Second imm  98.1 6.8E-06 1.5E-10   42.6   4.2   23   16-39     36-58  (72)
 98 cd05750 Ig_Pro_neuregulin Immu  98.1 1.8E-05 3.9E-10   40.6   5.6   26   13-39     40-65  (75)
 99 cd05855 Ig_TrkB_d5 Fifth domai  98.1 1.9E-05   4E-10   41.7   5.6   25   14-39     42-66  (79)
100 cd05773 Ig8_hNephrin_like Eigh  98.1 2.7E-05 5.9E-10   43.3   6.6   40   15-58     68-108 (109)
101 cd05870 Ig5_NCAM-2 Fifth immun  98.1   1E-05 2.2E-10   44.0   4.8   36   61-97      3-38  (98)
102 cd05764 Ig_2 Subgroup of the i  98.1   9E-06 1.9E-10   41.8   4.0   33   17-53     41-73  (74)
103 cd00099 IgV Immunoglobulin var  98.1   1E-05 2.2E-10   44.2   4.4   27   12-39     63-89  (105)
104 cd05756 Ig1_IL1R_like First im  98.0   1E-05 2.3E-10   43.9   4.2   34   16-53     60-93  (94)
105 smart00406 IGv Immunoglobulin   98.0 7.7E-06 1.7E-10   42.4   3.4   31    5-36     49-81  (81)
106 cd05734 Ig7_DSCAM Seventh immu  98.0 1.4E-05 3.1E-10   41.7   4.4   24   16-40     44-67  (79)
107 PHA03269 envelope glycoprotein  98.0 0.00014 3.1E-09   49.7   9.6   83   10-97    283-367 (566)
108 cd05757 Ig2_IL1R_like Second i  98.0 2.9E-05 6.3E-10   42.0   5.2   25   15-40     51-75  (92)
109 cd05851 Ig3_Contactin-1 Third   98.0 2.6E-05 5.6E-10   41.7   4.7   30   67-97      9-38  (88)
110 cd05738 Ig2_RPTP_IIa_LAR_like   97.9   2E-05 4.2E-10   40.7   4.0   35   17-54     39-73  (74)
111 cd05728 Ig4_Contactin-2-like F  97.9 1.8E-05   4E-10   41.9   3.9   33   17-53     52-84  (85)
112 cd05729 Ig2_FGFR_like Second i  97.9 0.00011 2.3E-09   38.4   6.5   37   13-53     48-84  (85)
113 cd07693 Ig1_Robo First immunog  97.9 4.4E-05 9.5E-10   41.1   5.1   30   67-97      9-38  (100)
114 cd05732 Ig5_NCAM-1_like Fifth   97.9 2.6E-05 5.5E-10   42.0   3.9   36   61-97      3-38  (96)
115 smart00409 IG Immunoglobulin.   97.9 9.6E-05 2.1E-09   37.9   6.0   28   11-39     46-73  (86)
116 smart00410 IG_like Immunoglobu  97.9 9.6E-05 2.1E-09   37.9   6.0   28   11-39     46-73  (86)
117 cd05871 Ig_Semaphorin_classIII  97.9 4.2E-05 9.1E-10   41.2   4.7   37   16-55     53-89  (91)
118 cd05724 Ig2_Robo Second immuno  97.9 3.4E-05 7.3E-10   40.7   4.3   24   16-40     51-74  (86)
119 cd04984 IgV_L_lambda Immunoglo  97.9 2.6E-05 5.6E-10   42.4   3.9   33    5-38     52-84  (98)
120 KOG3515|consensus               97.9 2.4E-05 5.2E-10   55.9   4.4   80   17-97    164-244 (741)
121 cd05772 IgC_SIRP Signal-regula  97.8 4.3E-05 9.2E-10   42.8   4.4   43   54-97      2-45  (111)
122 cd05716 Ig_pIgR Immunoglobulin  97.8 3.2E-05   7E-10   41.9   3.7   29   10-39     58-86  (98)
123 cd05897 Ig2_IL1R2_like Second   97.8 7.3E-05 1.6E-09   40.7   4.8   25   16-41     55-79  (95)
124 cd07706 IgV_TCR_delta Immunogl  97.8 5.6E-05 1.2E-09   42.3   4.5   34    5-39     59-94  (116)
125 cd05753 Ig2_FcgammaR_like Seco  97.8 4.9E-05 1.1E-09   40.3   3.8   25   14-39     46-70  (83)
126 cd04980 IgV_L_kappa Immunoglob  97.8 3.9E-05 8.4E-10   42.3   3.6   32    6-38     61-92  (106)
127 cd04979 Ig_Semaphorin_C Immuno  97.8   7E-05 1.5E-09   39.9   4.4   36   17-55     52-87  (89)
128 cd05774 Ig_CEACAM_D1 First imm  97.8 0.00016 3.6E-09   40.0   5.9   23   16-39     70-92  (105)
129 cd05720 Ig_CD8_alpha Immunoglo  97.8 5.2E-05 1.1E-09   41.8   3.8   33    5-38     58-90  (104)
130 cd05873 Ig_Sema4D_like Immunog  97.7   9E-05 1.9E-09   39.7   4.5   22   17-39     49-70  (87)
131 cd05899 IgV_TCR_beta Immunoglo  97.7 7.7E-05 1.7E-09   41.3   4.5   34    5-39     60-94  (110)
132 cd05749 Ig2_Tyro3_like Second   97.7   7E-05 1.5E-09   39.6   4.1   30   67-97      6-36  (81)
133 cd05745 Ig3_Peroxidasin Third   97.7   5E-05 1.1E-09   39.1   3.3   24   73-97      1-24  (74)
134 cd05758 Ig5_KIRREL3-like Fifth  97.7 0.00013 2.8E-09   39.6   5.0   37   60-97      2-39  (98)
135 cd05724 Ig2_Robo Second immuno  97.7 0.00013 2.8E-09   38.4   4.6   31   67-97      4-34  (86)
136 cd05755 Ig2_ICAM-1_like Second  97.7 0.00014 2.9E-09   40.1   4.7   29   69-97     11-41  (100)
137 cd05754 Ig3_Perlecan_like Thir  97.7 9.3E-05   2E-09   39.1   3.9   23   16-39     52-74  (85)
138 PHA02987 Ig domain OX-2-like p  97.7 0.00024 5.1E-09   43.1   5.9   51    5-57     73-124 (189)
139 cd05737 Ig_Myomesin_like_C C-t  97.7 9.1E-05   2E-09   39.8   3.7   29   68-97     10-38  (92)
140 PF00047 ig:  Immunoglobulin do  97.6 4.8E-05   1E-09   37.9   2.4   18   18-36     47-64  (64)
141 cd04972 Ig_TrkABC_d4 Fourth do  97.6 0.00012 2.5E-09   39.2   4.0   29   68-97      9-37  (90)
142 cd05747 Ig5_Titin_like M5, fif  97.6 0.00015 3.2E-09   38.9   4.4   30   67-97     11-40  (92)
143 cd07700 IgV_CD8_beta Immunoglo  97.6 0.00013 2.9E-09   40.3   4.3   28   10-38     66-93  (107)
144 cd04975 Ig4_SCFR_like Fourth i  97.6 8.3E-05 1.8E-09   40.9   3.4   31   67-97     11-41  (101)
145 cd05740 Ig_CEACAM_D4 Fourth im  97.6 0.00021 4.6E-09   38.5   4.8   28   68-97     12-39  (91)
146 cd04982 IgV_TCR_gamma Immunogl  97.6 0.00014   3E-09   40.6   4.2   32    6-38     65-98  (116)
147 PHA02633 hypothetical protein;  97.6 0.00035 7.7E-09   34.9   5.0   36   16-55     18-53  (63)
148 cd05752 Ig1_FcgammaR_like Frst  97.6 4.5E-05 9.8E-10   40.0   1.9   21   16-38     47-67  (78)
149 cd05754 Ig3_Perlecan_like Thir  97.6 0.00032 6.9E-09   37.0   5.1   31   67-97      9-39  (85)
150 cd05739 Ig3_RPTP_IIa_LAR_like   97.6 0.00012 2.7E-09   37.3   3.3   23   74-97      1-23  (69)
151 cd05857 Ig2_FGFR Second immuno  97.6 0.00017 3.8E-09   37.9   4.0   28   69-97      4-31  (85)
152 PHA03271 envelope glycoprotein  97.6  0.0022 4.7E-08   43.4   9.8   81   11-97    202-285 (490)
153 PF08205 C2-set_2:  CD80-like C  97.6 5.9E-05 1.3E-09   40.1   2.2   25   73-97     13-37  (89)
154 cd04968 Ig3_Contactin_like Thi  97.6 0.00022 4.9E-09   37.8   4.4   30   67-97      9-38  (88)
155 cd05727 Ig2_Contactin-2-like S  97.6 0.00015 3.3E-09   39.6   3.7   25   15-40     59-83  (96)
156 cd05733 Ig6_L1-CAM_like Sixth   97.5 0.00014   3E-09   37.8   3.4   24   16-40     39-66  (77)
157 cd05727 Ig2_Contactin-2-like S  97.5  0.0002 4.3E-09   39.1   4.0   31   67-97     11-41  (96)
158 cd05894 Ig_C5_MyBP-C C5 immuno  97.5 0.00016 3.5E-09   38.5   3.6   29   68-97      4-32  (86)
159 cd05728 Ig4_Contactin-2-like F  97.5 0.00021 4.4E-09   37.9   4.0   30   67-97      7-36  (85)
160 cd05722 Ig1_Neogenin First imm  97.5 0.00029 6.2E-09   38.0   4.6   29   68-97      8-36  (95)
161 cd05875 Ig6_hNeurofascin_like   97.5 0.00052 1.1E-08   35.7   5.2   25   16-40     39-66  (77)
162 cd05762 Ig8_MLCK Eighth immuno  97.5 0.00031 6.8E-09   38.3   4.5   30   67-97      8-37  (98)
163 cd05849 Ig1_Contactin-1 First   97.5  0.0003 6.6E-09   38.0   4.4   23   17-40     58-81  (93)
164 cd05758 Ig5_KIRREL3-like Fifth  97.5 0.00029 6.2E-09   38.2   4.3   24   16-39     64-87  (98)
165 cd05752 Ig1_FcgammaR_like Frst  97.5 0.00053 1.2E-08   35.9   5.1   30   67-97      8-38  (78)
166 smart00408 IGc2 Immunoglobulin  97.5 0.00017 3.8E-09   34.9   3.1   25   14-39     37-61  (63)
167 cd05891 Ig_M-protein_C C-termi  97.5 0.00023   5E-09   38.3   3.8   30   67-97      9-38  (92)
168 cd05896 Ig1_IL1RAPL-1_like Fir  97.4 0.00043 9.3E-09   38.3   4.5   23   16-39     70-92  (104)
169 PHA02826 IL-1 receptor-like pr  97.4 0.00064 1.4E-08   42.6   5.9   23   16-39    188-210 (227)
170 cd05730 Ig3_NCAM-1_like Third   97.4 0.00034 7.4E-09   37.6   4.1   29   68-97     12-40  (95)
171 cd05848 Ig1_Contactin-5 First   97.4 0.00026 5.7E-09   38.2   3.4   24   73-97     18-41  (94)
172 cd05739 Ig3_RPTP_IIa_LAR_like   97.4  0.0006 1.3E-08   34.8   4.6   21   16-39     38-58  (69)
173 cd05869 Ig5_NCAM-1 Fifth immun  97.4  0.0004 8.6E-09   37.6   4.0   27   70-97     13-39  (97)
174 cd05848 Ig1_Contactin-5 First   97.4 0.00037   8E-09   37.7   3.8   23   17-40     59-82  (94)
175 PF07679 I-set:  Immunoglobulin  97.4 0.00031 6.7E-09   37.1   3.4   30   67-97      8-37  (90)
176 cd05845 Ig2_L1-CAM_like Second  97.4 0.00035 7.6E-09   38.1   3.6   31   67-97     11-41  (95)
177 cd05751 Ig1_LILRB1_like First   97.4 0.00043 9.3E-09   37.2   3.9   26   13-39     50-75  (91)
178 cd05850 Ig1_Contactin-2 First   97.3 0.00071 1.5E-08   36.5   4.6   23   17-40     59-82  (94)
179 PF13927 Ig_3:  Immunoglobulin   97.3 0.00046   1E-08   34.8   3.5   26   12-38     50-75  (75)
180 cd04981 IgV_H Immunoglobulin (  97.3  0.0015 3.2E-08   36.8   5.7   26   12-38     72-97  (117)
181 cd07693 Ig1_Robo First immunog  97.3  0.0018 3.9E-08   34.6   5.9   30   22-54     70-99  (100)
182 cd05845 Ig2_L1-CAM_like Second  97.3 0.00039 8.5E-09   37.9   3.2   23   16-39     58-81  (95)
183 cd05753 Ig2_FcgammaR_like Seco  97.3 0.00097 2.1E-08   35.2   4.6   31   67-97      7-37  (83)
184 cd07704 Ig2_Nectin-3-4_like Se  97.3 0.00083 1.8E-08   36.7   4.3   31   67-97      9-40  (97)
185 cd05874 Ig6_NrCAM Sixth immuno  97.2  0.0016 3.5E-08   33.8   5.2   22   17-39     40-65  (77)
186 cd05872 Ig_Sema4B_like Immunog  97.2  0.0015 3.2E-08   34.9   5.0   21   18-39     49-69  (85)
187 cd05856 Ig2_FGFRL1-like Second  97.2 0.00058 1.3E-08   35.4   3.5   28   69-97      4-31  (82)
188 PF13895 Ig_2:  Immunoglobulin   97.2 0.00083 1.8E-08   34.4   4.0   35   61-97      2-36  (80)
189 PF13895 Ig_2:  Immunoglobulin   97.2  0.0017 3.7E-08   33.2   5.2   34   18-54     47-80  (80)
190 cd05850 Ig1_Contactin-2 First   97.2  0.0013 2.8E-08   35.5   4.8   24   73-97     18-41  (94)
191 cd05898 Ig5_KIRREL3 Fifth immu  97.2  0.0018 3.9E-08   35.5   5.0   36   60-96      2-38  (98)
192 PHA03273 envelope glycoprotein  97.2  0.0072 1.6E-07   41.4   8.7   77   15-97    197-275 (486)
193 cd04967 Ig1_Contactin First Ig  97.2 0.00054 1.2E-08   36.6   2.9   22   17-39     59-81  (91)
194 cd05859 Ig4_PDGFR-alpha Fourth  97.1 0.00066 1.4E-08   37.3   3.0   29   68-97     12-40  (101)
195 cd05860 Ig4_SCFR Fourth immuno  97.1  0.0027 5.8E-08   35.0   5.2   35   16-54     65-99  (101)
196 cd05849 Ig1_Contactin-1 First   97.0   0.002 4.3E-08   34.8   4.5   23   74-97     19-41  (93)
197 cd05882 Ig1_Necl-1 First (N-te  97.0  0.0015 3.2E-08   35.5   3.8   29   67-96      5-33  (95)
198 cd05722 Ig1_Neogenin First imm  97.0  0.0018   4E-08   34.8   4.1   22   17-39     55-81  (95)
199 cd05865 Ig1_NCAM-1 First immun  97.0  0.0025 5.5E-08   34.6   4.6   28   68-96      9-37  (96)
200 PHA03270 envelope glycoprotein  97.0   0.014   3E-07   39.8   8.7   74   18-97    184-259 (466)
201 cd05898 Ig5_KIRREL3 Fifth immu  96.9  0.0083 1.8E-07   32.8   6.4   27   13-39     61-87  (98)
202 cd04979 Ig_Semaphorin_C Immuno  96.9  0.0025 5.4E-08   33.8   3.8   28   68-97      5-32  (89)
203 cd05729 Ig2_FGFR_like Second i  96.8  0.0043 9.3E-08   32.2   4.3   28   69-97      4-31  (85)
204 cd05885 Ig2_Necl-4 Second immu  96.7  0.0039 8.5E-08   32.9   4.0   36   17-53     44-79  (80)
205 cd05756 Ig1_IL1R_like First im  96.7  0.0021 4.6E-08   34.8   2.9   30   68-97      8-41  (94)
206 cd07701 Ig1_Necl-3 First (N-te  96.7   0.003 6.5E-08   34.2   3.4   29   67-96      5-33  (95)
207 cd05759 Ig2_KIRREL3-like Secon  96.7  0.0046 9.9E-08   32.3   4.0   35   17-53     47-81  (82)
208 cd05899 IgV_TCR_beta Immunoglo  96.7  0.0054 1.2E-07   33.9   4.4   29   67-97      6-34  (110)
209 cd00096 Ig Immunoglobulin doma  96.6  0.0039 8.5E-08   30.1   3.5   28   11-39     38-65  (74)
210 cd05773 Ig8_hNephrin_like Eigh  96.6  0.0041 8.9E-08   34.5   3.7   24   73-97     22-45  (109)
211 cd04973 Ig1_FGFR First immunog  96.6  0.0067 1.4E-07   31.5   4.2   28   68-97      3-30  (79)
212 cd05871 Ig_Semaphorin_classIII  96.5  0.0057 1.2E-07   32.9   3.8   27   69-97      6-32  (91)
213 cd04967 Ig1_Contactin First Ig  96.5  0.0044 9.4E-08   33.1   3.3   24   73-97     18-41  (91)
214 cd04980 IgV_L_kappa Immunoglob  96.5   0.011 2.4E-07   32.4   4.9   29   68-97      9-38  (106)
215 cd05721 IgV_CTLA-4 Immunoglobu  96.5  0.0093   2E-07   33.6   4.5   35    3-38     61-95  (115)
216 cd07689 Ig2_VCAM-1 Second immu  96.5  0.0076 1.7E-07   33.1   4.0   29   69-97     10-40  (99)
217 PF00047 ig:  Immunoglobulin do  96.5  0.0048   1E-07   30.4   3.0   24   74-97      1-24  (64)
218 cd05751 Ig1_LILRB1_like First   96.4   0.015 3.2E-07   31.1   5.0   35   61-97      3-37  (91)
219 cd05711 Ig_FcalphaRI Immunoglo  96.4   0.013 2.9E-07   31.6   4.8   35   61-97      2-36  (94)
220 PF11465 Receptor_2B4:  Natural  96.4   0.014   3E-07   32.4   4.7   41   12-55     67-107 (108)
221 PF13927 Ig_3:  Immunoglobulin   96.3  0.0044 9.6E-08   31.1   2.6   23   73-95     14-36  (75)
222 smart00408 IGc2 Immunoglobulin  96.3  0.0092   2E-07   28.5   3.6   24   73-97      1-24  (63)
223 cd05749 Ig2_Tyro3_like Second   96.3   0.013 2.9E-07   30.8   4.2   22   16-40     49-70  (81)
224 cd05873 Ig_Sema4D_like Immunog  96.2   0.013 2.9E-07   31.3   3.9   29   67-97      4-32  (87)
225 cd05717 Ig1_Necl-1-3_like Firs  96.2   0.013 2.8E-07   31.4   4.0   29   67-96      5-33  (95)
226 cd05866 Ig1_NCAM-2 First immun  96.2   0.013 2.7E-07   31.7   3.8   28   67-96      8-35  (92)
227 cd04983 IgV_TCR_alpha_like Imm  96.1   0.017 3.6E-07   31.6   4.4   30   67-97      6-35  (109)
228 cd05766 IgC_MHC_II_beta Class   96.1   0.012 2.5E-07   31.9   3.6   26   72-97     12-38  (94)
229 cd07706 IgV_TCR_delta Immunogl  96.0   0.022 4.7E-07   31.7   4.5   31   67-97      7-37  (116)
230 cd04982 IgV_TCR_gamma Immunogl  96.0   0.018   4E-07   32.0   4.0   30   68-97      7-37  (116)
231 cd07694 Ig2_CD4 Second immunog  95.9   0.069 1.5E-06   28.7   5.8   39   13-55     48-86  (88)
232 cd05719 Ig2_PVR_like Second im  95.8   0.021 4.5E-07   31.1   3.7   22   76-97     17-38  (95)
233 cd04977 Ig1_NCAM-1_like First   95.8   0.023   5E-07   30.4   3.8   27   68-96      9-35  (92)
234 cd07703 Ig2_Nectin-2_like Seco  95.8   0.018   4E-07   31.3   3.3   21   77-97     18-38  (95)
235 smart00409 IG Immunoglobulin.   95.7   0.033 7.2E-07   28.1   4.3   28   69-97      4-31  (86)
236 smart00410 IG_like Immunoglobu  95.7   0.033 7.2E-07   28.1   4.3   28   69-97      4-31  (86)
237 cd00098 IgC Immunoglobulin Con  95.7   0.015 3.3E-07   30.9   2.8   26   72-97     11-37  (95)
238 cd05711 Ig_FcalphaRI Immunoglo  95.5   0.038 8.2E-07   29.8   4.1   23   15-38     54-76  (94)
239 cd07699 IgC_L Immunoglobulin C  95.5    0.02 4.3E-07   31.3   2.9   27   71-97     14-41  (100)
240 cd07698 IgC_MHC_I_alpha3 Class  95.0   0.054 1.2E-06   29.1   3.6   24   74-97     14-38  (93)
241 cd05768 IgC_CH4 CH4 domain (fo  94.9   0.049 1.1E-06   29.9   3.4   25   73-97     15-40  (102)
242 cd04981 IgV_H Immunoglobulin (  94.8   0.096 2.1E-06   29.4   4.4   32   67-98      5-37  (117)
243 cd07696 IgC_CH3 CH3 domain (th  94.7   0.066 1.4E-06   29.1   3.5   28   70-97     10-39  (96)
244 cd05767 IgC_MHC_II_alpha Class  94.5   0.059 1.3E-06   29.2   3.0   25   73-97     14-39  (94)
245 cd05769 IgC_TCR_beta T cell re  94.3   0.058 1.3E-06   30.4   2.8   25   73-97     17-42  (115)
246 cd07694 Ig2_CD4 Second immunog  94.1    0.19 4.2E-06   27.0   4.4   27   69-95      9-36  (88)
247 cd05770 IgC_beta2m Class I maj  94.1    0.09 1.9E-06   28.5   3.1   26   72-97     13-39  (93)
248 KOG3515|consensus               94.0   0.081 1.8E-06   38.6   3.5   40   57-96      4-44  (741)
249 cd05757 Ig2_IL1R_like Second i  93.8   0.043 9.4E-07   29.5   1.5   29   69-97      5-37  (92)
250 PHA02914 Immunoglobulin-like d  93.8    0.24 5.1E-06   33.9   5.2   38   14-54     79-116 (500)
251 cd07697 IgC_TCR_gamma T cell r  93.8    0.12 2.6E-06   28.1   3.3   24   74-97     16-40  (96)
252 cd05881 Ig1_Necl-2 First (N-te  93.7    0.21 4.6E-06   27.1   4.1   29   67-96      5-33  (95)
253 cd05715 Ig_P0-like Immunoglobu  93.5     0.2 4.3E-06   27.9   4.0   31   67-97      6-39  (116)
254 cd05761 Ig2_Necl-1-4_like Seco  93.4    0.19 4.1E-06   26.2   3.6   21   20-41     49-69  (82)
255 cd04985 IgC_CH1 CH1 domain (fi  93.3    0.23   5E-06   26.9   3.9   25   73-97     15-40  (95)
256 cd05847 IgC_CH2_IgE CH2 domain  93.3    0.17 3.7E-06   27.4   3.4   24   74-97     14-38  (94)
257 PHA02987 Ig domain OX-2-like p  93.2    0.24 5.1E-06   30.4   4.1   30   68-97     24-53  (189)
258 cd05721 IgV_CTLA-4 Immunoglobu  93.2     0.3 6.6E-06   27.6   4.3   31   68-98      7-39  (115)
259 cd05860 Ig4_SCFR Fourth immuno  93.1    0.17 3.8E-06   27.9   3.2   30   67-97     11-41  (101)
260 cd07705 Ig2_Necl-1 Second immu  93.1    0.28 6.1E-06   25.7   4.0   34   18-52     48-81  (83)
261 cd05872 Ig_Sema4B_like Immunog  92.9    0.14   3E-06   27.3   2.6   28   68-97      5-32  (85)
262 PF08204 V-set_CD47:  CD47 immu  92.8     0.2 4.2E-06   29.0   3.3   39   11-54     81-119 (130)
263 cd05880 Ig_EVA1 Immunoglobulin  92.7    0.29 6.3E-06   27.3   3.9   31   67-97      6-39  (115)
264 PF07686 V-set:  Immunoglobulin  91.9    0.33 7.2E-06   26.1   3.5   30   68-97     10-39  (114)
265 PF07654 C1-set:  Immunoglobuli  91.6    0.22 4.7E-06   26.0   2.4   26   72-97      6-32  (83)
266 PHA02982 hypothetical protein;  91.3    0.42 9.2E-06   29.9   3.6   32    7-39     91-122 (251)
267 cd00098 IgC Immunoglobulin Con  91.2    0.18   4E-06   26.6   1.9   21   18-39     64-84  (95)
268 cd05712 Ig_Siglec_N Immunoglob  91.0    0.53 1.1E-05   26.3   3.7   31   67-97      7-42  (119)
269 cd04986 IgC_CH2 CH2 domain (se  89.6    0.88 1.9E-05   25.0   3.7   27   71-97     16-44  (99)
270 cd05774 Ig_CEACAM_D1 First imm  88.4     1.5 3.2E-05   24.2   4.1   28   69-97      8-35  (105)
271 cd05883 Ig2_Necl-2 Second immu  88.0     2.2 4.8E-05   22.5   4.4   36   17-55     45-80  (82)
272 cd05890 Ig2_Nectin-1_like Seco  87.7     1.2 2.7E-05   24.4   3.3   21   77-97     23-43  (98)
273 PHA02914 Immunoglobulin-like d  85.5     4.7  0.0001   27.9   5.8   36   15-54    345-380 (500)
274 PHA03283 envelope glycoprotein  85.2      12 0.00025   26.8   8.0   77   16-96    134-233 (542)
275 PF01688 Herpes_gI:  Alphaherpe  84.2     4.5 9.9E-05   24.3   4.9   26   13-39    121-146 (161)
276 cd05884 Ig2_Necl-3 Second immu  83.5     2.5 5.4E-05   22.1   3.3   22   18-40     48-69  (83)
277 cd07691 Ig_CD3_gamma_delta Imm  82.6     1.9 4.2E-05   22.1   2.5   22   16-38     33-54  (69)
278 cd05879 Ig_P0 Immunoglobulin (  81.3     4.7  0.0001   22.6   4.0   30   67-96      6-38  (116)
279 PF07354 Sp38:  Zona-pellucida-  80.9     1.7 3.8E-05   28.1   2.4   24   16-40     37-60  (271)
280 KOG1480|consensus               80.8    0.71 1.5E-05   34.2   0.7   24   15-39    182-205 (909)
281 PHA03290 envelope glycoprotein  78.2     8.7 0.00019   25.9   5.0   26   13-39    126-151 (357)
282 smart00407 IGc1 Immunoglobulin  76.6     5.1 0.00011   20.3   3.0   21   18-39     50-70  (75)
283 PHA02865 MHC-like TNF binding   71.2     7.1 0.00015   26.3   3.3   22   76-97    216-238 (338)
284 PHA03286 envelope glycoprotein  71.2      34 0.00074   24.2   9.4   78   16-96    127-225 (492)
285 PHA03292 envelope glycoprotein  70.5      14 0.00031   25.4   4.6   24   15-39    127-150 (413)
286 PHA03289 envelope glycoprotein  68.5      16 0.00034   24.6   4.4   24   15-39    121-144 (352)
287 PHA03042 CD47-like protein; Pr  68.5      27 0.00059   23.0   5.4   23   15-39     70-92  (286)
288 cd07692 Ig_CD3_epsilon Immunog  65.4     7.4 0.00016   19.7   2.0   22   72-97      5-26  (65)
289 PHA03052 Hypothetical protein;  64.4      17 0.00036   18.6   3.2   29   68-96      6-36  (69)
290 PF05790 C2-set:  Immunoglobuli  64.1      20 0.00042   18.8   5.0   20   18-38     45-64  (80)
291 PF06214 SLAM:  Signaling lymph  60.8      21 0.00046   20.2   3.4   21   16-37    103-123 (126)
292 PHA03282 envelope glycoprotein  60.5      21 0.00046   25.4   4.0   38   15-54    123-160 (540)
293 PF11327 DUF3129:  Protein of u  57.0      32  0.0007   21.1   4.1   31   11-42     88-118 (184)
294 PHA03291 envelope glycoprotein  55.9      50  0.0011   22.7   5.1   25   14-39    127-151 (401)
295 PF10651 DUF2479:  Domain of un  50.8      53  0.0011   19.6   4.7   46    9-55     77-124 (170)
296 PHA03282 envelope glycoprotein  50.4      56  0.0012   23.4   4.8   26   13-39    330-355 (540)
297 COG5475 Uncharacterized small   50.4      26 0.00057   17.2   2.4   21   16-39     18-38  (60)
298 KOG4597|consensus               49.3      24 0.00052   25.2   2.9   37   15-55    256-292 (560)
299 PF10572 UPF0556:  Uncharacteri  48.9      58  0.0013   19.6   4.3   30   26-55     69-98  (158)
300 PF02480 Herpes_gE:  Alphaherpe  43.5      53  0.0011   23.1   3.9   26   13-39    266-291 (439)
301 PHA03112 IL-18 binding protein  41.3      65  0.0014   19.0   3.5   26   71-96     35-61  (141)
302 PHA03240 envelope glycoprotein  38.6      15 0.00033   23.3   0.7   19   15-34    104-122 (258)
303 PF06328 Lep_receptor_Ig:  Ig-l  38.3      66  0.0014   17.2   4.8   30   67-96     11-44  (89)
304 PHA03286 envelope glycoprotein  37.2 1.1E+02  0.0023   21.9   4.5   22   17-39    308-329 (492)
305 PF01082 Cu2_monooxygen:  Coppe  33.1      76  0.0016   18.2   3.0   24   15-39      3-27  (132)
306 TIGR00864 PCC polycystin catio  32.7 3.8E+02  0.0081   24.2   8.2   70   23-96   1834-1903(2740)
307 PHA03189 UL14 tegument protein  31.3 1.7E+02  0.0037   19.9   5.5   17   22-39    139-155 (348)
308 PHA03283 envelope glycoprotein  30.3      64  0.0014   23.4   2.7   26   13-39    312-337 (542)
309 PF11781 RRN7:  RNA polymerase   28.3      35 0.00077   14.9   0.9   10   25-35     20-29  (36)
310 cd00501 Peptidase_C15 Pyroglut  25.8      42  0.0009   20.5   1.2   15   22-36    130-144 (194)
311 PF07430 PP1:  Phloem filament   24.1 1.9E+02  0.0042   18.1   4.5   35    3-38    153-188 (202)
312 KOG0200|consensus               23.4      87  0.0019   22.9   2.5   23   15-38     12-34  (609)
313 COG3536 Uncharacterized protei  22.9      97  0.0021   17.6   2.1   19   17-38     59-77  (120)
314 PRK13194 pyrrolidone-carboxyla  21.3      41 0.00088   21.1   0.5   15   22-36    130-144 (208)
315 PF12539 Csm1:  Chromosome segr  21.2 1.6E+02  0.0034   16.0   4.8   32   18-55     14-46  (90)

No 1  
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=99.51  E-value=2.9e-13  Score=78.37  Aligned_cols=75  Identities=21%  Similarity=0.399  Sum_probs=57.3

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCC-CeEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPD-PQISVT   95 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~-~~~~W~   95 (98)
                      +|+|.+++.. |+|.|+|.+.+.   .......+.|.|..+|.. .+.. ......+|..+.|+|.+.+.+|. +.+.|+
T Consensus         2 sL~i~~v~~~-D~G~Y~C~~~~~---~~~~~~~~~l~v~~~P~v-~~~~-~~~~~~~~~~~~L~C~a~g~~P~~~~i~W~   75 (139)
T cd05771           2 SLTLPGLTVH-DEGTYICSVSTP---PHQAQQIIQLSVSEPPRV-RLSL-EKLVSMIEEPQTLICHIAGYYPLDVQVEWT   75 (139)
T ss_pred             eEEECCCCHH-HCEEEEEEEEcc---CcceeeEEEEEEecCCce-EEeC-CCceeecCCcEEEEEEECCCCCCCeEEEEE
Confidence            6999999999 999999999863   445666778888876654 3332 22344478889999999877776 589999


Q ss_pred             ec
Q psy5866          96 LQ   97 (98)
Q Consensus        96 ~~   97 (98)
                      ++
T Consensus        76 ~~   77 (139)
T cd05771          76 RE   77 (139)
T ss_pred             EC
Confidence            75


No 2  
>PHA02785 IL-beta-binding protein; Provisional
Probab=99.27  E-value=1.1e-10  Score=76.20  Aligned_cols=79  Identities=18%  Similarity=0.290  Sum_probs=56.4

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCee-eEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCC---CeE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDL-HSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPD---PQI   92 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~-~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~---~~~   92 (98)
                      .|.|.+++.+ |+|.|+|.+.+..++... .+..+.|.|..+..+|.+.......+..|+.+.|.|.+.+ .|.   +.+
T Consensus       178 ~L~i~~v~~~-d~G~Y~C~~~n~~g~~~~~~t~~v~l~V~~~~~pp~~~~p~~~~~~~G~~v~L~C~a~g-~P~~~~~~v  255 (326)
T PHA02785        178 IITIEDVRKN-DAGYYTCVLKYIYGDKTYNVTRIVKLEVRDRIIPPTMQLPEGVVTSIGSNLTIACRVSL-RPPTTDADV  255 (326)
T ss_pred             eEEEeecChh-hCeEEEEEEEeccCCEEEeEEEEEEEEEeccCCCceecCCCcEEecCCCcEEEEEEEEC-CCCCCCceE
Confidence            6999999999 999999999986432221 2334456665444556553335567788999999999974 454   589


Q ss_pred             EEEec
Q psy5866          93 SVTLQ   97 (98)
Q Consensus        93 ~W~~~   97 (98)
                      .|+++
T Consensus       256 ~W~kn  260 (326)
T PHA02785        256 FWISN  260 (326)
T ss_pred             EEEEC
Confidence            99875


No 3  
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=99.22  E-value=1.9e-10  Score=71.67  Aligned_cols=71  Identities=18%  Similarity=0.221  Sum_probs=53.4

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCC----CCCC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGG----SPDP   90 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~----~p~~   90 (98)
                      ..+|.|.+++.+ |+|.|+|.+.+.   .......+.|.|..++        ....+.+|+.+.|+|.+.++    .|.|
T Consensus        97 ~~~L~I~~v~~~-DsG~Y~C~a~N~---~~~~~~~i~L~V~~~~--------~~~~~~~G~~v~L~C~~~~~~~~~~p~p  164 (227)
T PHA02826         97 SENLWIGNVINI-DEGIYICTISSG---NICEESTIRLTFDSGT--------INYQFNSGKDSKLHCYGTDGISSTFKDY  164 (227)
T ss_pred             CCeEEECCCChH-HCEEEEEEEEEC---CcceEEEEEEEEecCC--------ccceEecCCCEEEEeeCCCCccccCCCc
Confidence            357999999999 999999999995   3344555667764211        22456789999999998654    4578


Q ss_pred             eEEEEec
Q psy5866          91 QISVTLQ   97 (98)
Q Consensus        91 ~~~W~~~   97 (98)
                      ++.|+++
T Consensus       165 ~I~WyKn  171 (227)
T PHA02826        165 TLTWYKN  171 (227)
T ss_pred             eEEEEEC
Confidence            9999986


No 4  
>KOG3513|consensus
Probab=99.20  E-value=1.3e-10  Score=83.81  Aligned_cols=76  Identities=28%  Similarity=0.480  Sum_probs=62.7

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPDPQISV   94 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W   94 (98)
                      ...|.|.+++.+ |+|.|+|.+.|.   .+.......+.|..+|.-  +....+..+..|+++.+.|.+. |.|.|+++|
T Consensus       293 ~~vL~I~nv~~~-D~G~Y~C~AeN~---~G~~~~~~~v~v~a~P~w--~~~~~d~~~~~gs~v~~eC~a~-g~P~p~v~W  365 (1051)
T KOG3513|consen  293 GKVLKIPNVQYE-DAGEYECIAENS---RGSATHSGHVTVYAPPYW--LQKPQDTEADTGSNVTLECKAS-GKPNPTVKW  365 (1051)
T ss_pred             ccEEEecccCcC-CCeEEEEEEecc---cccceeeEEEEEecCchh--hcccceeEecCCCCeEEEEEec-CCCCCceEE
Confidence            346999999999 999999999995   566777788888766653  3233667889999999999996 899999999


Q ss_pred             Eec
Q psy5866          95 TLQ   97 (98)
Q Consensus        95 ~~~   97 (98)
                      +++
T Consensus       366 lkN  368 (1051)
T KOG3513|consen  366 LKN  368 (1051)
T ss_pred             eeC
Confidence            975


No 5  
>KOG4194|consensus
Probab=99.11  E-value=5.8e-10  Score=77.01  Aligned_cols=83  Identities=24%  Similarity=0.429  Sum_probs=63.3

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCC
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSG   85 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~   85 (98)
                      |+.+.+..+  ..-|.||+++ |.|.|+|.+++.   ++..+..+.|.|+..|.. .+. ..+..+..|+.+.|+|.+. 
T Consensus       661 Rl~Vmpedd--~f~Itnvk~e-D~GiYtC~A~n~---AG~isanAtL~V~e~p~f-~~P-L~~~~V~~get~vlqC~a~-  731 (873)
T KOG4194|consen  661 RLHVMPEDD--VFFITNVKIE-DQGIYTCTAQNV---AGQISANATLTVLETPSF-SIP-LEDQLVVVGETLVLQCLAE-  731 (873)
T ss_pred             eeeecCCCC--EEEEeccccc-ccceeEEeeecc---ccceeeceEEEEecCCcc-ccc-ccceEEEecceEEEEEecC-
Confidence            344444433  4779999999 999999999996   455566788999877654 332 3567899999999999986 


Q ss_pred             CCCC-CeEEEEec
Q psy5866          86 GSPD-PQISVTLQ   97 (98)
Q Consensus        86 ~~p~-~~~~W~~~   97 (98)
                      +.|+ |.+.|+|+
T Consensus       732 ~~~a~pr~~W~k~  744 (873)
T KOG4194|consen  732 GAPADPRLEWFKE  744 (873)
T ss_pred             CCCCCccccccCC
Confidence            5665 99999986


No 6  
>PHA03376 BARF1; Provisional
Probab=99.02  E-value=7.2e-09  Score=62.44  Aligned_cols=87  Identities=14%  Similarity=0.332  Sum_probs=56.4

Q ss_pred             CceeEEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeC-CCCceecCCCcEEEE
Q psy5866           2 DKVEIIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISP-GANPVATEGRAIELV   80 (98)
Q Consensus         2 ~~~~~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~-~~~~~~~~g~~~~l~   80 (98)
                      ++.-++++..+.++++|.|.+++++ |+|.|+|.++....+.   ...-.|++. .|-...+.. ..+..+  .....+.
T Consensus        73 EyRGrtD~~~~~gnvsLvI~~l~lS-DdGtY~C~fQkge~~~---~k~ehLt~V-~~~~Lsv~a~~~dFp~--~~~~~i~  145 (221)
T PHA03376         73 PFRGFFDIHRSANTFFLVVTAANIS-HDGNYLCRMKLGETEV---TKQEHLSVV-KPLTLSVHSERSQFPD--FSVLTVT  145 (221)
T ss_pred             ccccEEEEEecCCeEEEEEEeeeec-CCceEEEEEEcCCCce---eeeeeeeee-ecceEEEEeccccCCC--CCeeEEE
Confidence            3455667766679999999999999 9999999998743222   122234442 222223321 011111  3446899


Q ss_pred             EEcCCCCCCCeEEEEe
Q psy5866          81 CSTSGGSPDPQISVTL   96 (98)
Q Consensus        81 C~~~~~~p~~~~~W~~   96 (98)
                      |. .+|.|.|.++|+.
T Consensus       146 C~-sggfP~P~~~Wle  160 (221)
T PHA03376        146 CT-VNAFPHPHVQWLM  160 (221)
T ss_pred             Ee-cCCcCCchheecc
Confidence            99 5899999999974


No 7  
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=98.97  E-value=5.2e-09  Score=57.29  Aligned_cols=52  Identities=19%  Similarity=0.293  Sum_probs=40.7

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCC
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPP   61 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p   61 (98)
                      ++..........|.|.++... |+|.|+|.+.|.   .+.....+.|.|...|.+|
T Consensus        46 ~~~~~~~~~~s~L~I~~~~~~-D~G~Ytc~a~N~---~G~~~~~~~l~V~~~P~pP   97 (98)
T cd05762          46 GIKIENTENSSKLTITEGQQE-HCGCYTLEVENK---LGSRQAQVNLTVVDKPDPP   97 (98)
T ss_pred             cEEEEecCCeeEEEECCCChh-hCEEEEEEEEcC---CCceeEEEEEEEecCCCCC
Confidence            444444455678999999999 999999999996   4556667889998887765


No 8  
>KOG3513|consensus
Probab=98.93  E-value=1.8e-08  Score=73.15  Aligned_cols=75  Identities=21%  Similarity=0.275  Sum_probs=57.7

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCC--CCeEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSP--DPQIS   93 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p--~~~~~   93 (98)
                      .+|.|++++.+ |+|.|+|.|.|.   .+......+|.|..++..  +.......+..|+.+.|.|.+. ..+  .+.+.
T Consensus       479 GtL~I~n~t~~-DaG~YtC~A~N~---~G~a~~~~~L~Vkd~tri--~~~P~~~~v~~g~~v~l~Ce~s-hD~~ld~~f~  551 (1051)
T KOG3513|consen  479 GTLEISNVTRS-DAGKYTCVAENK---LGKAESTGNLIVKDATRI--TLAPSNTDVKVGESVTLTCEAS-HDPSLDITFT  551 (1051)
T ss_pred             CcEEecccCcc-cCcEEEEEEEcc---cCccceEEEEEEecCceE--EeccchhhhccCceEEEEeecc-cCCCcceEEE
Confidence            36999999999 999999999995   567777788888654432  2233556889999999999986 344  45788


Q ss_pred             EEec
Q psy5866          94 VTLQ   97 (98)
Q Consensus        94 W~~~   97 (98)
                      |.++
T Consensus       552 W~~n  555 (1051)
T KOG3513|consen  552 WKKN  555 (1051)
T ss_pred             EEEC
Confidence            9764


No 9  
>KOG4194|consensus
Probab=98.89  E-value=6.2e-09  Score=72.10  Aligned_cols=75  Identities=25%  Similarity=0.426  Sum_probs=60.7

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      .|++.||... |+|.|+|.+.|+-+  ...+..++|+|...|.....  ..+.+...|+.+.|.|.+. |.|.|.+.|-+
T Consensus       575 ~L~L~nVt~t-d~grYQCVvtN~FG--Stysqk~KltV~~~PsFtkt--P~dltl~tg~mArl~CaAt-G~P~PeIawqk  648 (873)
T KOG4194|consen  575 ILHLDNVTFT-DEGRYQCVVTNHFG--STYSQKAKLTVNQAPSFTKT--PEDLTLRTGQMARLECAAT-GHPRPEIAWQK  648 (873)
T ss_pred             eeeeeeeecc-cCceEEEEEecccC--cchhheeEEEeeccCccccC--cccceeecccceeeeeecc-CCCCcceeehh
Confidence            4899999999 99999999999733  44556678888766664333  3678999999999999996 89999999965


Q ss_pred             c
Q psy5866          97 Q   97 (98)
Q Consensus        97 ~   97 (98)
                      +
T Consensus       649 d  649 (873)
T KOG4194|consen  649 D  649 (873)
T ss_pred             c
Confidence            3


No 10 
>KOG4221|consensus
Probab=98.87  E-value=8.3e-09  Score=75.37  Aligned_cols=75  Identities=36%  Similarity=0.521  Sum_probs=59.8

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPDPQISVT   95 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~   95 (98)
                      .+|.|++++.. |+|.|+|+|.+.   .......+.++|+.+|..  +.........++.++.+.|.+. |.|.|++.|+
T Consensus       291 ~slliS~a~~~-dSg~YtC~Atn~---~D~idasaev~V~a~P~~--~~~p~~l~A~e~~die~ec~~~-g~p~p~v~w~  363 (1381)
T KOG4221|consen  291 SSLLISNATDD-DSGKYTCRATNT---NDSIDASAEVTVLAPPGF--TKAPTTLVAHESMDIEFECPVS-GKPIPTVRWY  363 (1381)
T ss_pred             cceEEeccccc-cCceEEEEecCC---CcccccceEEEEEcCCCC--CCCCcceeeeeccceeEeCCCC-CCCcceEEEE
Confidence            36899999999 999999999984   455566678889877653  2223456777889999999986 7899999999


Q ss_pred             ec
Q psy5866          96 LQ   97 (98)
Q Consensus        96 ~~   97 (98)
                      ++
T Consensus       364 kN  365 (1381)
T KOG4221|consen  364 KN  365 (1381)
T ss_pred             ec
Confidence            86


No 11 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=98.78  E-value=4.9e-08  Score=52.08  Aligned_cols=41  Identities=32%  Similarity=0.478  Sum_probs=33.3

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCC
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPP   58 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~   58 (98)
                      ...+|.|.+++.. |+|.|+|.|.+.   .+..+..+.|.|..+|
T Consensus        45 ~~~~L~I~~v~~~-D~G~YtC~A~n~---~g~~~~~~~L~V~~~P   85 (85)
T cd05854          45 TIGDLVIVNAQLS-HAGTYTCTAQTV---VDSASASATLVVRGPP   85 (85)
T ss_pred             eEeEEEEccCChh-hCeEEEEEEecC---CCCEEEEEEEEEECCC
Confidence            3457999999999 999999999996   4566667788887554


No 12 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.77  E-value=4.3e-08  Score=52.60  Aligned_cols=42  Identities=31%  Similarity=0.488  Sum_probs=35.0

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPP   61 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p   61 (98)
                      .+|.|.++... |+|.|+|.|.|.   .+..+..+.|.|..+|.+|
T Consensus        47 s~L~I~~~~~~-D~G~YtC~A~N~---~G~~~~~~~L~V~~~P~~P   88 (88)
T cd05735          47 STLQILPTVRE-DSGFFSCHAINS---YGEDRGIIQLTVQEPPDPP   88 (88)
T ss_pred             EEEEECCCCcc-cCEEEEEEEEcC---CCcceEEEEEEEeCCCCCC
Confidence            56999999999 999999999996   4556667888888777654


No 13 
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=98.75  E-value=2e-08  Score=53.72  Aligned_cols=39  Identities=28%  Similarity=0.497  Sum_probs=33.2

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPP   58 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~   58 (98)
                      .+|.|.+++.. |+|.|+|.|.+.   ....+..+.|.|..||
T Consensus        47 ~~L~I~nv~~~-dsG~YtC~a~n~---~~~~~a~a~L~V~~pP   85 (85)
T cd05853          47 GDLMIRSIQLK-HAGKYVCMVQTS---VDKLSAAADLIVRGPP   85 (85)
T ss_pred             CcEEEecCCHH-HCEEEEEEEEcc---cCceEEEEEEEEecCC
Confidence            36999999999 999999999995   5666777888888765


No 14 
>KOG4221|consensus
Probab=98.75  E-value=1.4e-07  Score=69.29  Aligned_cols=85  Identities=27%  Similarity=0.403  Sum_probs=60.9

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCC---C-EEeCCCCceecCCCcEEEEE
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQP---P-KISPGANPVATEGRAIELVC   81 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~---p-~i~~~~~~~~~~g~~~~l~C   81 (98)
                      |+-+.+++   .|.|.++..+ |.|.|+|.+.+.+..  -.+..+.|+|..-+..   . ++.......+.+|+++.|.|
T Consensus       186 r~i~lpsG---~L~I~~~qp~-d~g~yrc~vt~g~~~--r~S~~a~ltv~s~~~~~~~~~fl~~p~~~~v~~g~~v~leC  259 (1381)
T KOG4221|consen  186 RVIVLPSG---ALEISGLQPS-DTGEYRCVVTGGASQ--RTSNEAELTVLSDPGALNKLVFLDEPSNAVVVEGDDVVLEC  259 (1381)
T ss_pred             cEEEcCCC---cEEecccccC-CCceEEEEEecCCcC--CccceeEEEecCCcccccceeeecCCCccccccCCcEEEEE
Confidence            44444433   4999999999 999999999985332  2355677777622211   1 23223456899999999999


Q ss_pred             EcCCCCCCCeEEEEec
Q psy5866          82 STSGGSPDPQISVTLQ   97 (98)
Q Consensus        82 ~~~~~~p~~~~~W~~~   97 (98)
                      .+. +.|.|.+.|+++
T Consensus       260 vvs-~~p~p~v~Wlrn  274 (1381)
T KOG4221|consen  260 VVS-GVPKPSVKWLRN  274 (1381)
T ss_pred             Eec-CCCCCceEEeeC
Confidence            985 899999999975


No 15 
>PHA02785 IL-beta-binding protein; Provisional
Probab=98.72  E-value=1.2e-07  Score=62.05  Aligned_cols=75  Identities=17%  Similarity=0.283  Sum_probs=51.7

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEe-CCCCceecCCCcEEEEEEcC----CCCCCCe
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKIS-PGANPVATEGRAIELVCSTS----GGSPDPQ   91 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~-~~~~~~~~~g~~~~l~C~~~----~~~p~~~   91 (98)
                      .|.|.++..+ |+|.|+|.+.|.   .......+.|.|..... +.+. ......+.+|..+.+.|...    .+.|.+.
T Consensus        83 ~l~i~~~~~~-DsG~Y~C~a~N~---~g~~~~s~~L~V~~~~~-~~~~~~~~~~~~~~g~~~~i~C~~~~~~~~~~~~~~  157 (326)
T PHA02785         83 NMLILNPTQS-DSGIYICITKNE---TYCDMMSLNLTIVSVSE-SNIDLISYPQIVNERSTGEMVCPNINAFIASNVNAD  157 (326)
T ss_pred             eEEEcccCcc-cCeEEEEEEECC---CcceEEEEEEEEEecCC-CccceeeccceecccCcEEEECCChhhcccCCCCce
Confidence            5889999999 999999999985   23344556777764322 1110 11234567899999999621    3568899


Q ss_pred             EEEEe
Q psy5866          92 ISVTL   96 (98)
Q Consensus        92 ~~W~~   96 (98)
                      +.|++
T Consensus       158 i~W~k  162 (326)
T PHA02785        158 IIWSG  162 (326)
T ss_pred             EEEcc
Confidence            99975


No 16 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=98.68  E-value=1.4e-07  Score=48.73  Aligned_cols=45  Identities=24%  Similarity=0.327  Sum_probs=32.6

Q ss_pred             eEEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866           5 EIIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus         5 ~~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      .++......+...|.|.++... |+|.|+|.+.|.   .+..+..+.|.
T Consensus        29 ~~~~~~~~~~~~~L~I~~~~~~-D~G~Y~C~a~N~---~G~~~~~~~l~   73 (74)
T cd05748          29 GRVQIETTASSTSLVIKNAERS-DSGKYTLTLKNP---AGEKSATINVK   73 (74)
T ss_pred             CeEEEEECCCeEEEEECCCCcC-cCEEEEEEEECC---CccEEEEEEEE
Confidence            3445544556678999999999 999999999995   34444444443


No 17 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.67  E-value=1e-07  Score=50.68  Aligned_cols=40  Identities=33%  Similarity=0.522  Sum_probs=32.6

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPP   58 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~   58 (98)
                      ..+|.|.+++.. |+|.|+|.+.+.   ....+..+.|.|..+|
T Consensus        46 ~~~L~I~~v~~~-D~G~Y~C~a~n~---~g~~~~~~~l~V~~pP   85 (85)
T cd04970          46 NGDLMIRNAQLK-HAGKYTCTAQTV---VDSLSASADLIVRGPP   85 (85)
T ss_pred             cceEEEccCCHH-hCeeeEEEEecC---CCcEEEEEEEEEECCC
Confidence            457999999999 999999999985   4456667888887654


No 18 
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=98.66  E-value=1.6e-07  Score=48.99  Aligned_cols=46  Identities=22%  Similarity=0.298  Sum_probs=33.0

Q ss_pred             eEEEEeC-CCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866           5 EIIDYRP-DSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus         5 ~~~~~~~-~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .++.+.. ..+..+|.|.++..+ |+|.|+|.+.|.   .+..+..+.|.|
T Consensus        29 ~r~~~~~~~~g~~~L~I~~~~~~-D~G~Y~C~A~N~---~G~~~~~a~L~V   75 (75)
T cd05892          29 DRISLYQDNSGRVTLLIKNVNKK-DAGWYTVSAVNE---AGVATCHARLDV   75 (75)
T ss_pred             CeEEEEEcCCCcEEEEECCCChh-hCEEEEEEEEcC---cCeEEEEEEEeC
Confidence            3555433 345568999999999 999999999996   445555555543


No 19 
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=98.66  E-value=2e-07  Score=51.11  Aligned_cols=42  Identities=29%  Similarity=0.423  Sum_probs=31.9

Q ss_pred             eCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          10 RPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        10 ~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      +...++.+|+|++++.+ |+|.|.|.+.+-..+.  .+..+.|.|
T Consensus        58 ~~~~~~~sL~I~nv~~s-D~GtY~C~v~~~p~g~--~~~~~~L~V   99 (100)
T cd05888          58 PNPIADGALILRNAVQA-DEGKYKCRVITFPAGN--FEAELVLTV   99 (100)
T ss_pred             CCCCCceEEEEecCccc-cceEEEEEEEeCCCCC--eeeEEEEEe
Confidence            34567889999999999 9999999999853332  355566665


No 20 
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=98.65  E-value=1.9e-07  Score=51.24  Aligned_cols=49  Identities=18%  Similarity=0.346  Sum_probs=36.3

Q ss_pred             eeEEEEe-CCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866           4 VEIIDYR-PDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus         4 ~~~~~~~-~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      +.|+.+. ...++.+|+|++++.+ |+|.|.|.+.+...  +..+..+.|+|+
T Consensus        50 ~~Rv~f~~~~~~daSi~i~nl~~~-D~G~Y~C~v~t~P~--g~~~~~~~L~V~   99 (99)
T cd05886          50 RERVTFKNPSFEDGTISLSRLELE-DEGVYICEFATFPT--GNRESQLNLTVY   99 (99)
T ss_pred             cCcEEEcCCCCCcceEEEcCCccc-cCEEEEEEEEeCCC--CCeEEEEEEEEC
Confidence            3555543 4557789999999999 99999999998432  345666777763


No 21 
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=98.62  E-value=2.2e-07  Score=50.70  Aligned_cols=39  Identities=21%  Similarity=0.331  Sum_probs=31.0

Q ss_pred             CCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          12 DSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        12 ~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..+.++|+|.+++.+ |+|.|+|.+.+.   .......+.|+|
T Consensus        61 ~~~~~sL~I~~v~~~-D~G~Y~C~v~~~---~~~~~~~i~l~v   99 (100)
T cd05713          61 AEGSVALRIHNVRAS-DEGLYTCFFQSD---GFYEEATVELKV   99 (100)
T ss_pred             cCCcEEEEEEcCChh-hCEEEEEEEecC---CcEEEEEEEEEE
Confidence            457889999999999 999999999974   344555566665


No 22 
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=98.61  E-value=2.1e-07  Score=50.74  Aligned_cols=43  Identities=21%  Similarity=0.340  Sum_probs=31.7

Q ss_pred             eEEEEe-CCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEE
Q psy5866           5 EIIDYR-PDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTV   52 (98)
Q Consensus         5 ~~~~~~-~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l   52 (98)
                      .||... .++..++|+|++++.+ |+|.|+|++..    .+..+..+.+
T Consensus        50 ~Rf~~~~~~~~~~tL~I~~vq~~-D~G~Y~Cqv~t----~p~~~~~~~~   93 (95)
T cd05881          50 SRFQLVNFSSNELRVSLSNVSLS-DEGRYFCQLYT----DPPQEAYTTI   93 (95)
T ss_pred             cCEEEEeCCCCEEEEEECcCCcc-cCEEEEEEEEc----ccCeEEEEEE
Confidence            355433 3577999999999999 99999999987    3444444443


No 23 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.60  E-value=1.9e-07  Score=50.88  Aligned_cols=44  Identities=18%  Similarity=0.397  Sum_probs=31.7

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      ++.+....+..+|+|.+++.+ |+|.|+|.+.|..   +.....+.|+
T Consensus        54 r~~v~~~~~~~~L~I~~v~~~-D~G~Y~C~A~N~~---G~~~~~~~l~   97 (98)
T cd05870          54 RIEVKGQHGESSLHIKDVKLS-DSGRYDCEAASRI---GGHQKSMYLD   97 (98)
T ss_pred             eEEEeecCCeeEEEEeeCCcC-CCEEEEEEEeccC---CcceeEEEEe
Confidence            445444445678999999999 9999999999963   3344444544


No 24 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.59  E-value=2.3e-07  Score=50.27  Aligned_cols=47  Identities=21%  Similarity=0.363  Sum_probs=33.0

Q ss_pred             eEEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866           5 EIIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus         5 ~~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .++.........+|+|.++..+ |+|.|+|.|.|..+  ......+.|.+
T Consensus        45 ~r~~~~~~g~~~~L~I~~v~~~-D~G~Y~C~A~N~~G--~~~~~~i~l~~   91 (92)
T cd05866          45 QRVVVQKEGVRSRLTIYNANIE-DAGIYRCQATDAKG--QTQEATVVLEI   91 (92)
T ss_pred             CCEEEEeCCCeeEEEEecCChH-HCEEEEEEEEcCCC--cEEEEEEEEEE
Confidence            3455555555678999999999 99999999999633  22244445543


No 25 
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=98.59  E-value=2.8e-07  Score=50.32  Aligned_cols=47  Identities=19%  Similarity=0.268  Sum_probs=34.6

Q ss_pred             eEEEEe-CCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866           5 EIIDYR-PDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus         5 ~~~~~~-~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .|+.+. ...++.+|+|.|++.+ |+|.|+|.+.+...  +.......|+|
T Consensus        48 ~Rv~~~~~~~~d~sl~i~nv~~~-D~G~Y~C~v~tfP~--G~~~~~~~l~~   95 (96)
T cd05887          48 GRVSFKNYSLLDATIMLENVGFS-DIGVYICKAVTFPL--GNTQSSTTVTV   95 (96)
T ss_pred             CcEEEcCCCCCccEEEEeCCCcc-ccEEEEEEEEeCCC--CCeeEEEEEEE
Confidence            455553 4556789999999999 99999999988533  44445556655


No 26 
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=98.58  E-value=2.7e-07  Score=52.03  Aligned_cols=30  Identities=30%  Similarity=0.643  Sum_probs=26.7

Q ss_pred             eCCCCeEEEEEccceeeccCeEEEEEEEECC
Q psy5866          10 RPDSGRYDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        10 ~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      +...++.+|.|.+++.+ |+|.|+|.+.+..
T Consensus        74 ~~~~~daSI~I~nv~~s-D~G~Y~C~v~n~p  103 (116)
T cd05879          74 NPSRKDGSIVIHNLDYT-DNGTFTCDVKNPP  103 (116)
T ss_pred             CCCcCeeEEEEccCCcc-cCEEEEEEEEcCC
Confidence            45678899999999999 9999999999853


No 27 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=98.58  E-value=2e-07  Score=49.64  Aligned_cols=45  Identities=24%  Similarity=0.377  Sum_probs=33.8

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ++.+....+..+|+|.++..+ |+|.|+|.+.+.   ....+..+.|.|
T Consensus        46 ~~~~~~~~~~~~L~I~~v~~~-D~G~Y~C~~~n~---~g~~~~~~~l~V   90 (90)
T PF07679_consen   46 RYQIESDGGSSSLTIKNVTRE-DAGTYTCVASNS---SGEATASVNLTV   90 (90)
T ss_dssp             SEEEEEETTEEEEEESSESGG-GSEEEEEEEEET---TEEEEEEEEEEE
T ss_pred             eeeeecccceeEEccCCCChh-hCEEEEEEEEEC---CCEEEEEEEEEC
Confidence            344444447889999999999 999999999995   455555555554


No 28 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=98.57  E-value=3.5e-07  Score=47.69  Aligned_cols=46  Identities=24%  Similarity=0.317  Sum_probs=32.4

Q ss_pred             eEEEEeCCC-CeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866           5 EIIDYRPDS-GRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus         5 ~~~~~~~~~-~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .++.+.... +...|.|.++..+ |+|.|+|.+.|.   .+..+..+.|.|
T Consensus        29 ~~~~~~~~~~~~~~L~I~~v~~~-D~G~Y~C~A~N~---~G~~~~~a~L~V   75 (75)
T cd05893          29 DRVSMHQDNCGYICLLIQGATKE-DAGWYTVSAKNE---AGIVSCTARLDV   75 (75)
T ss_pred             CeEEEEEcCCCEEEEEECCCCHH-HCEEEEEEEEcC---CCEEEEEEEEeC
Confidence            345554332 4447999999999 999999999996   445555555543


No 29 
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=98.56  E-value=4.8e-07  Score=50.52  Aligned_cols=46  Identities=17%  Similarity=0.286  Sum_probs=35.1

Q ss_pred             EEEE---eCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866           6 IIDY---RPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus         6 ~~~~---~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      |+.+   ....+.++|+|++++.+ |+|.|.|.+...   .......+.|.|.
T Consensus        59 R~~~~~~~~~~~~asL~I~~l~~s-D~G~Y~C~v~~~---~~~~~~~v~l~V~  107 (110)
T cd05878          59 RVSLPNYPENRGDASLEISRLRSS-DSGVYRCEVMHG---IEDEQDTVPLEVT  107 (110)
T ss_pred             eEEeccCCCCCCcEEEEECCCChh-hCEEEEEEEEeC---CCcceEEEEEEEE
Confidence            5554   24567899999999999 999999999874   3455666666664


No 30 
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=98.55  E-value=6.8e-07  Score=48.48  Aligned_cols=38  Identities=32%  Similarity=0.451  Sum_probs=29.0

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ++.+|+|.+++.+ |+|.|.|.+....  .+.....+.|.|
T Consensus        60 ~~~sL~I~~v~~~-D~G~Y~C~v~~~~--~g~~~~~~~l~V   97 (98)
T cd05718          60 EDATISISNLRLE-DEGNYICEFATFP--QGNRQKVTTLTV   97 (98)
T ss_pred             CceEEEEccCCcc-cCEEEEEEEEeCC--CCcEEEEEEEEe
Confidence            6789999999999 9999999998642  234445555555


No 31 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=98.55  E-value=3.4e-07  Score=47.91  Aligned_cols=33  Identities=18%  Similarity=0.365  Sum_probs=26.8

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ++......+...|+|.+++.+ |+|.|+|.+.|.
T Consensus        32 ~~~~~~~~~~~~L~I~~v~~~-D~G~Y~C~a~N~   64 (78)
T cd05743          32 RVSITSEGGYGTLTIRDVKES-DQGAYTCEAINT   64 (78)
T ss_pred             CEEEEECCCEEEEEECCCChH-HCEEEEEEEEec
Confidence            444444456678999999999 999999999986


No 32 
>KOG4222|consensus
Probab=98.55  E-value=1.3e-07  Score=68.96  Aligned_cols=74  Identities=24%  Similarity=0.372  Sum_probs=58.7

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      .|.|.+++.. |+|.|.|.+.|..+..  .+....|+|+.+|..  +.......+.+|..+.+.|.+ .|.|.|+++|.+
T Consensus       188 ~LlIsnvrks-D~GtY~CVatNmvG~R--eS~~A~lsv~e~P~f--~~rp~~~~v~~g~~~~f~c~v-~GdP~P~Vrwkk  261 (1281)
T KOG4222|consen  188 NLLISNVRKS-DEGTYACVATNMVGER--ESIPARLSVQEKPWF--WKRPKDLAVLVGAAAEFDCRV-GGDPQPTVRWKK  261 (1281)
T ss_pred             cEEEeccccC-CCceeeeeeccccccc--ccccceeeeccCCcc--ccccccceeeccccccccccc-CCCCCCceeeec
Confidence            4999999999 9999999999975433  333467888866653  322356789999999999998 589999999976


No 33 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=98.54  E-value=6.3e-07  Score=47.86  Aligned_cols=44  Identities=14%  Similarity=0.145  Sum_probs=31.7

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      ++......+...|.|.++... |+|.|+|.+.|.   .+..+..+.|.
T Consensus        42 r~~~~~~~~~~~L~I~~~~~~-D~G~Y~c~a~N~---~G~~~~~~~l~   85 (86)
T cd05894          42 RVRVESYKDLSSFVIEGAERE-DEGVYTITVTNP---VGEDHASLFVK   85 (86)
T ss_pred             eEEEEEcCCeEEEEECCCccC-cCEEEEEEEEeC---CCcEEEEEEEE
Confidence            455444455678999999999 999999999996   33444444443


No 34 
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=98.53  E-value=5.3e-07  Score=49.20  Aligned_cols=43  Identities=21%  Similarity=0.376  Sum_probs=31.4

Q ss_pred             EeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866           9 YRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus         9 ~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      +....+.++|+|++++.+ |+|.|+|.+....  .......+.|.|
T Consensus        54 ~~~~~~~~sL~I~~~~~~-DsG~Y~c~v~~~~--~~~~~~~f~L~v   96 (97)
T cd05775          54 VNFSQNDYSLQISNLKME-DAGSYRAEINTKN--GVTITKEFTLHI   96 (97)
T ss_pred             EEecCCceeEEECCCchH-HCEEEEEEEEcCC--CCeEEEEEEEEe
Confidence            344566789999999999 9999999999853  233344455554


No 35 
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=98.52  E-value=6e-07  Score=49.55  Aligned_cols=41  Identities=22%  Similarity=0.498  Sum_probs=32.1

Q ss_pred             CCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          11 PDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        11 ~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ...++++|+|++++.+ |+|.|+|.+.+.   .......+.|.|.
T Consensus        63 ~~~~~~sL~I~~v~~s-D~G~Y~C~v~~~---~~~~~~~v~L~V~  103 (106)
T cd05714          63 ADPGDASLVITDLRLE-DSGRYRCEVIDG---IEDEQDTVELEVR  103 (106)
T ss_pred             CCCCcceEEECCCCHH-HCEEEEEEEEcC---CCceEEEEEEEEE
Confidence            4567899999999999 999999999873   3444555666653


No 36 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=98.51  E-value=7.1e-07  Score=48.24  Aligned_cols=43  Identities=16%  Similarity=0.276  Sum_probs=30.7

Q ss_pred             EEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866           7 IDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus         7 ~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      +..........|+|.+++.+ |+|.|+|.+.|..   +..+..+.|.
T Consensus        53 ~~~~~~~~~~~L~I~~v~~~-D~G~Y~C~a~N~~---G~~~~s~~l~   95 (96)
T cd05732          53 IVVRGHARVSSLTLKDVQLT-DAGRYDCEASNRI---GGDQQSMYLE   95 (96)
T ss_pred             EEEeCCccEEEEEECcCCcC-cCEEeEEEEEeCC---CCcEEEEEEe
Confidence            33333445678999999999 9999999999963   3344444444


No 37 
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=98.50  E-value=1e-06  Score=46.83  Aligned_cols=40  Identities=25%  Similarity=0.384  Sum_probs=30.4

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ...+|+|.+++.+ |+|.|.|.+.+... ....+..+.|+|+
T Consensus        44 ~~s~L~I~~~~~~-DsG~Y~C~a~n~~~-~~~~~~sv~i~V~   83 (84)
T cd05861          44 LRSTLTFPHATVE-DSGTYECAAHESTQ-DQKAFKKVNITVH   83 (84)
T ss_pred             EEEEEEECCCCcC-CCEEEEEEEEECcc-CcceeEEEEEEEe
Confidence            3568999999999 99999999987522 1244666777765


No 38 
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=98.49  E-value=5.6e-07  Score=50.48  Aligned_cols=45  Identities=18%  Similarity=0.274  Sum_probs=32.6

Q ss_pred             EEEEeC---CCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866           6 IIDYRP---DSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus         6 ~~~~~~---~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      |+.+..   ..++++|+|++++.+ |+|.|+|.+..   +....+..+.|.|
T Consensus        61 R~sl~~~~~~~~~asL~I~nl~~s-DsG~Y~C~V~~---g~~~~~~~v~l~v  108 (112)
T cd05900          61 RVSLPNYPAIPSDATLEITELRSN-DSGTYRCEVMH---GIEDNYDTVEVQV  108 (112)
T ss_pred             eEEecccCCCCCCcEEEEeecccc-cCEEEEEEEec---CCCCceeEEEEEE
Confidence            555543   568899999999999 99999999985   2334444444444


No 39 
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=98.48  E-value=9.8e-07  Score=48.19  Aligned_cols=46  Identities=22%  Similarity=0.224  Sum_probs=32.4

Q ss_pred             eEEEEeC-CCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866           5 EIIDYRP-DSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus         5 ~~~~~~~-~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      .|+.+.. ...+.+|+|.|++.+ |+|.|+|.+.+.    +..+....+.|.
T Consensus        48 ~Rv~f~~~~~~d~sI~i~nvt~~-D~G~Y~C~~~t~----P~g~~~~~i~~~   94 (96)
T cd05889          48 GRVYFLNSTREDMSLSFNNATEE-DVGLYCCSLVTY----PQGSWEKVIEVV   94 (96)
T ss_pred             CeEEEecCCCCccEEEEcCCCcc-cCEEEEEEEEeC----CCCCeEEEEEEE
Confidence            4555542 235788999999999 999999999984    333444455543


No 40 
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=98.47  E-value=6.7e-07  Score=48.71  Aligned_cols=26  Identities=23%  Similarity=0.503  Sum_probs=23.4

Q ss_pred             CCCeEEEEEccceeeccCeEEEEEEEE
Q psy5866          12 DSGRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        12 ~~~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      ..+.++|+|+++..+ |+|.|+|.+..
T Consensus        58 ~~~~~~L~I~nV~~~-D~G~YtC~~~t   83 (95)
T cd05882          58 TPTELIISISNVQLS-DEGEYTCSIFT   83 (95)
T ss_pred             CCceEEEEECCCCcc-cCEEEEEEEEe
Confidence            345789999999999 99999999987


No 41 
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=98.46  E-value=8.9e-07  Score=48.16  Aligned_cols=33  Identities=27%  Similarity=0.511  Sum_probs=26.3

Q ss_pred             EEEE-eCCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866           6 IIDY-RPDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus         6 ~~~~-~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      |+.+ ....+.++|+|.+++.+ |+|.|+|.+.+.
T Consensus        51 r~~~~~~~~~~~sL~I~~v~~~-DsG~Y~C~~~t~   84 (95)
T cd07701          51 RIELVRASWHELSISISDVSLS-DEGQYTCSLFTM   84 (95)
T ss_pred             CEEEEECCCCcEEEEECcCCcc-cCEEEEEEeEee
Confidence            4443 33456789999999999 999999999984


No 42 
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=98.45  E-value=1.1e-06  Score=49.16  Aligned_cols=47  Identities=13%  Similarity=0.296  Sum_probs=35.8

Q ss_pred             eEEEEe---CCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866           5 EIIDYR---PDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus         5 ~~~~~~---~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      -|+.+.   ...++.+|+|.+++.+ |+|.|.|.+...   ....+..+.|.|.
T Consensus        58 gRvsl~~~~~~~~~asL~i~nv~~~-D~G~Y~C~v~~g---~~~~~~~v~L~V~  107 (110)
T cd05902          58 GRVSLPGYPKNRYNASLVLSRLRYS-DSGTYRCEVVLG---INDEQDTVPLEVT  107 (110)
T ss_pred             cEEEeecCCCCCceEEEEECCCCHH-HCEEEEEEEEEC---CcccEEEEEEEEE
Confidence            455553   3457899999999999 999999999972   4566666777664


No 43 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=98.45  E-value=1.1e-06  Score=44.85  Aligned_cols=38  Identities=11%  Similarity=0.142  Sum_probs=28.4

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ....|.|.++..+ |+|.|+|.+.|.   .+..+..+.+.|+
T Consensus        29 ~~~~L~i~~v~~~-D~G~YtC~a~N~---~g~~~~~~~~~l~   66 (67)
T cd05863          29 SQHSLQIKDVTEA-SAGTYTLVLWNS---AAGLEKRISLELI   66 (67)
T ss_pred             CcCEEEECCCCHH-HCEEEEEEEEEC---CccEEEEEEEEEE
Confidence            3457999999999 999999999985   3444444555543


No 44 
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=98.44  E-value=8.5e-07  Score=48.01  Aligned_cols=27  Identities=30%  Similarity=0.635  Sum_probs=23.8

Q ss_pred             CCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          12 DSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        12 ~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..+.++|+|.+++.+ |+|.|+|.+.+.
T Consensus        58 ~~~~~~L~I~~v~~~-DsG~Y~C~~~~~   84 (95)
T cd05717          58 SANELSISISNVSLS-DEGRYTCSLYTM   84 (95)
T ss_pred             CCCeeEEEEccCCcc-cCEEEEEEEecC
Confidence            445789999999999 999999999874


No 45 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=98.43  E-value=1.3e-06  Score=45.40  Aligned_cols=37  Identities=27%  Similarity=0.287  Sum_probs=28.7

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      .+..+|.|.+++.. |+|.|+|.+.|.   .+..+..+.|.
T Consensus        38 ~~~~~L~I~~~~~~-D~G~Y~C~a~N~---~G~~~~~~~l~   74 (75)
T cd05744          38 CGRICLLIQNANKE-DAGWYTVSAVNE---AGVVSCNARLD   74 (75)
T ss_pred             CCeEEEEECCCCcc-cCEEEEEEEEcC---CCcEEEEEEEe
Confidence            45668999999999 999999999996   34444445554


No 46 
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.43  E-value=1.5e-06  Score=45.00  Aligned_cols=34  Identities=26%  Similarity=0.401  Sum_probs=27.6

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .|.|.+++.+ |+|.|+|.+.|.   .+..+..+.|.|
T Consensus        41 ~L~I~~~~~~-D~G~Y~C~A~N~---~G~~~~~~~l~V   74 (75)
T cd05763          41 VFFIVDVKIE-DTGVYSCTAQNT---AGSISANATLTV   74 (75)
T ss_pred             EEEEeeCCcc-cCEEEEEEEEcC---CCEEEeeEEEEE
Confidence            6999999999 999999999985   345555666665


No 47 
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=98.41  E-value=1.3e-06  Score=49.12  Aligned_cols=30  Identities=30%  Similarity=0.659  Sum_probs=25.9

Q ss_pred             eCCCCeEEEEEccceeeccCeEEEEEEEECC
Q psy5866          10 RPDSGRYDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        10 ~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      +...++++|+|.+++.+ |+|.|.|.+.+..
T Consensus        74 ~~~~~~~sL~I~~v~~~-D~G~Y~C~v~~~~  103 (116)
T cd05715          74 NPSRKDASIVIHNLQFT-DNGTYTCDVKNPP  103 (116)
T ss_pred             CCcCCeeEEEEeeCCcc-cCEEEEEEEEeCC
Confidence            34566799999999999 9999999999853


No 48 
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=98.41  E-value=1.9e-06  Score=46.93  Aligned_cols=42  Identities=21%  Similarity=0.320  Sum_probs=32.3

Q ss_pred             eCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          10 RPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        10 ~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ....+..+|+|++++.+ |+|.|.|.+....  ....+..+.|+|
T Consensus        55 ~~~~~~~sL~I~nv~~~-D~G~Y~C~~~~~p--~g~~~~~~~L~v   96 (97)
T cd05846          55 SLGLNSTSITIWNVTLE-DEGCYKCIFNTFP--DGSKSGTMCLTV   96 (97)
T ss_pred             CCCCCccEEEEeCCcee-eeEEEEEEEEeCC--CCCeeeEEEEEE
Confidence            34456789999999999 9999999998753  244555566766


No 49 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=98.40  E-value=1.4e-06  Score=46.97  Aligned_cols=25  Identities=32%  Similarity=0.365  Sum_probs=22.6

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      +..+|.|.+++.+ |+|.|+|.+.|.
T Consensus        56 ~~~~L~I~~v~~~-D~G~Y~C~a~N~   80 (92)
T cd05737          56 KYASLTIKGVSSE-DSGKYGIVVKNK   80 (92)
T ss_pred             CEEEEEEccCChh-hCEEEEEEEEEC
Confidence            3568999999999 999999999995


No 50 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=98.40  E-value=7.2e-07  Score=47.89  Aligned_cols=35  Identities=26%  Similarity=0.421  Sum_probs=28.3

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..|.|.+++.+ |+|.|+|.+.|.   .+.....+.|.|
T Consensus        55 ~~L~I~~v~~~-D~G~Y~C~A~N~---~G~~~~~a~L~V   89 (90)
T cd05858          55 EVLYLRNVTFE-DAGEYTCLAGNS---IGISHHSAWLTV   89 (90)
T ss_pred             eEEEEccCCHH-HCEEEEEEEEeC---CCcccceEEEEE
Confidence            57999999999 999999999996   344555566665


No 51 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.39  E-value=1.3e-06  Score=45.27  Aligned_cols=33  Identities=18%  Similarity=0.266  Sum_probs=26.2

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      +|.|.+++.+ |+|.|+|.+.|.   .+.....+.|.
T Consensus        40 ~L~I~~v~~~-D~G~Y~C~A~N~---~G~~~~~~~l~   72 (73)
T cd05852          40 SLEILNITKL-DEGSYTCFAENN---RGKANSTGVLS   72 (73)
T ss_pred             EEEECcCChh-HCEEEEEEEECC---CCceeEEEEEE
Confidence            6999999999 999999999996   34444455554


No 52 
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=98.38  E-value=2e-06  Score=47.38  Aligned_cols=45  Identities=20%  Similarity=0.356  Sum_probs=32.5

Q ss_pred             EEEEeC-CCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866           6 IIDYRP-DSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus         6 ~~~~~~-~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      |+.+.. ..+..+|+|.+++.+ |+|.|.|.+.+.   .......+.|.|
T Consensus        57 R~~~~~~~~~~~sL~I~~v~~~-DsG~Y~C~v~~~---~~~~~~~~~l~v  102 (106)
T cd05877          57 RVFLRRAHDLDASLVITDLRLE-DYGRYRCEVIDG---LEDESVVVALRL  102 (106)
T ss_pred             cEEecCCCCCcEEEEEccCChH-HCEEEEEEEEec---ccceEEEEEEEE
Confidence            444432 255789999999999 999999999762   444555566655


No 53 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=98.38  E-value=2e-06  Score=46.77  Aligned_cols=36  Identities=17%  Similarity=0.283  Sum_probs=27.2

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      ....|.|.+++.+ |+|.|+|.+.|.   .+..+..+.|.
T Consensus        61 ~~~~L~I~~v~~~-D~G~Y~C~A~N~---~G~~~~~~~l~   96 (97)
T cd05869          61 RVSSLTLKYIQYT-DAGEYLCTASNT---IGQDSQSMYLE   96 (97)
T ss_pred             cEEEEEEecCccC-cCEEEEEEEecC---CCCeeEEEEEE
Confidence            3457999999999 999999999996   34444444444


No 54 
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=98.38  E-value=2.5e-06  Score=48.13  Aligned_cols=41  Identities=20%  Similarity=0.331  Sum_probs=31.8

Q ss_pred             CCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          11 PDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        11 ~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ...++.+|+|.+++.+ |+|.|.|.+...   .......+.|.|.
T Consensus        74 ~~~g~asL~i~~v~~s-D~G~Y~C~V~~g---~~~~~~~v~L~V~  114 (117)
T cd05901          74 EDQGDASLTIVKLRAS-DAGVYRCEVMHG---IEDTQDTVSLDVS  114 (117)
T ss_pred             CcCCceEEEEcccccc-cCEEEEEEEEEC---CcccEEEEEEEEE
Confidence            3457899999999999 999999999873   4455555666653


No 55 
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=98.37  E-value=1.6e-06  Score=48.72  Aligned_cols=30  Identities=20%  Similarity=0.337  Sum_probs=26.1

Q ss_pred             eCCCCeEEEEEccceeeccCeEEEEEEEECC
Q psy5866          10 RPDSGRYDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        10 ~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      +...++.+|+|.+++++ |+|.|.|.+.+..
T Consensus        73 ~~~~~~~sL~I~~v~~~-D~G~Y~C~v~~~~  102 (115)
T cd05880          73 NIMRRDASILIWQLQPT-DNGTYTCQVKNPP  102 (115)
T ss_pred             CCcCCceEEEEeeCChh-hCEEEEEEEEeCC
Confidence            34567889999999999 9999999999853


No 56 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=98.37  E-value=1.9e-06  Score=46.98  Aligned_cols=37  Identities=22%  Similarity=0.397  Sum_probs=28.9

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..+|.|.+++.+ |+|.|+|.|.|..+  ...+..+.|.|
T Consensus        59 ~~~L~I~~v~~~-D~G~YtC~A~N~~~--g~~~~s~~l~v   95 (96)
T cd05865          59 SSTLTIYNANID-DAGIYKCVVSNEDE--GESEATVNVKI   95 (96)
T ss_pred             ceEEEEeccChh-hCEEEEEEEEcCCC--CcEEEEEEEEE
Confidence            467999999999 99999999999632  44455556655


No 57 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.36  E-value=8.1e-07  Score=45.28  Aligned_cols=34  Identities=21%  Similarity=0.310  Sum_probs=26.0

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      .+|+|.+++.+ |+|.|+|.+.|.   .+..+..+.|.
T Consensus        35 ~~L~I~~v~~~-D~G~Y~C~a~N~---~G~~~~~~~l~   68 (69)
T cd05725          35 KSLKIRNVTAG-DEGSYTCEAENM---VGKIEASASLT   68 (69)
T ss_pred             CEEEECcCChh-HCEEEEEEEEcC---CCcEEEEEEEE
Confidence            46999999999 999999999985   33344444444


No 58 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=98.36  E-value=1.4e-06  Score=44.82  Aligned_cols=37  Identities=24%  Similarity=0.302  Sum_probs=27.4

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ..+|.|.++..+ |+|.|+|.+.|.   .+..+..+.+.|+
T Consensus        34 ~~~L~I~~v~~~-D~G~YtC~a~N~---~g~~~~~~~~~~~   70 (71)
T cd04976          34 GHSLTIKDVTEE-DAGNYTVVLTNK---QAKLEKRLTFTLV   70 (71)
T ss_pred             CCEEEECcCCHH-HCEEEEEEEEcC---CccEEEEEEEEEE
Confidence            357999999999 999999999985   3333444445443


No 59 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=98.35  E-value=6.8e-07  Score=48.02  Aligned_cols=36  Identities=25%  Similarity=0.359  Sum_probs=28.3

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ...|.|.+++.+ |+|.|+|.|.|.   .+.....+.|.|
T Consensus        54 ~~~L~I~~v~~~-D~G~Y~C~A~N~---~G~~~~sa~L~V   89 (90)
T cd04974          54 SEVLYLRNVSFD-DAGEYTCLAGNS---IGPSHHSAWLTV   89 (90)
T ss_pred             cceEEEeccccc-cCcEEEEEeecc---cCcccCCEEEEe
Confidence            357999999999 999999999996   344455566665


No 60 
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.34  E-value=3.5e-06  Score=45.15  Aligned_cols=36  Identities=22%  Similarity=0.233  Sum_probs=29.2

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEEC
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLT   56 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~   56 (98)
                      +|+|.+++.+ |+|.|+|.+.|.   .+.....+.|.|..
T Consensus        48 ~L~I~~v~~~-D~G~Y~C~a~N~---~G~~~~~~~l~V~~   83 (90)
T cd05726          48 DLTITNVQRS-DVGYYICQTLNV---AGSILTKAYLEVTD   83 (90)
T ss_pred             eEEEeeCChh-hCEEEEEEEEcC---CCceEEEEEEEEee
Confidence            6999999999 999999999996   34455567777753


No 61 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.33  E-value=1.6e-06  Score=44.53  Aligned_cols=36  Identities=28%  Similarity=0.457  Sum_probs=27.9

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..+|.|.+++.+ |+|.|+|.+.|.   .+..+..+.|.|
T Consensus        35 ~~~L~I~~v~~~-D~G~Y~C~a~N~---~G~~~~~~~l~V   70 (71)
T cd05876          35 NKTLQLDNVLES-DDGEYVCTAENS---EGSARHHYTVTV   70 (71)
T ss_pred             CCEEEEcccCHH-hCEEEEEEEEcC---CCeEEEEEEEEE
Confidence            457999999999 999999999996   344455555554


No 62 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.33  E-value=1.5e-06  Score=45.46  Aligned_cols=34  Identities=24%  Similarity=0.442  Sum_probs=27.0

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      .+|.|.+++.+ |+|.|+|.+.|.   .+.....+.|.
T Consensus        47 ~~L~I~~~~~~-D~G~Y~C~a~N~---~G~~~~~~~l~   80 (81)
T cd05765          47 GQLVIYNAQPQ-DAGLYTCTARNS---GGLLRANFPLS   80 (81)
T ss_pred             cEEEEccCCcc-cCEEEEEEEecC---CceEEEEEEEe
Confidence            57999999999 999999999995   34455555554


No 63 
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=98.33  E-value=1.8e-06  Score=45.66  Aligned_cols=37  Identities=22%  Similarity=0.372  Sum_probs=27.9

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ...+|+|.+++.+ |+|.|+|.+.+.   ....+.+..+.|
T Consensus        47 ~~s~L~I~~v~~~-DsG~Y~C~a~n~---~~~~~~s~~v~v   83 (84)
T cd05742          47 LSSTLTIPNATLK-DSGTYTCAASSG---TMDQKESTKVNI   83 (84)
T ss_pred             EEEEEEECCCChh-hCEEEEEEEccC---CCceEEEEEEEE
Confidence            3567999999999 999999999985   334444455544


No 64 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=98.32  E-value=4.2e-06  Score=45.15  Aligned_cols=27  Identities=41%  Similarity=0.588  Sum_probs=23.7

Q ss_pred             CCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          12 DSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        12 ~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .....+|+|.+++.+ |+|.|+|.+.|.
T Consensus        53 ~~~~~~L~I~~v~~~-D~G~Y~C~A~N~   79 (92)
T cd04977          53 DDVRSTLTIYNANIE-DAGIYKCVATDA   79 (92)
T ss_pred             CCCEEEEEEecCCcc-cCEEEEEEEEcC
Confidence            345568999999999 999999999995


No 65 
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=98.32  E-value=4.3e-07  Score=49.40  Aligned_cols=27  Identities=33%  Similarity=0.710  Sum_probs=24.6

Q ss_pred             CCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          12 DSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        12 ~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..+.++|+|++++.+ |+|.|.|.+.+.
T Consensus        61 ~~g~~~L~I~~l~~s-DsgtY~C~v~~~   87 (94)
T cd07690          61 DQGSFPLIIKNLKIE-DSDTYICEVEDK   87 (94)
T ss_pred             CCCeEEEEECCCCHH-HCEEEEEEECCc
Confidence            567899999999999 999999999874


No 66 
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=98.30  E-value=3.5e-06  Score=45.32  Aligned_cols=33  Identities=12%  Similarity=0.214  Sum_probs=26.2

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ++.+.......+|.|.++..+ |+|.|+|.+.|.
T Consensus        49 ~~~~~~~~~~~~L~i~~~~~~-D~G~Y~C~a~N~   81 (92)
T cd05747          49 RHQITSTEYKSTFEISKVQMS-DEGNYTVVVENS   81 (92)
T ss_pred             cEEEEEcCCeeEEEECCCCcc-cCEeEEEEEEcC
Confidence            344444444578999999999 999999999985


No 67 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.30  E-value=1.3e-06  Score=45.13  Aligned_cols=34  Identities=26%  Similarity=0.412  Sum_probs=26.5

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      .+|+|.+++.+ |+|.|+|.+.|.   .+..+..+.|.
T Consensus        40 ~~L~I~~v~~~-D~G~Y~C~A~N~---~G~~~~~~~L~   73 (74)
T cd05745          40 GTLRISRVALH-DQGQYECQAVNI---VGSQRTVAQLT   73 (74)
T ss_pred             CeEEEeeCCHH-hCEEEEEEEEeC---CCceeEEEEEe
Confidence            37999999999 999999999995   34444445554


No 68 
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=98.29  E-value=6.4e-06  Score=45.23  Aligned_cols=46  Identities=17%  Similarity=0.320  Sum_probs=33.4

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .+..+...++++|+|.+++.+ |+|.|.|.+...  ..........|.|
T Consensus        69 ~~~~~~~~~~~sL~i~~l~~~-DsG~Y~C~v~~~--~~~~~~~~~~L~V  114 (114)
T PF07686_consen   69 TFSGNGSQNNFSLTIKNLQPS-DSGTYFCQVSTS--NEQSFGNGTKLTV  114 (114)
T ss_dssp             EEEEETTTTEEEEEESSESGG-GEEEEEEEEEES--SEEEEEEEEEEEE
T ss_pred             eeeecccCCeEEEEECCCCcC-cCEEEEEEEEEC--CCCEECCcEEEEC
Confidence            344556678999999999999 999999999984  1244444444443


No 69 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=98.29  E-value=3.6e-06  Score=45.43  Aligned_cols=36  Identities=11%  Similarity=0.233  Sum_probs=29.5

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ..|+|.+++.. |+|.|+|.+.|.   .+.....+.|.|+
T Consensus        58 ~~L~I~~v~~~-D~G~Y~C~a~N~---~G~~~~~~~L~V~   93 (95)
T cd05730          58 SEMTILDVDKL-DEAEYTCIAENK---AGEQEAEIHLKVF   93 (95)
T ss_pred             CEEEECCCChh-hCEEEEEEEEcC---CCeEEEEEEEEEE
Confidence            36999999999 999999999996   4455666777775


No 70 
>KOG4222|consensus
Probab=98.29  E-value=1.6e-06  Score=63.59  Aligned_cols=75  Identities=23%  Similarity=0.347  Sum_probs=60.5

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPDPQISVT   95 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~   95 (98)
                      .+|+|.++... |+|.|.|.+.+.   .+..+....++|+++|..- ..+ .+..+..|..++|.|.+. |.|.|.+.|.
T Consensus       278 qtl~i~r~tp~-deg~y~C~a~n~---vG~l~asa~ltV~apP~f~-kkp-~dq~v~lg~~vt~pc~~~-gnP~PavfW~  350 (1281)
T KOG4222|consen  278 QTLRIDRVTPT-DEGTYVCPAENL---VGGLEASATLTVQAPPSFG-KKP-RDQKVALGGTVTFPCETL-GNPPPAVFWL  350 (1281)
T ss_pred             ccccccccCCC-cccceeeecccc---ccccccccceEEecCcccc-ccc-CccccccCceEEeeeecC-CCCCcceEEe
Confidence            57999999999 999999999986   5666777889998777642 222 345677888999999986 7899999997


Q ss_pred             ec
Q psy5866          96 LQ   97 (98)
Q Consensus        96 ~~   97 (98)
                      +.
T Consensus       351 ke  352 (1281)
T KOG4222|consen  351 KE  352 (1281)
T ss_pred             cc
Confidence            63


No 71 
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=98.28  E-value=5.7e-06  Score=42.88  Aligned_cols=27  Identities=33%  Similarity=0.567  Sum_probs=23.5

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEECC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      ....+|.|.++... |+|.|+|.+.+..
T Consensus        41 ~~~~~L~I~~~~~~-DsG~Y~C~a~N~~   67 (76)
T cd05895          41 KKSSELQISKASLA-DNGEYKCMVSSKL   67 (76)
T ss_pred             CcEEEEEECcCCcc-cCEEEEEEEEeCC
Confidence            34567999999999 9999999999963


No 72 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.28  E-value=2.7e-06  Score=45.36  Aligned_cols=36  Identities=28%  Similarity=0.439  Sum_probs=28.2

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ...|+|.+++.+ |+|.|.|.+.|.   .+.....+.|.|
T Consensus        52 ~~~L~i~~v~~~-D~G~Y~C~a~N~---~G~~~~~~~l~V   87 (88)
T cd04968          52 GAVLKIPNIQFE-DEGTYECEAENI---KGKDTHQGRIYV   87 (88)
T ss_pred             CCEEEECCCCcc-cCEEEEEEEEEC---CCcEEEEEEEEE
Confidence            357999999999 999999999996   344455566655


No 73 
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=98.28  E-value=4.3e-06  Score=44.75  Aligned_cols=23  Identities=26%  Similarity=0.459  Sum_probs=21.7

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ++|+|.+++.+ |+|.|+|++...
T Consensus        57 ~sL~I~~l~~~-DsG~Y~c~v~~~   79 (92)
T cd05741          57 GSLLIQNLTKE-DSGTYTLQIIST   79 (92)
T ss_pred             ceEEEccCCch-hcEEEEEEEEcC
Confidence            78999999999 999999999985


No 74 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=98.28  E-value=3.2e-06  Score=44.11  Aligned_cols=37  Identities=24%  Similarity=0.340  Sum_probs=26.7

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..|.|.+++.+ |+|.|+|.+.|..+ ....+..+.|.|
T Consensus        38 ~~L~I~~~~~~-D~G~Y~C~a~N~~G-~~~s~~~~~l~v   74 (77)
T cd05760          38 RTLTLRSAGPD-DSGLYYCCAHNAFG-SVCSSQNFTLSI   74 (77)
T ss_pred             CEEEEeeCCcc-cCEEEEEEEEeCCC-eEeeCceEEEEE
Confidence            47999999999 99999999999532 122233455554


No 75 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.27  E-value=1.8e-06  Score=44.50  Aligned_cols=33  Identities=21%  Similarity=0.290  Sum_probs=26.3

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      +|.|.+++.+ |+|.|+|.+.|.   .+..+..+.|.
T Consensus        40 ~L~i~~v~~~-D~G~Y~C~a~N~---~G~~~~~~~l~   72 (73)
T cd04969          40 SLEILNVTKS-DEGKYTCFAENF---FGKANSTGSLS   72 (73)
T ss_pred             eEEEccCChh-HCEEEEEEEECC---CCceEEEEEEE
Confidence            6999999999 999999999995   34455555554


No 76 
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=98.27  E-value=2.8e-06  Score=43.28  Aligned_cols=36  Identities=31%  Similarity=0.448  Sum_probs=27.2

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ...|.|.+++.+ |+|.|+|.+.|.   .+..+..+.|.|
T Consensus        35 ~~~L~i~~v~~~-D~G~Y~C~a~N~---~G~~~~~~~l~V   70 (71)
T cd05731          35 NKTLKIDNVSEE-DDGEYRCTASNS---LGSARHTISVTV   70 (71)
T ss_pred             CCEEEECCCCHH-HCEEEEEEEEeC---CceEEEEEEEEE
Confidence            347999999999 999999999995   344444455543


No 77 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=98.26  E-value=3.3e-06  Score=46.46  Aligned_cols=37  Identities=11%  Similarity=0.126  Sum_probs=29.6

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ...|.|.++..+ |+|.|+|.|.|.   .+..+..+.|.|.
T Consensus        64 ~~~L~i~~v~~~-D~G~Ytc~A~N~---~G~~~~t~~L~V~  100 (101)
T cd04975          64 VSELKLVRLKES-EAGTYTFLASNS---DASKSLTFELYVN  100 (101)
T ss_pred             EEEEEEeecCHh-hCeeEEEEEECC---CccEEEEEEEEEE
Confidence            356999999999 999999999996   4555666666664


No 78 
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.26  E-value=3.4e-06  Score=43.40  Aligned_cols=23  Identities=22%  Similarity=0.342  Sum_probs=21.4

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..|.|.++..+ |+|.|+|.+.|.
T Consensus        34 ~~L~I~~v~~~-D~G~YtC~a~N~   56 (70)
T cd05864          34 VHLTIYEVTEK-DAGNYTVVLTNP   56 (70)
T ss_pred             CEEEECcCCHH-HCEEEEEEEEEC
Confidence            46999999999 999999999996


No 79 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=98.26  E-value=4.9e-06  Score=43.92  Aligned_cols=36  Identities=17%  Similarity=0.435  Sum_probs=28.1

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      +.++|.|.++... |+|.|+|.+.|.   .+.....+.|.
T Consensus        49 ~~~~l~i~~~~~~-D~G~Y~C~a~N~---~G~~~~~~~l~   84 (85)
T cd05857          49 QHWSLIMESVVPS-DKGNYTCVVENE---YGSINHTYHLD   84 (85)
T ss_pred             CceEEEEccCCcc-cCEEEEEEEEeC---CCEEEEEEEEE
Confidence            4567999999999 999999999995   34455555554


No 80 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.25  E-value=3.3e-06  Score=43.88  Aligned_cols=35  Identities=17%  Similarity=0.250  Sum_probs=27.2

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .+|.|.+++.+ |+|.|+|.+.|.   .+.....+.|.|
T Consensus        41 ~~L~I~~~~~~-D~G~Y~C~a~N~---~G~~~~~~~l~V   75 (76)
T cd05867          41 GALILTDVQPS-DTAVYQCEARNR---HGNLLANAHVHV   75 (76)
T ss_pred             CEEEECCCChh-hCEEEEEEEECC---CCeEEEEEEEEE
Confidence            36999999999 999999999985   344444555555


No 81 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=98.24  E-value=3.6e-06  Score=45.40  Aligned_cols=37  Identities=24%  Similarity=0.485  Sum_probs=27.8

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..+|+|.+++.+ |+|.|.|.+.|..+  ...+..+.|.|
T Consensus        54 ~~~L~I~~v~~~-D~G~Y~C~a~N~~G--~~~S~~~~L~V   90 (91)
T cd05740          54 NRTLTFNNVTRS-DTGHYQCEASNEVS--NMTSDPYILNV   90 (91)
T ss_pred             CCEEEECcCChh-hCEEEEEEEEcCCC--CEEeeeEEEEe
Confidence            347999999999 99999999999632  23444555554


No 82 
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.24  E-value=3.7e-06  Score=45.02  Aligned_cols=35  Identities=29%  Similarity=0.335  Sum_probs=27.1

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..|.|.+++.+ |+|.|+|.+.|.   .+.....+.|.|
T Consensus        53 ~~L~I~~v~~~-D~G~Y~C~A~N~---~G~~~~~~~l~V   87 (88)
T cd05851          53 AVLKIFNIQPE-DEGTYECEAENI---KGKDKHQARVYV   87 (88)
T ss_pred             CEEEECcCChh-hCEEEEEEEEcC---CCceEEEEEEEE
Confidence            36999999999 999999999996   344444555554


No 83 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=98.23  E-value=3.6e-06  Score=46.30  Aligned_cols=36  Identities=17%  Similarity=0.278  Sum_probs=29.3

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      .+|+|.++..+ |+|.|+|.|.|.   .+..+..+.|.|.
T Consensus        65 s~L~I~~v~~~-D~G~Ytc~A~N~---~g~~~~t~~l~V~  100 (101)
T cd05859          65 SKLKLIRAKEE-DSGLYTALAQNE---DAVKSYTFALQIQ  100 (101)
T ss_pred             cEEEEeeCCHH-HCEEEEEEEEcC---CceEEEEEEEEEE
Confidence            47999999999 999999999996   4556666666664


No 84 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=98.23  E-value=5.4e-06  Score=44.71  Aligned_cols=24  Identities=29%  Similarity=0.432  Sum_probs=21.8

Q ss_pred             eEEEEEccceeeccCeEEEEEEEEC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..+|.|.+++.+ |+|.|+|.+.|.
T Consensus        57 ~~~L~I~~~~~~-D~G~Y~C~a~N~   80 (92)
T cd05891          57 YASLTIKGVTSE-DSGKYSINVKNK   80 (92)
T ss_pred             EEEEEECCCChh-hCEEEEEEEEeC
Confidence            357999999999 999999999985


No 85 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.21  E-value=4.1e-06  Score=43.26  Aligned_cols=35  Identities=23%  Similarity=0.273  Sum_probs=27.8

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..|.|.+++.. |+|.|+|.+.|.   .+.....+.|.|
T Consensus        41 ~~L~i~~v~~~-D~G~Y~C~A~N~---~G~~~~~~~l~V   75 (76)
T cd04978          41 GTLILSNVQPN-DTAVYQCNASNV---HGYLLANAFVHV   75 (76)
T ss_pred             CEEEECCCChh-hCEEEEEEEEcc---CCeEEEeEEEEE
Confidence            46999999999 999999999985   344555566665


No 86 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=98.21  E-value=3.8e-06  Score=43.82  Aligned_cols=26  Identities=27%  Similarity=0.602  Sum_probs=23.0

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .+..+|.|.+++.+ |+|.|+|.+.+.
T Consensus        45 ~~~~~L~i~~v~~~-D~G~Y~C~a~N~   70 (82)
T cd05856          45 KKKWTLSLKNLKPE-DSGKYTCHVSNR   70 (82)
T ss_pred             CceEEEEEccCChh-hCEEEEEEEEcC
Confidence            34578999999999 999999999985


No 87 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.20  E-value=6e-06  Score=42.10  Aligned_cols=23  Identities=26%  Similarity=0.547  Sum_probs=21.2

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..|.|.+++.. |+|.|+|.+.|.
T Consensus        36 ~~L~I~~~~~~-D~G~Y~C~a~N~   58 (69)
T cd05746          36 GYLAIRDVGVA-DQGRYECVARNT   58 (69)
T ss_pred             CEEEECcCChh-hCEEEEEEEECC
Confidence            36999999999 999999999985


No 88 
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=98.20  E-value=9.3e-06  Score=44.79  Aligned_cols=29  Identities=24%  Similarity=0.356  Sum_probs=25.4

Q ss_pred             eCCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          10 RPDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        10 ~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      +...+.++|+|.+++.+ |+|.|.|.+.+.
T Consensus        64 ~~~~~~~~L~I~~~~~~-DsG~Y~C~~~~~   92 (109)
T cd04983          64 DKSRKSSSLHISAAQLS-DSAVYFCALSES   92 (109)
T ss_pred             cccCCEEEEEECCCCHH-HCEEEEEEEecC
Confidence            34568999999999999 999999999864


No 89 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=98.20  E-value=1e-05  Score=43.35  Aligned_cols=37  Identities=22%  Similarity=0.267  Sum_probs=27.8

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      .....|+|.++... |.|.|+|.+.|.   .+.....+.|+
T Consensus        53 ~~~~~L~I~~v~~~-D~g~Y~C~A~N~---~G~~~~~~~L~   89 (90)
T cd04972          53 VDIYNLQLSNITSE-TQTTVTCTAENP---VGQANVSVQVT   89 (90)
T ss_pred             CCEEEEEEecCCcc-cCEEEEEEEECC---CCceeEEEEEe
Confidence            33568999999999 999999999986   33444445554


No 90 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.18  E-value=1e-05  Score=41.44  Aligned_cols=33  Identities=12%  Similarity=0.166  Sum_probs=25.5

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      .|.|.+++.+ |+|.|+|.+.|.   .+.....+.|.
T Consensus        38 ~l~i~~v~~~-D~G~Y~C~A~N~---~G~~~~~~~L~   70 (71)
T cd05723          38 NLQVLGLVKS-DEGFYQCIAEND---VGNVQASAQLI   70 (71)
T ss_pred             CEEEEcCCcc-cCEEEEEEEEcC---CCEEEEEEEEE
Confidence            4888899999 999999999995   34455555554


No 91 
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=98.18  E-value=5.4e-06  Score=42.95  Aligned_cols=35  Identities=29%  Similarity=0.546  Sum_probs=27.6

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..|.|.++... |.|.|+|.+.+.   .+.....+.|.|
T Consensus        39 ~~l~I~~~~~~-D~G~Y~C~a~N~---~G~~~~~~~l~V   73 (76)
T cd05736          39 SELHISNVRYE-DTGAYTCIAKNE---AGVDEDISSLFV   73 (76)
T ss_pred             CEEEECcCCcc-cCEEEEEEEEcC---CCCcceEEEEEE
Confidence            46999999999 999999999985   344455556655


No 92 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.17  E-value=5.7e-06  Score=43.05  Aligned_cols=34  Identities=15%  Similarity=0.197  Sum_probs=27.9

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .|.|.+++.. |+|.|+|.+.|.   .+.....+.|.|
T Consensus        42 ~l~i~~v~~~-D~G~Y~C~A~N~---~G~~~~~~~l~v   75 (76)
T cd05868          42 TIIFSKVQER-SSAVYQCNASNE---YGYLLANAFVNV   75 (76)
T ss_pred             EEEECCCCHh-hCEEEEEEEEcC---CCEEEEEEEEEe
Confidence            6899999999 999999999996   455556666665


No 93 
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=98.17  E-value=1.1e-05  Score=45.57  Aligned_cols=32  Identities=28%  Similarity=0.366  Sum_probs=27.6

Q ss_pred             EEEE--eCCCCeEEEEEccceeeccCeEEEEEEEE
Q psy5866           6 IIDY--RPDSGRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus         6 ~~~~--~~~~~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      |+.+  +...++++|+|.+++.+ |+|.|.|++..
T Consensus        68 R~~~~~~~~~~~~sL~I~~l~~~-Dsg~Y~C~~~~  101 (119)
T cd05712          68 RFRLLGDLGKKNCSLLISDAQPE-DSGKYFFRVEL  101 (119)
T ss_pred             cEEEecCCCCCEEEEEEccCChh-hCeEEEEEEEc
Confidence            5555  56788899999999999 99999999876


No 94 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=98.15  E-value=9.2e-06  Score=42.54  Aligned_cols=22  Identities=23%  Similarity=0.483  Sum_probs=20.5

Q ss_pred             EEEEccceeeccCeEEEEEEEEC
Q psy5866          17 DLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      +|.|.+++.+ |+|.|+|.+.+.
T Consensus        46 ~L~I~~~~~~-DsG~Y~C~a~n~   67 (79)
T cd04973          46 EVQIKDAVPR-DSGLYACVTSSP   67 (79)
T ss_pred             EEEECCCChh-hCEEEEEEEeCC
Confidence            6999999999 999999999874


No 95 
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=98.15  E-value=8.8e-06  Score=43.41  Aligned_cols=37  Identities=24%  Similarity=0.399  Sum_probs=28.7

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ...|.|.+++.. |+|.|+|.+.+.   .........|.|+
T Consensus        49 ~s~L~I~~~~~~-DsG~Y~C~a~n~---~~~~~~~t~~~V~   85 (86)
T cd05862          49 SSTLTIENVTLS-DLGRYTCTASSG---QMIAKNSTIVIVH   85 (86)
T ss_pred             eeEEEEecCCcc-cCEEEEEEEeec---ceEecccEEEEEe
Confidence            457999999999 999999999984   4455555566554


No 96 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=98.14  E-value=1.2e-05  Score=42.43  Aligned_cols=24  Identities=17%  Similarity=0.198  Sum_probs=22.1

Q ss_pred             eEEEEEccceeeccCeEEEEEEEEC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ...|.|.+++.. |+|.|+|.|.|.
T Consensus        45 ~~~L~I~~~~~~-D~G~YtC~A~N~   68 (81)
T cd04971          45 HGCLQFDNPTHV-NNGNYTLVASNE   68 (81)
T ss_pred             EEEEEECCCCcc-cCeEEEEEEEeC
Confidence            457999999999 999999999996


No 97 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.12  E-value=6.8e-06  Score=42.55  Aligned_cols=23  Identities=30%  Similarity=0.512  Sum_probs=21.3

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .+|.|.+++.+ |+|.|+|.+.+.
T Consensus        36 ~~L~I~~v~~~-D~G~YtC~a~~~   58 (72)
T cd07702          36 YSLVIKDVTEE-DAGIYTILLGIK   58 (72)
T ss_pred             CEEEECcCCHH-HCEEEEEEEEcc
Confidence            37999999999 999999999985


No 98 
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=98.10  E-value=1.8e-05  Score=40.64  Aligned_cols=26  Identities=23%  Similarity=0.542  Sum_probs=23.1

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .....|.|.+++.+ |+|.|+|.+.|.
T Consensus        40 ~~~~~L~I~~~~~~-D~G~Y~C~a~N~   65 (75)
T cd05750          40 KKNSELQINKAKLA-DSGEYTCVVENI   65 (75)
T ss_pred             CceEEEEEccCCcc-cCeEEEEEEEEc
Confidence            34568999999999 999999999996


No 99 
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=98.10  E-value=1.9e-05  Score=41.65  Aligned_cols=25  Identities=20%  Similarity=0.151  Sum_probs=22.5

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ....|.|.++... |+|.|+|.|.|.
T Consensus        42 ~~~~L~i~~~~~~-D~G~YtC~A~N~   66 (79)
T cd05855          42 YHGCLQLDNPTHL-NNGIYTLVAKNE   66 (79)
T ss_pred             eEEEEEECCCCcc-cCEEEEEEEEcC
Confidence            3457999999999 999999999996


No 100
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=98.09  E-value=2.7e-05  Score=43.30  Aligned_cols=40  Identities=23%  Similarity=0.182  Sum_probs=30.4

Q ss_pred             eEEEEEccce-eeccCeEEEEEEEECCCCCeeeEeeEEEEEECCC
Q psy5866          15 RYDLIISNAS-FERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPP   58 (98)
Q Consensus        15 ~~~l~I~~v~-~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~   58 (98)
                      ...|+|.+++ .+ |.|.|+|.|.|.   .+..+..+.|.|..+|
T Consensus        68 ~s~L~I~~v~~~~-D~G~Y~C~A~N~---~G~~~~~i~L~~~~~p  108 (109)
T cd05773          68 TSILTIINVSAAL-DYALFTCTAHNS---LGEDSLDIQLVSTSRP  108 (109)
T ss_pred             eeEEEECcCCccC-CCEEEEEEEEeC---CccCcEEEEEEecCCC
Confidence            3579999997 58 999999999996   3445666777776444


No 101
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.09  E-value=1e-05  Score=44.04  Aligned_cols=36  Identities=31%  Similarity=0.461  Sum_probs=29.1

Q ss_pred             CEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          61 PKISPGANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        61 p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      |.|....+..+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus         3 p~i~~~~~~~~~~G~~v~l~C~~~-G~P~p~i~W~k~   38 (98)
T cd05870           3 PHIIQLKNETTVENGAATLSCKAE-GEPIPEITWKRA   38 (98)
T ss_pred             CEEEeeccEEEcCCCcEEEEEecc-cCCCCeEEEEEC
Confidence            334333567899999999999986 899999999984


No 102
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.06  E-value=9e-06  Score=41.85  Aligned_cols=33  Identities=21%  Similarity=0.300  Sum_probs=25.4

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      +|.|.++..+ |+|.|+|.+.|.   .+..+..+.|.
T Consensus        41 ~L~i~~~~~~-D~G~Y~C~a~N~---~G~~~~~~~l~   73 (74)
T cd05764          41 TLDILITTVK-DTGSFTCIASNA---AGEATATVELH   73 (74)
T ss_pred             EEEEEECChh-hCEEEEEEEECC---CCeEEEEEEEE
Confidence            6899999999 999999999996   33444444444


No 103
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.06  E-value=1e-05  Score=44.21  Aligned_cols=27  Identities=22%  Similarity=0.429  Sum_probs=24.3

Q ss_pred             CCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          12 DSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        12 ~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..+.++|+|.+++.+ |+|.|.|.+.+.
T Consensus        63 ~~~~~sL~I~~v~~~-D~G~Y~C~v~~~   89 (105)
T cd00099          63 SKSSFTLTISSLQPE-DSAVYYCAVSLS   89 (105)
T ss_pred             cCCEEEEEECCCCHH-HCEEEEEEEecC
Confidence            347899999999999 999999999874


No 104
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=98.05  E-value=1e-05  Score=43.88  Aligned_cols=34  Identities=21%  Similarity=0.291  Sum_probs=25.8

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      ..|.|.++..+ |+|.|+|.+.+.   .......+.|.
T Consensus        60 ~~L~I~~~~~~-DsG~Y~C~~~N~---~g~~~~~~~L~   93 (94)
T cd05756          60 DLLWFLPAALE-DSGLYTCVVRNS---TYCMKVSISLT   93 (94)
T ss_pred             CeEEEccCCcc-cCeEEEEEEcCC---CccEEEEEEEE
Confidence            46999999999 999999999985   33333344444


No 105
>smart00406 IGv Immunoglobulin V-Type.
Probab=98.03  E-value=7.7e-06  Score=42.41  Aligned_cols=31  Identities=26%  Similarity=0.451  Sum_probs=24.7

Q ss_pred             eEEEEe--CCCCeEEEEEccceeeccCeEEEEEE
Q psy5866           5 EIIDYR--PDSGRYDLIISNASFERDNGKFECRL   36 (98)
Q Consensus         5 ~~~~~~--~~~~~~~l~I~~v~~~~d~G~y~C~~   36 (98)
                      .|+.+.  ...+.++|+|.+++.+ |+|.|.|.+
T Consensus        49 ~R~~~~~~~~~~~~~L~i~~~~~~-D~G~Y~C~v   81 (81)
T smart00406       49 GRVTISKDTSKNDVSLTISNLRVE-DTGTYYCAV   81 (81)
T ss_pred             CcEEEEecCcCCEEEEEEcCCCHH-HCEEEEEcC
Confidence            344443  3478899999999999 999999964


No 106
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.03  E-value=1.4e-05  Score=41.71  Aligned_cols=24  Identities=25%  Similarity=0.430  Sum_probs=21.8

Q ss_pred             EEEEEccceeeccCeEEEEEEEECC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      .+|.|.++..+ |+|.|+|.+.|..
T Consensus        44 ~~L~I~~v~~~-D~G~Y~C~a~N~~   67 (79)
T cd05734          44 GSLLIKHVLEE-DSGYYLCKVSNDV   67 (79)
T ss_pred             CeEEECcCCcc-cCEEEEEEEEeCC
Confidence            57999999999 9999999999963


No 107
>PHA03269 envelope glycoprotein C; Provisional
Probab=98.00  E-value=0.00014  Score=49.68  Aligned_cols=83  Identities=14%  Similarity=0.191  Sum_probs=60.9

Q ss_pred             eCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCC
Q psy5866          10 RPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPD   89 (98)
Q Consensus        10 ~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~   89 (98)
                      ....+.+.|.|..++.. ++|.|+=++.+.+.+.......+.+.++.+|.. .+   ....+.+|+.+..+|.+..-+|.
T Consensus       283 ~a~p~~~pL~I~sltaA-TeGvY~Wrv~~~~n~t~~~~~~VtV~~yr~PsV-sV---~p~PVL~Ge~YkAtC~vA~YYPp  357 (566)
T PHA03269        283 RKTTSDFSLHILSLDAS-TEGTYIWRVIHTANKNVINEHHITVMSYKRPNI-TV---IGDPVLLGNPYAAYCKVNKYYPP  357 (566)
T ss_pred             CCCCCccceEEeecccc-cCceEEEEEecCCCCceeeeeEEEEEEecCCCc-cc---cCCccccCCCceEEEEeeeecCC
Confidence            34456788999999999 999998777654333455556667777766532 22   33578899999999999877774


Q ss_pred             --CeEEEEec
Q psy5866          90 --PQISVTLQ   97 (98)
Q Consensus        90 --~~~~W~~~   97 (98)
                        ..++|+++
T Consensus       358 ~SvrlrWf~n  367 (566)
T PHA03269        358 HSVIVKWTSN  367 (566)
T ss_pred             CceEEEEEeC
Confidence              46899976


No 108
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=97.99  E-value=2.9e-05  Score=42.01  Aligned_cols=25  Identities=32%  Similarity=0.610  Sum_probs=22.1

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      ...|.|.++..+ |+|.|+|.+.+..
T Consensus        51 ~~~L~I~~v~~~-DsG~YtC~~~n~~   75 (92)
T cd05757          51 GSKLLIQNVTEE-DAGNYTCKLTFTH   75 (92)
T ss_pred             CCEEEEeeCChh-hCEEEEEEEEecC
Confidence            347999999999 9999999999863


No 109
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=97.96  E-value=2.6e-05  Score=41.69  Aligned_cols=30  Identities=27%  Similarity=0.429  Sum_probs=26.5

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      .+..+.+|+.+.|.|.+. |.|.|.++|+++
T Consensus         9 ~~~~~~~G~~v~l~C~~~-G~P~P~v~W~k~   38 (88)
T cd05851           9 KDTYALKGQNVTLECFAL-GNPVPVIRWRKI   38 (88)
T ss_pred             ccEEEeCCCcEEEEEEec-ccCCCEEEEEEC
Confidence            456788999999999985 899999999985


No 110
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=97.95  E-value=2e-05  Score=40.75  Aligned_cols=35  Identities=29%  Similarity=0.371  Sum_probs=25.8

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .|.|.+++.+ |+|.|+|.+.|..+  ...+..+.|.|
T Consensus        39 ~L~i~~~~~~-D~G~Y~C~a~N~~G--~~~s~~a~l~v   73 (74)
T cd05738          39 ALQIENSEES-DQGKYECVATNSAG--TRYSAPANLYV   73 (74)
T ss_pred             EEEECCCChh-hCEEEEEEEECCCC--ceEcccEEEEE
Confidence            5999999999 99999999998632  22344445544


No 111
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.94  E-value=1.8e-05  Score=41.93  Aligned_cols=33  Identities=21%  Similarity=0.375  Sum_probs=25.8

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      .|.|.++..+ |+|.|+|.+.|.   .+.....+.|.
T Consensus        52 ~L~i~~~~~~-D~G~Y~C~a~N~---~G~~~~~~~l~   84 (85)
T cd05728          52 DLRITKLSLS-DSGMYQCVAENK---HGTIYASAELA   84 (85)
T ss_pred             EEEEeeCCHH-HCEEEEEEEECC---CCeEEEEEEEE
Confidence            6999999999 999999999985   34444445544


No 112
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=97.91  E-value=0.00011  Score=38.39  Aligned_cols=37  Identities=22%  Similarity=0.474  Sum_probs=27.3

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      ...+.|.|.++..+ |+|.|.|.+.+.   .+.....+.|.
T Consensus        48 ~~~~~l~i~~~~~~-d~g~Y~C~~~n~---~g~~~~~~~l~   84 (85)
T cd05729          48 KKKWTLILESVVPS-DSGKYTCIVENK---YGSINHTYKVD   84 (85)
T ss_pred             CcEEEEEEeECCcc-cCEEEEEEEEEC---CceEEEEEEEe
Confidence            44567999999999 999999999985   33334444443


No 113
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=97.91  E-value=4.4e-05  Score=41.08  Aligned_cols=30  Identities=23%  Similarity=0.526  Sum_probs=26.2

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      .+..+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus         9 ~~~~v~~G~~~~l~C~~~-g~P~p~i~W~k~   38 (100)
T cd07693           9 SDLIVSKGDPATLNCKAE-GRPTPTIQWLKN   38 (100)
T ss_pred             ceeEEcCCCeEEEEeeCC-cCCCCEEEEEEC
Confidence            456888999999999986 789999999985


No 114
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=97.89  E-value=2.6e-05  Score=42.05  Aligned_cols=36  Identities=36%  Similarity=0.511  Sum_probs=28.3

Q ss_pred             CEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          61 PKISPGANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        61 p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      |.|....+..+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus         3 P~i~~~~~~~~~~g~~v~l~C~~~-g~p~p~v~W~~~   38 (96)
T cd05732           3 PKITYLENQTAVELEQITLTCEAE-GDPIPEITWRRA   38 (96)
T ss_pred             ccceecCceeEecCCcEEEEEEEe-EcCCCcEEEEEC
Confidence            334323456788999999999986 789999999875


No 115
>smart00409 IG Immunoglobulin.
Probab=97.89  E-value=9.6e-05  Score=37.90  Aligned_cols=28  Identities=29%  Similarity=0.495  Sum_probs=23.4

Q ss_pred             CCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          11 PDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        11 ~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ......+|.|.+++.. |+|.|.|.+.+.
T Consensus        46 ~~~~~~~l~i~~~~~~-d~G~Y~C~v~~~   73 (86)
T smart00409       46 RSGSNSTLTISNVTPE-DSGTYTCAATNS   73 (86)
T ss_pred             EcCCeeEEEEEeeccc-cCeEEEEEEEcC
Confidence            3333678999999999 999999999964


No 116
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=97.89  E-value=9.6e-05  Score=37.90  Aligned_cols=28  Identities=29%  Similarity=0.495  Sum_probs=23.4

Q ss_pred             CCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          11 PDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        11 ~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ......+|.|.+++.. |+|.|.|.+.+.
T Consensus        46 ~~~~~~~l~i~~~~~~-d~G~Y~C~v~~~   73 (86)
T smart00410       46 RSGSNSTLTISNVTPE-DSGTYTCAATNS   73 (86)
T ss_pred             EcCCeeEEEEEeeccc-cCeEEEEEEEcC
Confidence            3333678999999999 999999999964


No 117
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=97.89  E-value=4.2e-05  Score=41.25  Aligned_cols=37  Identities=19%  Similarity=0.332  Sum_probs=26.8

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      .+|.|+++..+ |+|.|.|.+.+...  ......+.|.|+
T Consensus        53 ~~L~I~~~~~~-DsG~Y~C~a~~~~~--~~~~~~~~l~v~   89 (91)
T cd05871          53 RGLLLRSLQRS-DAGVYTCTAVEHSF--SQTLAKYTLHVI   89 (91)
T ss_pred             CeEEEeeCChh-HCEEEEEEEEccCC--eEEEEEEEEEEe
Confidence            35999999999 99999999986422  222235666664


No 118
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=97.88  E-value=3.4e-05  Score=40.65  Aligned_cols=24  Identities=25%  Similarity=0.457  Sum_probs=21.6

Q ss_pred             EEEEEccceeeccCeEEEEEEEECC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      .+|.|.+++.+ |+|.|+|.+.|..
T Consensus        51 ~~L~I~~~~~~-D~G~Y~C~a~N~~   74 (86)
T cd05724          51 GNLLIAEARKS-DEGTYKCVATNMV   74 (86)
T ss_pred             CEEEEeECCcc-cCEEEEEEEEecc
Confidence            36999999999 9999999999963


No 119
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=97.88  E-value=2.6e-05  Score=42.38  Aligned_cols=33  Identities=21%  Similarity=0.309  Sum_probs=28.2

Q ss_pred             eEEEEeCCCCeEEEEEccceeeccCeEEEEEEEE
Q psy5866           5 EIIDYRPDSGRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus         5 ~~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      .|+......+.++|+|.+++.+ |+|.|.|.+.+
T Consensus        52 ~rf~~~~~~~~~~L~I~~~~~~-Dsg~Y~C~~~~   84 (98)
T cd04984          52 DRFSGSKSGNTASLTISGAQTE-DEADYYCQVWD   84 (98)
T ss_pred             CCEEEEccCCEEEEEECCCChh-hCEEEEEEEcc
Confidence            4666666668899999999999 99999998875


No 120
>KOG3515|consensus
Probab=97.87  E-value=2.4e-05  Score=55.87  Aligned_cols=80  Identities=26%  Similarity=0.357  Sum_probs=54.7

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCC-ceecCCCcEEEEEEcCCCCCCCeEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGAN-PVATEGRAIELVCSTSGGSPDPQISVT   95 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~-~~~~~g~~~~l~C~~~~~~p~~~~~W~   95 (98)
                      .+.+...+.+ +.|.|+|.+.++++.....-....+.|..+.....+..... ....+|+.+.|.|.+.+|+|.+.+.|+
T Consensus       164 ~l~~~v~Rka-~~g~~tC~A~nr~s~~l~~~~~~~i~v~~~~~~~~~~~~~~~qsF~~g~~inlvc~~~gg~P~~~~~w~  242 (741)
T KOG3515|consen  164 LLKQTVSRKA-DNGNYTCPANNRNSPGLSFAKQLTIIVEAPCKGIGITGAQEQQSFTEGQTINLVCNAQGGNPSQQQTWY  242 (741)
T ss_pred             ceeeEEEEec-CCceeEcccccccCccccccceeEeecccccccceecchhhcCcccccceEEEEehhhcCCcchhhhhc
Confidence            4667777788 99999999998644333333333444433333333332222 567889999999999999999999998


Q ss_pred             ec
Q psy5866          96 LQ   97 (98)
Q Consensus        96 ~~   97 (98)
                      ++
T Consensus       243 ~~  244 (741)
T KOG3515|consen  243 KD  244 (741)
T ss_pred             cc
Confidence            65


No 121
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=97.84  E-value=4.3e-05  Score=42.80  Aligned_cols=43  Identities=26%  Similarity=0.407  Sum_probs=34.0

Q ss_pred             EECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCC-CeEEEEec
Q psy5866          54 VLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPD-PQISVTLQ   97 (98)
Q Consensus        54 v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~-~~~~W~~~   97 (98)
                      |.++|..|.+.. .......|+.++|.|.+.+++|. .+++|+++
T Consensus         2 v~~~P~~p~i~~-~~~~~~~g~~~tL~C~a~gF~P~~i~v~W~kn   45 (111)
T cd05772           2 VRAKPSVPVVSG-PSGRANPGQSVNFTCSAHGFSPRDITVKWLKN   45 (111)
T ss_pred             cccCCCCcEeCC-chhccCCCCCEEEEEEEeeEeCCCCEEEEEEC
Confidence            557888888864 34455678889999999998996 68999975


No 122
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=97.83  E-value=3.2e-05  Score=41.95  Aligned_cols=29  Identities=24%  Similarity=0.530  Sum_probs=25.5

Q ss_pred             eCCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          10 RPDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        10 ~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      +...+.++|+|.+++.+ |+|.|.|.+...
T Consensus        58 ~~~~~~~~L~I~~v~~~-DsG~Y~C~~~~~   86 (98)
T cd05716          58 DPDNGVFTVTLNQLRKE-DAGWYWCGVGDD   86 (98)
T ss_pred             cCCCCEEEEEEcCCCHH-HCEEEEEEcccC
Confidence            45577899999999999 999999998864


No 123
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=97.81  E-value=7.3e-05  Score=40.74  Aligned_cols=25  Identities=28%  Similarity=0.515  Sum_probs=21.9

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGS   41 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~   41 (98)
                      ..|.|.+++.+ |+|.|+|.+.+...
T Consensus        55 ~~L~I~~v~~~-D~G~YtC~~~~~~~   79 (95)
T cd05897          55 TYLHIIDVSLN-DSGYYTCKLQFTHE   79 (95)
T ss_pred             CEEEEEEcChh-hCEEEEEEEEEeeC
Confidence            35999999999 99999999998633


No 124
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=97.80  E-value=5.6e-05  Score=42.28  Aligned_cols=34  Identities=24%  Similarity=0.319  Sum_probs=27.8

Q ss_pred             eEEEEe--CCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866           5 EIIDYR--PDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus         5 ~~~~~~--~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .|+.+.  ...+.++|+|.+++.+ |+|.|.|.+...
T Consensus        59 ~R~~~~~~~~~~~~sL~I~~~~~~-Dsg~Y~C~~~~~   94 (116)
T cd07706          59 GRYSVNFQKAQKSISLTISALQLE-DSAKYFCALSTL   94 (116)
T ss_pred             CeEEEEEeccCCEEEEEECCCCHH-HCEEEEEEEECC
Confidence            455543  5567899999999999 999999999863


No 125
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=97.78  E-value=4.9e-05  Score=40.26  Aligned_cols=25  Identities=24%  Similarity=0.490  Sum_probs=22.3

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ....|.|.+++.+ |+|.|+|.+.+.
T Consensus        46 ~~~~l~I~~~~~~-dsG~Y~C~~~~~   70 (83)
T cd05753          46 SNSNLSIPQATLS-DSGSYHCSGIIG   70 (83)
T ss_pred             CCceEEECccCHH-HCEEEEEEEEeC
Confidence            3467999999999 999999999985


No 126
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=97.78  E-value=3.9e-05  Score=42.27  Aligned_cols=32  Identities=19%  Similarity=0.244  Sum_probs=26.8

Q ss_pred             EEEEeCCCCeEEEEEccceeeccCeEEEEEEEE
Q psy5866           6 IIDYRPDSGRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus         6 ~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      ++........++|+|.+++.+ |+|.|.|.+.+
T Consensus        61 r~~~~~~~~~~~L~I~~~~~~-Dsg~Y~Ca~~~   92 (106)
T cd04980          61 RFSGSGSGTDFTLTISRVEPE-DAAVYYCQQYG   92 (106)
T ss_pred             CEEEeccCCEEEEEECCCChH-HCEEEEEEEeC
Confidence            555555567889999999999 99999999865


No 127
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=97.78  E-value=7e-05  Score=39.93  Aligned_cols=36  Identities=28%  Similarity=0.483  Sum_probs=26.7

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      .|.|.+++.+ |+|.|.|.+.+..  .......+.+.|.
T Consensus        52 ~L~I~~~~~~-D~G~Y~C~a~~~~--~~~~~~~~~l~V~   87 (89)
T cd04979          52 GLLIRSVSPA-DAGVYTCQSVEHG--FKQTLATYSLNVL   87 (89)
T ss_pred             CEEEccCCHH-HCEEEEEEEecCc--cceeEeEEEEEEe
Confidence            4899999999 9999999998752  2344444556554


No 128
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=97.76  E-value=0.00016  Score=40.04  Aligned_cols=23  Identities=22%  Similarity=0.332  Sum_probs=21.2

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .+|.|.+++.. |+|.|.|++.+.
T Consensus        70 gSL~I~~v~~~-D~G~Y~~~v~~~   92 (105)
T cd05774          70 GSLLIQNVTQK-DTGFYTLQTITT   92 (105)
T ss_pred             CcEEEecCCcc-cCEEEEEEEEeC
Confidence            37999999999 999999999985


No 129
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=97.76  E-value=5.2e-05  Score=41.79  Aligned_cols=33  Identities=18%  Similarity=0.317  Sum_probs=27.4

Q ss_pred             eEEEEeCCCCeEEEEEccceeeccCeEEEEEEEE
Q psy5866           5 EIIDYRPDSGRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus         5 ~~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      .|+........++|+|.+++.+ |+|.|.|.+..
T Consensus        58 ~rf~~~~~~~~~~L~I~~~~~s-DsgtY~Ca~~~   90 (104)
T cd05720          58 KRFSGSRSSNSFVLTLKNFQKE-NEGYYFCSVAS   90 (104)
T ss_pred             ceEEEEecCCEEEEEECCCCHH-HCEEEEEEEcc
Confidence            4566655568899999999999 99999998764


No 130
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=97.75  E-value=9e-05  Score=39.74  Aligned_cols=22  Identities=36%  Similarity=0.579  Sum_probs=20.4

Q ss_pred             EEEEccceeeccCeEEEEEEEEC
Q psy5866          17 DLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .|.|.+++.+ |+|.|+|.+...
T Consensus        49 ~L~I~nv~~~-DsG~Y~C~a~e~   70 (87)
T cd05873          49 GLLIFNASEA-DAGRYQCLSVEK   70 (87)
T ss_pred             cEEEeCCCHH-HCEEEEEEEEec
Confidence            4999999999 999999999885


No 131
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=97.75  E-value=7.7e-05  Score=41.34  Aligned_cols=34  Identities=21%  Similarity=0.233  Sum_probs=26.6

Q ss_pred             eEEEEeCC-CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866           5 EIIDYRPD-SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus         5 ~~~~~~~~-~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .|+..... ...++|.|.+++.+ |+|.|.|.+...
T Consensus        60 ~r~~~~~~~~~~~~L~I~~~~~~-Dsg~Y~Ca~~~~   94 (110)
T cd05899          60 DRFSASRPSLTRSSLTIKSAEPE-DSAVYLCASSLG   94 (110)
T ss_pred             CceEEECcCCCccEEEECCCChh-hCEEEEEEeeCC
Confidence            34554433 36789999999999 999999998763


No 132
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=97.75  E-value=7e-05  Score=39.57  Aligned_cols=30  Identities=23%  Similarity=0.435  Sum_probs=25.9

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCC-eEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDP-QISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~-~~~W~~~   97 (98)
                      .+..+.+|+.+.|.|.+. |.|.| ++.|+++
T Consensus         6 ~~~~v~~G~~v~l~C~a~-G~P~P~~I~W~k~   36 (81)
T cd05749           6 EDLSVTANTPFNLTCQAV-GPPEPVEILWWQG   36 (81)
T ss_pred             CceEEcCCCCEEEEEEee-eecCCeEEEEEEC
Confidence            346788999999999985 89999 7999975


No 133
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=97.73  E-value=5e-05  Score=39.14  Aligned_cols=24  Identities=33%  Similarity=0.772  Sum_probs=21.4

Q ss_pred             CCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      +|+.+.|.|.+. |.|.|.+.|+++
T Consensus         1 eG~~v~l~C~~~-g~P~p~i~W~k~   24 (74)
T cd05745           1 EGQTVDFLCEAQ-GYPQPVIAWTKG   24 (74)
T ss_pred             CCCeEEEEeECC-EecCCEEEEEEC
Confidence            588999999985 899999999975


No 134
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=97.71  E-value=0.00013  Score=39.62  Aligned_cols=37  Identities=30%  Similarity=0.428  Sum_probs=28.5

Q ss_pred             CCEEeCCCCceecCCCcEEEEEEcCCCCCCC-eEEEEec
Q psy5866          60 PPKISPGANPVATEGRAIELVCSTSGGSPDP-QISVTLQ   97 (98)
Q Consensus        60 ~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~-~~~W~~~   97 (98)
                      +|.|.......+.+|+.+.|.|.+. |.|.| .+.|+++
T Consensus         2 pp~i~~~~~~~~~~G~~v~L~C~~~-g~P~P~~v~W~~~   39 (98)
T cd05758           2 PPIITSEATQYAILGDKGRVECFIF-STPPPDRIVWTWK   39 (98)
T ss_pred             CCeEcCCCcEEEeCCCcEEEEEEEc-ccCCCCEeEEEEC
Confidence            3555433556788999999999996 78888 6999864


No 135
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=97.69  E-value=0.00013  Score=38.37  Aligned_cols=31  Identities=26%  Similarity=0.487  Sum_probs=26.3

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+++.|.|.+..|.|.|.+.|+++
T Consensus         4 ~~~~~~~G~~v~l~C~~~~g~p~p~i~W~k~   34 (86)
T cd05724           4 SDTQVAVGEMAVLECSPPRGHPEPTVSWRKD   34 (86)
T ss_pred             ccEEEeCCCCEEEEEECCCCCCCCEEEEEEC
Confidence            3467889999999999856889999999975


No 136
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=97.68  E-value=0.00014  Score=40.06  Aligned_cols=29  Identities=17%  Similarity=0.352  Sum_probs=25.4

Q ss_pred             ceecCCCcEEEEEEcCCCCCCCe--EEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGSPDPQ--ISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~p~~~--~~W~~~   97 (98)
                      ..+.+|+.++|+|.+.++.|.+.  +.|++.
T Consensus        11 ~~~~eG~~~tL~C~v~g~~P~a~L~i~W~rG   41 (100)
T cd05755          11 SWQPVGKNYTLQCDVPGVAPRQNLTVVLLRG   41 (100)
T ss_pred             CcccCCCcEEEEEEEcCcCCCCcEEEEEeeC
Confidence            45689999999999999999887  699975


No 137
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=97.68  E-value=9.3e-05  Score=39.07  Aligned_cols=23  Identities=26%  Similarity=0.378  Sum_probs=21.2

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..|.|.+++.+ |+|.|.|.+.+.
T Consensus        52 ~~L~I~~v~~~-DsG~Y~C~a~n~   74 (85)
T cd05754          52 GILTIRNVQLS-DAGTYVCTGSNM   74 (85)
T ss_pred             CEEEECCCCHH-HCEEEEEEEecc
Confidence            47999999999 999999999885


No 138
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=97.67  E-value=0.00024  Score=43.09  Aligned_cols=51  Identities=24%  Similarity=0.343  Sum_probs=37.3

Q ss_pred             eEEE-EeCCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECC
Q psy5866           5 EIID-YRPDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTP   57 (98)
Q Consensus         5 ~~~~-~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~   57 (98)
                      .|++ +...-...+|+|.+++++ |+|.|.|.+..-..+ ...+....|+|...
T Consensus        73 ~Rve~mS~s~~~StItIknVt~s-DeGcY~C~F~tfp~G-~~~~gt~CLtVt~~  124 (189)
T PHA02987         73 NKIEYLSKSFNESTILIKNVSLK-DNGCYTCIFNTLLSK-NNEKGVVCLNVTTD  124 (189)
T ss_pred             CeEEEeccCCCcceEEEEeCChh-hCeEEEEEEEecCCC-CCceeEEEEEEEch
Confidence            3666 345555678999999999 999999999885332 25566678888643


No 139
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=97.66  E-value=9.1e-05  Score=39.78  Aligned_cols=29  Identities=31%  Similarity=0.629  Sum_probs=25.5

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus        10 ~v~v~~G~~v~L~C~v~-G~P~p~v~W~k~   38 (92)
T cd05737          10 VVTIMEGKTLNLTCTVF-GDPDPEVSWLKN   38 (92)
T ss_pred             eEEEeCCCcEEEEEEEE-ecCCCeEEEEEC
Confidence            35788999999999985 789999999985


No 140
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=97.65  E-value=4.8e-05  Score=37.86  Aligned_cols=18  Identities=44%  Similarity=0.803  Sum_probs=17.3

Q ss_pred             EEEccceeeccCeEEEEEE
Q psy5866          18 LIISNASFERDNGKFECRL   36 (98)
Q Consensus        18 l~I~~v~~~~d~G~y~C~~   36 (98)
                      |.|.+++.+ |+|.|+|.|
T Consensus        47 L~i~~v~~~-d~G~Y~C~v   64 (64)
T PF00047_consen   47 LTISNVTPE-DSGTYTCVV   64 (64)
T ss_dssp             EEESSCTGG-GTEEEEEEE
T ss_pred             EEEccCCHH-HCEEEEEEC
Confidence            999999999 999999986


No 141
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=97.64  E-value=0.00012  Score=39.18  Aligned_cols=29  Identities=28%  Similarity=0.565  Sum_probs=25.5

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      +..+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus         9 ~~~v~~G~~v~l~C~~~-G~P~p~v~W~~~   37 (90)
T cd04972           9 ATVVYEGGTATIRCTAE-GSPLPKVEWIIA   37 (90)
T ss_pred             CEEEcCCCcEEEEEEEE-EcCCCeEEEEEC
Confidence            45588999999999996 799999999975


No 142
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=97.64  E-value=0.00015  Score=38.90  Aligned_cols=30  Identities=20%  Similarity=0.523  Sum_probs=26.7

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus        11 ~~~~~~~G~~~~L~C~~~-g~P~p~v~W~k~   40 (92)
T cd05747          11 RSLTVSEGESARFSCDVD-GEPAPTVTWMRE   40 (92)
T ss_pred             ccEEEeCCCcEEEEEEEe-ecCCCEEEEEEC
Confidence            467899999999999986 899999999976


No 143
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=97.63  E-value=0.00013  Score=40.30  Aligned_cols=28  Identities=36%  Similarity=0.566  Sum_probs=24.2

Q ss_pred             eCCCCeEEEEEccceeeccCeEEEEEEEE
Q psy5866          10 RPDSGRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        10 ~~~~~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      ......++|+|.+++.+ |+|.|.|....
T Consensus        66 ~~~~~~~~L~I~~~~~~-Dsg~YyCa~~~   93 (107)
T cd07700          66 TSDSSRYRLHINRVKPE-DSGTYFCMTVG   93 (107)
T ss_pred             ECCCCEEEEEECCCCHH-HCEEEEEeEcC
Confidence            45566889999999999 99999999764


No 144
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=97.63  E-value=8.3e-05  Score=40.89  Aligned_cols=31  Identities=23%  Similarity=0.355  Sum_probs=26.4

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+++.|.|.+.+..|+|.+.|+|+
T Consensus        11 ~~~~v~~G~~v~L~c~v~g~~P~p~v~W~Kd   41 (101)
T cd04975          11 TTIFVNLGENLNLVVEVEAYPPPPHINWTYD   41 (101)
T ss_pred             ceEEEECCCCEEEEEEEEecCCCCccEEEeC
Confidence            4568889999999999963389999999986


No 145
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=97.62  E-value=0.00021  Score=38.45  Aligned_cols=28  Identities=18%  Similarity=0.324  Sum_probs=24.4

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      +..+.+|+.+.|.|.+. |. .|.+.|+++
T Consensus        12 ~~~v~~g~~v~l~C~a~-g~-~p~i~W~kn   39 (91)
T cd05740          12 NQPPEDNQPVTLTCEAE-GQ-ATYIWWVNN   39 (91)
T ss_pred             ccccccCCcEEEEEEeC-CC-CCEEEEEEC
Confidence            45899999999999996 66 899999975


No 146
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=97.61  E-value=0.00014  Score=40.64  Aligned_cols=32  Identities=25%  Similarity=0.337  Sum_probs=25.6

Q ss_pred             EEEEeCCC--CeEEEEEccceeeccCeEEEEEEEE
Q psy5866           6 IIDYRPDS--GRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus         6 ~~~~~~~~--~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      |+.+....  ..++|+|.+++.+ |+|.|.|.+..
T Consensus        65 r~~~~~~~~~~~~~L~I~~~~~~-Dsg~Y~C~~~~   98 (116)
T cd04982          65 KFEARKDVGKSTSTLTIQNLEKE-DSATYYCAYWE   98 (116)
T ss_pred             CEEEEEECCCCEEEEEEEECCHH-HCEEEEEEEec
Confidence            44443333  7899999999999 99999999875


No 147
>PHA02633 hypothetical protein; Provisional
Probab=97.60  E-value=0.00035  Score=34.90  Aligned_cols=36  Identities=17%  Similarity=0.324  Sum_probs=28.0

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ..|.|-++..+ |+|+|.|...+.   ..-...++.++|.
T Consensus        18 ~nLwilpa~~s-DSGiYiC~~rn~---t~c~~~si~l~V~   53 (63)
T PHA02633         18 NNMLILNPTQS-DSGIYMCITKNE---TYSDMMKFDLCIC   53 (63)
T ss_pred             ccEEEeccccc-cCcEEEEEEcCC---CeeEEEEEEEEEe
Confidence            46999999999 999999999874   3444555677775


No 148
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=97.59  E-value=4.5e-05  Score=39.99  Aligned_cols=21  Identities=24%  Similarity=0.525  Sum_probs=18.8

Q ss_pred             EEEEEccceeeccCeEEEEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      .+|+|.++ .+ |+|.|+|++.+
T Consensus        47 ~~l~i~~~-~~-dsG~Y~C~a~~   67 (78)
T cd05752          47 NSYRIRAA-NN-DSGEYRCQTQG   67 (78)
T ss_pred             CeEEEeec-cc-CCEEeEEECCC
Confidence            46899999 99 99999999976


No 149
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=97.58  E-value=0.00032  Score=36.98  Aligned_cols=31  Identities=16%  Similarity=0.296  Sum_probs=25.7

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+.++|.|.+..+.|.+.+.|+++
T Consensus         9 ~~~~v~~G~~v~L~C~~~~~~~~~~i~W~~~   39 (85)
T cd05754           9 RSQEVRPGADVSFICRAKSKSPAYTLVWTRV   39 (85)
T ss_pred             CceEEcCCCCEEEEEEcCCCCCCcEEEEEEC
Confidence            3457788999999999875678899999975


No 150
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=97.57  E-value=0.00012  Score=37.34  Aligned_cols=23  Identities=26%  Similarity=0.579  Sum_probs=20.2

Q ss_pred             CCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          74 GRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        74 g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      |+.+.|.|.+. |.|.|.+.|++.
T Consensus         1 G~~v~L~C~a~-G~P~P~v~W~k~   23 (69)
T cd05739           1 GGSVNLTCVAV-GAPMPYVKWMKG   23 (69)
T ss_pred             CCeEEEEEEee-ecCCCEEEEEEC
Confidence            56799999996 899999999874


No 151
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=97.57  E-value=0.00017  Score=37.87  Aligned_cols=28  Identities=14%  Similarity=0.456  Sum_probs=24.2

Q ss_pred             ceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ..+.+|..+.|.|.+. |.|.|.+.|+++
T Consensus         4 ~~v~~G~~~~L~C~~~-g~P~p~i~W~k~   31 (85)
T cd05857           4 HAVPAANTVKFRCPAA-GNPTPTMRWLKN   31 (85)
T ss_pred             EEcCCCCEEEEEEEcC-CCCCCEEEEEEC
Confidence            4577899999999986 789999999986


No 152
>PHA03271 envelope glycoprotein C; Provisional
Probab=97.57  E-value=0.0022  Score=43.37  Aligned_cols=81  Identities=16%  Similarity=0.220  Sum_probs=52.0

Q ss_pred             CCCCeEEEEEccceeeccCeEEEEEEEECC-CCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCC
Q psy5866          11 PDSGRYDLIISNASFERDNGKFECRLKAAG-SGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPD   89 (98)
Q Consensus        11 ~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~-~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~   89 (98)
                      .-.....|.|+++... |+|.|  ++..+. ...........+.+...|....+   ....+.+|+.+..+|.+..-+|+
T Consensus       202 ktt~~m~v~I~svD~~-t~Gy~--~v~~~d~~N~~i~e~~~~~~v~~RPPsVsV---~a~PVL~Ge~YkAtC~vAnYYPP  275 (490)
T PHA03271        202 KTTNTMGVEIRNVDYA-DNGYI--QVIMRDPFNRPLLDKHIYIRVCQRPASVDV---LAPPVLSGENYKASCIVRHFYPP  275 (490)
T ss_pred             cccceeeEEEEEeecc-cceEE--EEEecCCCCCccccceEEEEEEecCCCccc---cCCccccCCCceEEEEeeeecCC
Confidence            3445678999999999 99955  333321 11234444445555433322223   33578899999999999877774


Q ss_pred             --CeEEEEec
Q psy5866          90 --PQISVTLQ   97 (98)
Q Consensus        90 --~~~~W~~~   97 (98)
                        ..++|+++
T Consensus       276 ~SvrlrWf~n  285 (490)
T PHA03271        276 GSVYVSWRQN  285 (490)
T ss_pred             CceEEEEEeC
Confidence              36899975


No 153
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=97.56  E-value=5.9e-05  Score=40.14  Aligned_cols=25  Identities=52%  Similarity=0.925  Sum_probs=21.3

Q ss_pred             CCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      .|+.+.++|.+.+++|+|.++|+.+
T Consensus        13 ~~~~~~~~C~s~~~~P~~~i~W~~~   37 (89)
T PF08205_consen   13 EGEEVTLTCSSSGGYPPPQITWYLD   37 (89)
T ss_dssp             STEEEEEEEEEEEEBS-EEEEEEET
T ss_pred             cceEEEEEEEeCCeECCeEEEEEEC
Confidence            3678999999999999999999865


No 154
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=97.56  E-value=0.00022  Score=37.83  Aligned_cols=30  Identities=30%  Similarity=0.483  Sum_probs=25.7

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus         9 ~~~~~~~g~~v~l~C~~~-g~P~p~v~W~k~   38 (88)
T cd04968           9 KDTYALKGQNVTLECFAL-GNPVPQIKWRKV   38 (88)
T ss_pred             CceEEeCCCcEEEEEEee-EeCCCEEEEEEC
Confidence            446688999999999985 889999999985


No 155
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.55  E-value=0.00015  Score=39.59  Aligned_cols=25  Identities=20%  Similarity=0.476  Sum_probs=22.2

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      +.+|.+++|+.+ |+|.|.|.|.+..
T Consensus        59 ~G~L~fs~v~~~-D~g~Y~C~A~n~~   83 (96)
T cd05727          59 NGNLYIAKVEAS-DRGNYSCFVSSPS   83 (96)
T ss_pred             CCcEEEeecCHh-hCceeEEEEEecc
Confidence            346999999999 9999999999853


No 156
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=97.55  E-value=0.00014  Score=37.83  Aligned_cols=24  Identities=21%  Similarity=0.358  Sum_probs=19.0

Q ss_pred             EEEEEcccee----eccCeEEEEEEEECC
Q psy5866          16 YDLIISNASF----ERDNGKFECRLKAAG   40 (98)
Q Consensus        16 ~~l~I~~v~~----~~d~G~y~C~~~~~~   40 (98)
                      .+|.|.+++.    + |+|.|+|.|.|..
T Consensus        39 g~L~i~~~~~~~~~~-d~G~Y~C~A~N~~   66 (77)
T cd05733          39 GTLVIDNMNGGRAED-YEGEYQCYASNEL   66 (77)
T ss_pred             CEEEEeccCCCCCcC-CCEEEEEEEEcCC
Confidence            4577877753    6 8999999999963


No 157
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.54  E-value=0.0002  Score=39.12  Aligned_cols=31  Identities=23%  Similarity=0.318  Sum_probs=27.6

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+.+.|.|....|.|.+.+.|+++
T Consensus        11 ~~~~v~eG~~~~L~C~pP~g~P~p~~~W~k~   41 (96)
T cd05727          11 DEVKVKEGWGVVLFCDPPPHYPDLSYRWLLN   41 (96)
T ss_pred             CceeeeeCCcEEEeeCCCCCCCCCEEEEEEC
Confidence            3457889999999999999999999999986


No 158
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=97.53  E-value=0.00016  Score=38.48  Aligned_cols=29  Identities=24%  Similarity=0.417  Sum_probs=25.4

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus         4 ~~~v~~G~~v~l~c~~~-G~P~P~v~W~k~   32 (86)
T cd05894           4 TIVVVAGNKLRLDVPIS-GEPAPTVTWSRG   32 (86)
T ss_pred             EEEEEcCCEEEEEeeEe-ecCCCeEEEEEC
Confidence            45778999999999985 899999999975


No 159
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.53  E-value=0.00021  Score=37.85  Aligned_cols=30  Identities=23%  Similarity=0.442  Sum_probs=25.9

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      .+..+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus         7 ~~~~~~~G~~~~l~C~~~-g~p~p~v~W~k~   36 (85)
T cd05728           7 SDTEADIGSSLRWECKAS-GNPRPAYRWLKN   36 (85)
T ss_pred             CccEEcCCCcEEEEEEee-EeCCCEEEEEEC
Confidence            346788999999999985 799999999975


No 160
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=97.52  E-value=0.00029  Score=37.97  Aligned_cols=29  Identities=34%  Similarity=0.604  Sum_probs=24.8

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+.+|+++.|.|.+. |.|.|.+.|+++
T Consensus         8 ~~~~~~g~~v~l~C~v~-g~P~p~i~W~k~   36 (95)
T cd05722           8 DIVAVRGGPVVLNCSAE-GEPPPKIEWKKD   36 (95)
T ss_pred             CeEEcCCCCEEEeeecc-cCCCCEEEEEEC
Confidence            45677899999999986 789999999985


No 161
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=97.50  E-value=0.00052  Score=35.72  Aligned_cols=25  Identities=20%  Similarity=0.308  Sum_probs=18.4

Q ss_pred             EEEEEccce---eeccCeEEEEEEEECC
Q psy5866          16 YDLIISNAS---FERDNGKFECRLKAAG   40 (98)
Q Consensus        16 ~~l~I~~v~---~~~d~G~y~C~~~~~~   40 (98)
                      .+|.|.+++   ..+|+|.|+|.|.|..
T Consensus        39 ~~L~i~~~~~~~~~~d~G~Y~C~A~N~~   66 (77)
T cd05875          39 GTLVIDFSGGGRPEDYEGEYQCFARNNL   66 (77)
T ss_pred             ceEEEeccCCCCCCCCCEEEEEEEEecc
Confidence            468887764   2326999999999963


No 162
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=97.49  E-value=0.00031  Score=38.29  Aligned_cols=30  Identities=17%  Similarity=0.303  Sum_probs=26.6

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+..|+.+.|.|.+. |.|.+++.|+++
T Consensus         8 ~~~~v~~G~~v~l~C~~~-G~p~p~v~W~kd   37 (98)
T cd05762           8 EDMKVRAGESVELFCKVT-GTQPITCTWMKF   37 (98)
T ss_pred             cCEEEECCCEEEEEEEEc-ccCCCceEEEEC
Confidence            457889999999999995 899999999975


No 163
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=97.49  E-value=0.0003  Score=37.99  Aligned_cols=23  Identities=26%  Similarity=0.694  Sum_probs=19.9

Q ss_pred             EEEEccce-eeccCeEEEEEEEECC
Q psy5866          17 DLIISNAS-FERDNGKFECRLKAAG   40 (98)
Q Consensus        17 ~l~I~~v~-~~~d~G~y~C~~~~~~   40 (98)
                      .|.|.++. .. |+|.|+|.|.|..
T Consensus        58 ~L~I~~~~~~~-D~G~Y~C~A~N~~   81 (93)
T cd05849          58 NLVINNPDKYK-DAGRYVCIVSNIY   81 (93)
T ss_pred             EEEECcCCcCC-CCEEEEEEEEeCc
Confidence            68999985 68 9999999999963


No 164
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=97.49  E-value=0.00029  Score=38.24  Aligned_cols=24  Identities=21%  Similarity=0.236  Sum_probs=20.7

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .+|+|.++..+||.|.|.|.|.|.
T Consensus        64 s~L~I~~v~~~d~~G~Y~C~A~N~   87 (98)
T cd05758          64 STLTISNTQESDFQTSYNCTAWNS   87 (98)
T ss_pred             EEEEECCccccccceeEEEEEEcC
Confidence            479999999962599999999996


No 165
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=97.48  E-value=0.00053  Score=35.88  Aligned_cols=30  Identities=17%  Similarity=0.265  Sum_probs=23.9

Q ss_pred             CCceecCCCcEEEEEEcCCCCCC-CeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPD-PQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~-~~~~W~~~   97 (98)
                      +...+.+|+.+.|.|.+. +.|. +.+.|+++
T Consensus         8 ~~~~v~~G~~V~L~C~~~-~~p~~~~~~W~kn   38 (78)
T cd05752           8 PWTTIFQGEKVTLTCNGF-NSPEQNSTQWYHN   38 (78)
T ss_pred             CCeEeeCCCCEEEEEeCC-CCCCCccEEEEEC
Confidence            346788999999999986 4554 57999986


No 166
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=97.48  E-value=0.00017  Score=34.87  Aligned_cols=25  Identities=28%  Similarity=0.567  Sum_probs=21.6

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ....|.|.++... |+|.|.|.+.+.
T Consensus        37 ~~~~L~i~~~~~~-d~G~Y~C~~~n~   61 (63)
T smart00408       37 SGSTLTIKSVSLE-DSGEYTCVAENS   61 (63)
T ss_pred             CCcEEEEeeCCcc-cCEEEEEEEecC
Confidence            3457999999999 999999999863


No 167
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=97.48  E-value=0.00023  Score=38.28  Aligned_cols=30  Identities=27%  Similarity=0.555  Sum_probs=25.9

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+.+.|.|.+. |.|.|.+.|+++
T Consensus         9 ~~v~v~eG~~v~L~C~v~-g~P~p~i~W~k~   38 (92)
T cd05891           9 DVVTIMEGKTLNLTCTVF-GNPDPEVIWFKN   38 (92)
T ss_pred             CcEEEcCCCEEEEEEEEE-EeCCCeEEEEEC
Confidence            346788999999999985 789999999986


No 168
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=97.44  E-value=0.00043  Score=38.30  Aligned_cols=23  Identities=22%  Similarity=0.537  Sum_probs=20.7

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..|.|.++.++ |+|.|.|.+.+.
T Consensus        70 ~~Lwf~Pa~~e-DSG~Y~C~~rN~   92 (104)
T cd05896          70 DSIWFRPAELQ-DSGLYTCVLRNS   92 (104)
T ss_pred             CEEEEEeCChh-hCeEEEEEECCC
Confidence            35999999999 999999999984


No 169
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=97.44  E-value=0.00064  Score=42.63  Aligned_cols=23  Identities=30%  Similarity=0.691  Sum_probs=21.0

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..|.|.+++.+ |+|.|+|.+...
T Consensus       188 ~~L~I~~V~~~-DsG~YtC~a~~~  210 (227)
T PHA02826        188 STLVIKSATHD-DSGIYTCNLRFN  210 (227)
T ss_pred             CEEEECcCCHH-hCEEEEEEEEEe
Confidence            47999999999 999999999874


No 170
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=97.42  E-value=0.00034  Score=37.60  Aligned_cols=29  Identities=31%  Similarity=0.667  Sum_probs=25.2

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+..|+.+.|.|.+. |.|.|.+.|+++
T Consensus        12 ~~~~~~G~~v~L~C~~~-g~P~p~v~W~k~   40 (95)
T cd05730          12 NATANLGQSVTLACDAD-GFPEPTMTWTKD   40 (95)
T ss_pred             ceEEeCCCCEEEEEecc-EeCCCEEEEEEC
Confidence            35688999999999985 799999999975


No 171
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=97.40  E-value=0.00026  Score=38.24  Aligned_cols=24  Identities=21%  Similarity=0.445  Sum_probs=21.2

Q ss_pred             CCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      +|+.+.|.|.+. |.|.|.++|+++
T Consensus        18 ~g~~v~l~C~~~-G~P~P~i~W~k~   41 (94)
T cd05848          18 DEKKVILNCEAR-GNPVPTYRWLRN   41 (94)
T ss_pred             CCCEEEEEEEee-ecCCCEEEEEEC
Confidence            578899999985 899999999975


No 172
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=97.40  E-value=0.0006  Score=34.76  Aligned_cols=21  Identities=14%  Similarity=0.317  Sum_probs=17.9

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..|+|.++  . |+|.|+|.|.|.
T Consensus        38 ~~L~i~~~--~-d~G~Y~C~A~N~   58 (69)
T cd05739          38 NVLELTNI--Y-ESANYTCVAISS   58 (69)
T ss_pred             cEEEEecc--c-cCeeEEEEEEeC
Confidence            46888886  6 899999999996


No 173
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=97.38  E-value=0.0004  Score=37.62  Aligned_cols=27  Identities=30%  Similarity=0.477  Sum_probs=22.4

Q ss_pred             eecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          70 VATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        70 ~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....|+.+.|.|.+. |.|.|.++|+++
T Consensus        13 ~~~~g~~v~l~C~~~-G~P~P~v~W~~~   39 (97)
T cd05869          13 AMELEEQITLTCEAS-GDPIPSITWRTS   39 (97)
T ss_pred             EEEcCCCEEEEEEee-EeCCCEEEEEEC
Confidence            344579999999986 789999999874


No 174
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=97.38  E-value=0.00037  Score=37.66  Aligned_cols=23  Identities=39%  Similarity=0.728  Sum_probs=19.6

Q ss_pred             EEEEccce-eeccCeEEEEEEEECC
Q psy5866          17 DLIISNAS-FERDNGKFECRLKAAG   40 (98)
Q Consensus        17 ~l~I~~v~-~~~d~G~y~C~~~~~~   40 (98)
                      +|.|.++. .. |+|.|+|.|.|..
T Consensus        59 ~L~i~~~~~~~-D~G~Y~C~A~N~~   82 (94)
T cd05848          59 NLIISNPSEVK-DSGRYQCLATNSI   82 (94)
T ss_pred             eEEEccCCccC-cCEEEEEEEEcCC
Confidence            58898874 68 9999999999963


No 175
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=97.37  E-value=0.00031  Score=37.15  Aligned_cols=30  Identities=27%  Similarity=0.574  Sum_probs=26.3

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+++.|.|.+. +.|.+.+.|+++
T Consensus         8 ~~~~v~~G~~~~l~c~~~-~~p~~~v~W~~~   37 (90)
T PF07679_consen    8 KDVTVKEGESVTLECEVS-GNPPPTVTWYKN   37 (90)
T ss_dssp             SEEEEETTSEEEEEEEEE-ESSSSEEEEEET
T ss_pred             CCEEEeCCCEEEEEEEEE-eCCCCccccccc
Confidence            557899999999999996 678999999975


No 176
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=97.37  E-value=0.00035  Score=38.08  Aligned_cols=31  Identities=16%  Similarity=0.166  Sum_probs=27.1

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+.+.|.|....|.|.|.+.|+.+
T Consensus        11 ~~v~V~eG~~~~L~C~pP~g~P~P~i~W~~~   41 (95)
T cd05845          11 RPVEVEEGDSVVLPCNPPKSAVPLRIYWMNS   41 (95)
T ss_pred             ceeEEecCCCEEEEecCCCCCCCCEEEEECC
Confidence            4578999999999998777999999999864


No 177
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=97.36  E-value=0.00043  Score=37.16  Aligned_cols=26  Identities=15%  Similarity=0.496  Sum_probs=22.1

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .....+.|.+|+.+ |+|.|+|+..+.
T Consensus        50 ~~~~~f~i~~v~~~-~~G~Y~C~~~~~   75 (91)
T cd05751          50 QNKAKFFIPSMKRE-HAGRYRCYYRSG   75 (91)
T ss_pred             ceeEEEEccCCChh-HCEEEEEEEECC
Confidence            34567999999999 999999998863


No 178
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=97.34  E-value=0.00071  Score=36.52  Aligned_cols=23  Identities=26%  Similarity=0.546  Sum_probs=19.1

Q ss_pred             EEEEccce-eeccCeEEEEEEEECC
Q psy5866          17 DLIISNAS-FERDNGKFECRLKAAG   40 (98)
Q Consensus        17 ~l~I~~v~-~~~d~G~y~C~~~~~~   40 (98)
                      +|.|.++. .. |+|.|+|.|.|..
T Consensus        59 ~L~I~~~~~~~-D~G~Y~C~A~N~~   82 (94)
T cd05850          59 NLVINNPQKAR-DAGSYQCLAINRC   82 (94)
T ss_pred             eEEEccCCccC-cCEEEEEEEEcCc
Confidence            58888765 58 9999999999964


No 179
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=97.30  E-value=0.00046  Score=34.80  Aligned_cols=26  Identities=35%  Similarity=0.532  Sum_probs=22.1

Q ss_pred             CCCeEEEEEccceeeccCeEEEEEEEE
Q psy5866          12 DSGRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        12 ~~~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      ......|.|.++..+ |.|.|+|.|.|
T Consensus        50 ~~~~~~L~i~~v~~~-~~g~y~C~a~N   75 (75)
T PF13927_consen   50 SSSNSTLTISNVTRS-DNGTYTCIASN   75 (75)
T ss_dssp             EEEEEEEEESSCCGG-GTEEEEEEEEE
T ss_pred             cceeeEEEEccCCHH-hCcEEEEEEEC
Confidence            344567999999999 99999999975


No 180
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=97.29  E-value=0.0015  Score=36.77  Aligned_cols=26  Identities=15%  Similarity=0.213  Sum_probs=22.2

Q ss_pred             CCCeEEEEEccceeeccCeEEEEEEEE
Q psy5866          12 DSGRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        12 ~~~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      ....++|+|.++..+ |+|.|.|.+..
T Consensus        72 ~~~~~~L~I~~~~~~-Dsa~YyCa~~~   97 (117)
T cd04981          72 SKSTVYLQLNSLTPE-DTAVYYCARGL   97 (117)
T ss_pred             cCCEEEEEECCCCHH-HCEEEEEEEEc
Confidence            345678999999999 99999998764


No 181
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=97.29  E-value=0.0018  Score=34.64  Aligned_cols=30  Identities=17%  Similarity=0.247  Sum_probs=19.8

Q ss_pred             cceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          22 NASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        22 ~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      +++.+ |+|.|+|.+.|..+  ...+..+.|.|
T Consensus        70 ~~~~~-D~G~Y~C~a~N~~G--~~~s~~~~l~v   99 (100)
T cd07693          70 RKGRS-DEGVYVCVAHNSLG--EAVSRNASLEV   99 (100)
T ss_pred             CCCcC-cCEEEEEEEEcccc--ceecceEEEEe
Confidence            34688 99999999999632  22344445544


No 182
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=97.28  E-value=0.00039  Score=37.89  Aligned_cols=23  Identities=17%  Similarity=0.322  Sum_probs=21.0

Q ss_pred             EEEEEccceeeccCe-EEEEEEEEC
Q psy5866          16 YDLIISNASFERDNG-KFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G-~y~C~~~~~   39 (98)
                      .+|.|++|..+ |+| .|.|.|.+.
T Consensus        58 GnL~fs~v~~~-D~g~~Y~C~a~~~   81 (95)
T cd05845          58 GNLYFANVEEQ-DSHPDYICHAHFP   81 (95)
T ss_pred             ceEEEEEEehh-hCCCCeEEEEEcc
Confidence            46999999999 999 899999985


No 183
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=97.27  E-value=0.00097  Score=35.22  Aligned_cols=31  Identities=19%  Similarity=0.271  Sum_probs=25.3

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      +...+.+|+.++|.|.+..+.+.+.+.|+++
T Consensus         7 p~~~V~~G~~vtL~C~~~~~~~~~~~~w~k~   37 (83)
T cd05753           7 PSRVVFEGEPLVLRCHGWKNKPVYKVTYYRD   37 (83)
T ss_pred             CcceecCCCCEEEEeeCCCCCcceEEEEEEC
Confidence            3457889999999999866667788999975


No 184
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins. Ig2_Nectin-3-4_like: domain similar to the second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and nectin-4 (poliovirus receptor related protein 4). Nectin-3 and nectin-4 belong to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.  Nect
Probab=97.25  E-value=0.00083  Score=36.75  Aligned_cols=31  Identities=16%  Similarity=0.416  Sum_probs=26.3

Q ss_pred             CCceecCCCcEEE-EEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIEL-VCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l-~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|..+.+ .|.+.+|+|++.++|+..
T Consensus         9 ~~~~~~~g~~~~vA~C~sa~gkPaa~IsW~~~   40 (97)
T cd07704           9 PSLLIDGGNGTTLAACCAAEGRPAADVTWETN   40 (97)
T ss_pred             CeeEeecCcceeEEEEEccCCccCCEeEEeCC
Confidence            4456778888888 999999999999999864


No 185
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=97.24  E-value=0.0016  Score=33.84  Aligned_cols=22  Identities=18%  Similarity=0.403  Sum_probs=16.9

Q ss_pred             EEEEcccee----eccCeEEEEEEEEC
Q psy5866          17 DLIISNASF----ERDNGKFECRLKAA   39 (98)
Q Consensus        17 ~l~I~~v~~----~~d~G~y~C~~~~~   39 (98)
                      +|.|..+..    . |+|.|+|.|.|.
T Consensus        40 ~l~i~~~~~~~~~~-d~G~Y~C~A~N~   65 (77)
T cd05874          40 TLVINIMNGEKAEA-YEGVYQCTARNE   65 (77)
T ss_pred             eEEEeccccCCCCC-CCEEEEEEEEcC
Confidence            566766653    4 689999999995


No 186
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=97.23  E-value=0.0015  Score=34.89  Aligned_cols=21  Identities=29%  Similarity=0.499  Sum_probs=18.9

Q ss_pred             EEEccceeeccCeEEEEEEEEC
Q psy5866          18 LIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        18 l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      |.|.+++.. |+|.|.|.+.-.
T Consensus        49 LlI~~~~~~-dsG~Y~C~s~E~   69 (85)
T cd05872          49 LLILVTSPE-HSGTYRCYSEEE   69 (85)
T ss_pred             CEEEECCHh-hCEEEEEEEecC
Confidence            789999999 999999998863


No 187
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=97.22  E-value=0.00058  Score=35.36  Aligned_cols=28  Identities=29%  Similarity=0.541  Sum_probs=23.3

Q ss_pred             ceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      .....|+.+.|.|.+. |.|.|.+.|+++
T Consensus         4 ~~~~~G~~v~L~C~~~-g~p~p~i~W~k~   31 (82)
T cd05856           4 IARPVGSSVRLKCVAS-GNPRPDITWLKD   31 (82)
T ss_pred             eeccCCCeEEEEEEee-EeCCCcEEEEEC
Confidence            3456789999999985 788899999975


No 188
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=97.22  E-value=0.00083  Score=34.38  Aligned_cols=35  Identities=34%  Similarity=0.632  Sum_probs=27.1

Q ss_pred             CEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          61 PKISPGANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        61 p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      |.|.. ....+.+|+.+.|.|.+. +.|.+.+.|+++
T Consensus         2 P~l~~-~~~~v~~g~~~~l~C~~~-~~p~~~~~w~~~   36 (80)
T PF13895_consen    2 PVLSS-SPQSVEEGDSVTLTCSVS-GNPPPQVQWYKN   36 (80)
T ss_dssp             -EEEE-ESSEEETTSEEEEEEEEE-SSSSSEEEEEET
T ss_pred             cEEEc-cceEEeCCCcEEEEEEEE-cccceeeeeeee
Confidence            45543 236788999999999986 777899999874


No 189
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=97.21  E-value=0.0017  Score=33.15  Aligned_cols=34  Identities=38%  Similarity=0.541  Sum_probs=24.8

Q ss_pred             EEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          18 LIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        18 l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      +.|.++..+ |+|.|+|.+.+..  ....+..+.|+|
T Consensus        47 ~~~~~~~~~-~~g~y~C~~~~~~--~~~~s~~~~v~V   80 (80)
T PF13895_consen   47 LFIPNVSPE-DSGNYTCRASNGS--GSNTSTSVNVTV   80 (80)
T ss_dssp             EEESSEEGG-GTEEEEEEEEETT--EEEEEEEEEEEE
T ss_pred             eeeeeeccc-cCEEEEEEEEeCC--CCeEeeeEEeeC
Confidence            778899999 9999999999842  234445555544


No 190
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=97.21  E-value=0.0013  Score=35.49  Aligned_cols=24  Identities=17%  Similarity=0.336  Sum_probs=20.5

Q ss_pred             CCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      .|+.+.|.|.+. |.|.|+++|+++
T Consensus        18 ~g~~v~l~C~a~-g~P~p~i~W~~~   41 (94)
T cd05850          18 PEEKVTLGCRAR-ASPPATYRWKMN   41 (94)
T ss_pred             CCCeEEEEeEce-eCCCCEEEEEEC
Confidence            356899999995 899999999975


No 191
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=97.16  E-value=0.0018  Score=35.49  Aligned_cols=36  Identities=28%  Similarity=0.464  Sum_probs=26.8

Q ss_pred             CCEEeCCCCceecCCCcEEEEEEcCCCCCCC-eEEEEe
Q psy5866          60 PPKISPGANPVATEGRAIELVCSTSGGSPDP-QISVTL   96 (98)
Q Consensus        60 ~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~-~~~W~~   96 (98)
                      +|.|.......+.+|+.+.|.|.+. +.|.| .+.|..
T Consensus         2 pP~i~~~~s~~~~~G~~~~L~C~~~-s~P~P~~i~W~w   38 (98)
T cd05898           2 PPIISSEQVQYAVRGERGKVKCFIG-STPPPDRIAWAW   38 (98)
T ss_pred             CCEEecCceEEEeCCCcEEEEEEEc-cCCCCcEEEEEE
Confidence            4667555677899999999999996 45555 567754


No 192
>PHA03273 envelope glycoprotein C; Provisional
Probab=97.15  E-value=0.0072  Score=41.38  Aligned_cols=77  Identities=18%  Similarity=0.294  Sum_probs=54.5

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCC--CeE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPD--PQI   92 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~--~~~   92 (98)
                      .+.|+|..++.. ++|.|+=++.+.+ +.......+.+..+.+|.. .+   ....+.+|+.+..+|.+..-+|+  ..+
T Consensus       197 ~~~LtI~sltaa-TeGvYtWr~~~~n-~t~~~~~~VtV~~yr~Psv-sv---~~~PvL~Ge~y~A~C~aa~YYPp~Sv~~  270 (486)
T PHA03273        197 KFPLTIKSVDWR-TAGVYVWSLYAKN-GTLVNSTSVTVSTYNAPLV-DL---SVHPSLKGENYRAVCVVASYFPHSSVKL  270 (486)
T ss_pred             ccceEEEecchh-hceEEEEEEecCC-CceeeeeEEEEEEecCCcc-cc---cCCccccCCCceEEEEeeeecCCCceEE
Confidence            467999999999 9999987765532 2334444455555655542 22   34678899999999999877774  468


Q ss_pred             EEEec
Q psy5866          93 SVTLQ   97 (98)
Q Consensus        93 ~W~~~   97 (98)
                      +|+++
T Consensus       271 rWf~d  275 (486)
T PHA03273        271 RWYKN  275 (486)
T ss_pred             EEEeC
Confidence            99975


No 193
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=97.15  E-value=0.00054  Score=36.62  Aligned_cols=22  Identities=36%  Similarity=0.732  Sum_probs=19.1

Q ss_pred             EEEEccce-eeccCeEEEEEEEEC
Q psy5866          17 DLIISNAS-FERDNGKFECRLKAA   39 (98)
Q Consensus        17 ~l~I~~v~-~~~d~G~y~C~~~~~   39 (98)
                      .|.|.++. .. |+|.|+|.+.|.
T Consensus        59 ~L~i~~~~~~~-d~G~Y~C~a~N~   81 (91)
T cd04967          59 NLVISNPSKAK-DAGRYQCLASNI   81 (91)
T ss_pred             EEEEecCCccC-CCEEEEEEEEcC
Confidence            58898886 48 999999999985


No 194
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=97.11  E-value=0.00066  Score=37.29  Aligned_cols=29  Identities=24%  Similarity=0.204  Sum_probs=24.9

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+..|+.+.|.|.+. |.|+|.+.|+++
T Consensus        12 ~~~~~~~~~~~l~~~v~-g~P~P~v~W~kd   40 (101)
T cd05859          12 LEFANLHEVKEFVVEVE-AYPPPQIRWLKD   40 (101)
T ss_pred             eEEEecCCcEEEEEEEE-EeCCCceEEEEC
Confidence            35677889999999985 899999999986


No 195
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=97.08  E-value=0.0027  Score=35.00  Aligned_cols=35  Identities=14%  Similarity=0.232  Sum_probs=27.9

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..|+|.+++.+ |+|.|+|.+.|.   ....+..+.|.|
T Consensus        65 S~L~L~Rlk~~-E~G~YTf~a~N~---~~~~s~tF~l~v   99 (101)
T cd05860          65 SELHLTRLKGT-EGGTYTFLVSNS---DASASVTFNVYV   99 (101)
T ss_pred             EEEEEeecChh-hCcEEEEEEECC---CCeEEEEEEEEE
Confidence            46899999999 999999999985   455555666655


No 196
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=97.05  E-value=0.002  Score=34.79  Aligned_cols=23  Identities=13%  Similarity=0.260  Sum_probs=19.9

Q ss_pred             CCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          74 GRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        74 g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      +..+.|.|.+. |.|.|+++|+++
T Consensus        19 ~~~v~l~C~a~-G~P~P~i~W~k~   41 (93)
T cd05849          19 EGKVSVNCRAR-ANPFPIYKWRKN   41 (93)
T ss_pred             CCeEEEeCcCc-cCCCCEEEEEEC
Confidence            44699999995 899999999975


No 197
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=97.01  E-value=0.0015  Score=35.53  Aligned_cols=29  Identities=10%  Similarity=0.275  Sum_probs=25.3

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      .+..+.+|+.+.|.|.+. +.|.|.+.|++
T Consensus         5 ~~~tv~~G~tv~L~C~v~-g~~~~~v~W~k   33 (95)
T cd05882           5 QDETVAVGGTVTLKCGVK-EHDNSSLQWSN   33 (95)
T ss_pred             ccEEEecCCcEEEEEEEe-CCCCCeEEEec
Confidence            457889999999999986 68899999976


No 198
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=96.99  E-value=0.0018  Score=34.77  Aligned_cols=22  Identities=23%  Similarity=0.543  Sum_probs=17.6

Q ss_pred             EEEEccc-----eeeccCeEEEEEEEEC
Q psy5866          17 DLIISNA-----SFERDNGKFECRLKAA   39 (98)
Q Consensus        17 ~l~I~~v-----~~~~d~G~y~C~~~~~   39 (98)
                      ++.|.++     +.. |+|.|+|.+.|.
T Consensus        55 ~l~i~~v~~~~~~~~-D~G~Y~C~a~N~   81 (95)
T cd05722          55 SLLITSVVHSKHNKP-DEGFYQCVAQND   81 (95)
T ss_pred             eEEEeeeeccCCCCC-cCEEEEEEEECC
Confidence            4666666     578 999999999985


No 199
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=96.99  E-value=0.0025  Score=34.62  Aligned_cols=28  Identities=21%  Similarity=0.312  Sum_probs=23.2

Q ss_pred             CceecCCCcEEEEEEcCCCCC-CCeEEEEe
Q psy5866          68 NPVATEGRAIELVCSTSGGSP-DPQISVTL   96 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p-~~~~~W~~   96 (98)
                      ...+.+|+.+.|.|.+. |.| +|.+.|++
T Consensus         9 ~~~v~~G~~v~l~C~v~-G~P~~p~i~W~~   37 (96)
T cd05865           9 QGEISVGESKFFLCQVA-GEAKDKDISWFS   37 (96)
T ss_pred             ccEECCCCeEEEEEEEe-CCCCCCEEEEEC
Confidence            34678899999999996 677 57999996


No 200
>PHA03270 envelope glycoprotein C; Provisional
Probab=96.98  E-value=0.014  Score=39.79  Aligned_cols=74  Identities=15%  Similarity=0.183  Sum_probs=54.9

Q ss_pred             EEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCC--CeEEEE
Q psy5866          18 LIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPD--PQISVT   95 (98)
Q Consensus        18 l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~--~~~~W~   95 (98)
                      |.|..++.. .+|.|+=...+.+. .......+.+..+.+|.. .+   ....+.+|+.+..+|.+..-+|.  ..++|+
T Consensus       184 L~I~slt~a-TeGvY~Wr~~~~~~-~~~~~~~VtV~~yr~Psv-sv---~~~PvL~Ge~Y~AtC~va~YYPp~Sv~lrWf  257 (466)
T PHA03270        184 LVIQELTLA-TQGMYYWARGPADR-PHRYGTWTRVRMFRRPSL-SI---RPHAVLEGEPFGATCVAANYYPGDRAAFRWF  257 (466)
T ss_pred             EEEEEcccc-cceEEEEEEecCCC-ceeeeeEEEEEEecCCcc-cc---cCCccccCCCceEEEEeeeecCCCceEEEEE
Confidence            999999999 99999999877543 344445566666655542 22   33578899999999999877774  468999


Q ss_pred             ec
Q psy5866          96 LQ   97 (98)
Q Consensus        96 ~~   97 (98)
                      ++
T Consensus       258 ~n  259 (466)
T PHA03270        258 EG  259 (466)
T ss_pred             eC
Confidence            75


No 201
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=96.94  E-value=0.0083  Score=32.84  Aligned_cols=27  Identities=15%  Similarity=0.099  Sum_probs=21.9

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .....|+|.++...||.|.|.|.|.|.
T Consensus        61 g~~S~L~I~~~~~~d~~g~Y~C~a~N~   87 (98)
T cd05898          61 GVLSTLTINNIMEADFQTHYNCTAWNS   87 (98)
T ss_pred             CcEEEEEECCCccccCCcEEEEEEEeC
Confidence            345679999998872379999999996


No 202
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=96.85  E-value=0.0025  Score=33.82  Aligned_cols=28  Identities=21%  Similarity=0.261  Sum_probs=23.3

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+.+|+.+.|.|.+. + |.+.+.|+++
T Consensus         5 ~~~v~~g~~v~L~C~~~-~-p~~~i~W~k~   32 (89)
T cd04979           5 VVTVVEGNSVFLECSPK-S-NLASVVWLFQ   32 (89)
T ss_pred             EEEEECCCcEEEEEeCC-C-CCceEEEEEC
Confidence            35678899999999975 4 7789999986


No 203
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=96.77  E-value=0.0043  Score=32.16  Aligned_cols=28  Identities=29%  Similarity=0.590  Sum_probs=23.3

Q ss_pred             ceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ..+..|+.+.|.|.+. +.|.+.+.|+++
T Consensus         4 ~~~~~G~~~~l~C~~~-~~p~~~v~W~k~   31 (85)
T cd05729           4 HAVPAGSTVRLKCPAS-GNPRPTITWLKD   31 (85)
T ss_pred             eEecCCCcEEEEEEcC-CCCCCeEEEEEC
Confidence            4556799999999986 678899999875


No 204
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=96.75  E-value=0.0039  Score=32.89  Aligned_cols=36  Identities=8%  Similarity=0.178  Sum_probs=25.4

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      +|++...+-+ |.+.|.|++.|.+...........|.
T Consensus        44 ~L~~~~~~~D-dg~~~~C~A~n~a~~~~~~~~~~~l~   79 (80)
T cd05885          44 TIRFPVDRKD-DGAILSCEASHPALVSQKKQTQYSLD   79 (80)
T ss_pred             EEEEEeeecc-CCcEEEEEEEChhhCCCCeeEEEEEe
Confidence            5788777777 89999999999755444444444444


No 205
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=96.72  E-value=0.0021  Score=34.77  Aligned_cols=30  Identities=17%  Similarity=0.252  Sum_probs=24.3

Q ss_pred             CceecCCCcEEEEEEcCCC----CCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGG----SPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~----~p~~~~~W~~~   97 (98)
                      ...+.+|+.+.|.|.+.+.    .|.+.+.|+++
T Consensus         8 ~~~v~~G~~~~L~C~~~g~~~~~~p~~~v~Wyk~   41 (94)
T cd05756           8 KSYVLEGEPVVIKCPLFYSYIAQSPGLNLTWYKS   41 (94)
T ss_pred             EEEEecCCCeEEECCCCCcccccCCCceEEEEEc
Confidence            3567789999999998643    68899999986


No 206
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=96.69  E-value=0.003  Score=34.20  Aligned_cols=29  Identities=17%  Similarity=0.326  Sum_probs=25.0

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      ++..+.+|+++.|.|.+. +.|.+.+.|++
T Consensus         5 ~~v~v~eG~~v~L~C~~~-~~p~~~v~W~~   33 (95)
T cd07701           5 QNVTVVEGGTANLTCRVD-QNDNTSLQWSN   33 (95)
T ss_pred             ceEEEecCCcEEEEEEEe-cCCceEEEEeC
Confidence            457899999999999986 67889999974


No 207
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=96.69  E-value=0.0046  Score=32.28  Aligned_cols=35  Identities=17%  Similarity=0.282  Sum_probs=23.7

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVT   53 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~   53 (98)
                      .|.|.....+ |.|.|+|.+.+.+.. .....++.|.
T Consensus        47 ~L~i~~~~~~-~~~~y~C~a~n~~l~-~~~~~s~~l~   81 (82)
T cd05759          47 TLPITPSDHD-TGRTFTCRARNEALP-TGKETSVTLD   81 (82)
T ss_pred             EEEEeCceec-CCCEEEEEEcCccCC-CCcEEEEEEc
Confidence            5778788887 889999999986432 2234444443


No 208
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=96.66  E-value=0.0054  Score=33.87  Aligned_cols=29  Identities=17%  Similarity=0.265  Sum_probs=24.2

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|++++|.|....  +...+.|++|
T Consensus         6 ~~~~v~~G~~v~l~C~~~~--~~~~v~Wykq   34 (110)
T cd05899           6 RYLIKGRGQSVTLRCSQTS--GHDNMYWYRQ   34 (110)
T ss_pred             CceEEcCCCcEEEEEEECC--CCCEEEEEEE
Confidence            3467889999999999864  6678999987


No 209
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.65  E-value=0.0039  Score=30.06  Aligned_cols=28  Identities=36%  Similarity=0.648  Sum_probs=24.0

Q ss_pred             CCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          11 PDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        11 ~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .......|.|.+++.. |+|.|.|.+.+.
T Consensus        38 ~~~~~~~l~i~~~~~~-d~g~y~C~~~~~   65 (74)
T cd00096          38 TSSGSSTLTISNVTLE-DSGTYTCVASNS   65 (74)
T ss_pred             cceeEEEEEECccCcc-cCcEEEEEEecC
Confidence            4456778999999999 999999999874


No 210
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=96.62  E-value=0.0041  Score=34.49  Aligned_cols=24  Identities=25%  Similarity=0.422  Sum_probs=20.8

Q ss_pred             CCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      .|..+.|.|.+. |.|.+.++|+++
T Consensus        22 ~g~~v~L~C~a~-G~P~p~i~W~k~   45 (109)
T cd05773          22 GSSDANLVCQAQ-GVPRVQFRWAKN   45 (109)
T ss_pred             CCCEEEEEEECc-ccCCCEEEEEEC
Confidence            467899999996 799999999975


No 211
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=96.59  E-value=0.0067  Score=31.53  Aligned_cols=28  Identities=21%  Similarity=0.253  Sum_probs=22.7

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+.+|+.+.|.|.+. +. .+.+.|+++
T Consensus         3 ~~~~~~G~~v~l~C~~~-~~-~~~v~W~k~   30 (79)
T cd04973           3 SYSAHPGDLLQLRCRLR-DD-VQSINWTKD   30 (79)
T ss_pred             cEEecCCCCEEEEEEec-CC-CceEEEeeC
Confidence            45678999999999986 44 568999986


No 212
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=96.53  E-value=0.0057  Score=32.87  Aligned_cols=27  Identities=22%  Similarity=0.300  Sum_probs=22.6

Q ss_pred             ceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+|+.+.|.|..  +.|.|.+.|++|
T Consensus         6 ~~~~eG~~v~L~C~~--~~p~p~v~Wykq   32 (91)
T cd05871           6 VYGVENNSTFLECLP--KSPQASVKWLFQ   32 (91)
T ss_pred             EEEecCCcEEEEEEC--CCCCceEEEEEE
Confidence            457789999999995  468899999975


No 213
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=96.52  E-value=0.0044  Score=33.05  Aligned_cols=24  Identities=25%  Similarity=0.547  Sum_probs=20.0

Q ss_pred             CCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      .+..+.|.|.+. |.|.|.++|+++
T Consensus        18 ~~~~~~l~C~~~-g~p~p~i~W~k~   41 (91)
T cd04967          18 DEGKVSLNCRAR-GSPPPTYRWLMN   41 (91)
T ss_pred             CCCEEEEEEeee-EcCCCEEEEEEC
Confidence            346799999985 789999999975


No 214
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=96.50  E-value=0.011  Score=32.37  Aligned_cols=29  Identities=17%  Similarity=0.226  Sum_probs=23.2

Q ss_pred             CceecCCCcEEEEEEcCCCCC-CCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSP-DPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p-~~~~~W~~~   97 (98)
                      ...+.+|++++|.|.+. +.. ...+.|++|
T Consensus         9 ~~~v~~G~~v~L~C~~~-~~~~~~~~~Wyrq   38 (106)
T cd04980           9 TLSVSPGESATISCKAS-QSVSSNYLAWYQQ   38 (106)
T ss_pred             cEEECCCCCEEEEEEEC-CCCCCCcEEEEEE
Confidence            45788999999999975 333 567999987


No 215
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=96.49  E-value=0.0093  Score=33.62  Aligned_cols=35  Identities=9%  Similarity=0.130  Sum_probs=30.4

Q ss_pred             ceeEEEEeCCCCeEEEEEccceeeccCeEEEEEEEE
Q psy5866           3 KVEIIDYRPDSGRYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus         3 ~~~~~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      .+.++..+.+++..+|.|.+++.+ |.+.|.|....
T Consensus        61 ~r~tcs~~~s~ntv~L~l~~L~a~-DTa~Y~Ca~e~   95 (115)
T cd05721          61 DGFNCDGTLGNEQVNFTLQNLRAN-QTDIYFCKIEL   95 (115)
T ss_pred             CCeEEeEeCCCCEEEEEEcCCCHH-HCeEEEEEeee
Confidence            345678889999999999999999 99999997754


No 216
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=96.46  E-value=0.0076  Score=33.06  Aligned_cols=29  Identities=17%  Similarity=0.263  Sum_probs=24.2

Q ss_pred             ceecCCCcEEEEEEcCCCCCC--CeEEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGSPD--PQISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~p~--~~~~W~~~   97 (98)
                      ....+|..+++.|.+.+++|.  +.+.|++.
T Consensus        10 ~~l~~G~~vtv~C~v~~v~P~~~l~v~LlkG   40 (99)
T cd07689          10 GPLEEGKPVTVKCEVPDVYPFDRLEIELLKG   40 (99)
T ss_pred             CcccCCceEEEEEEecCcccCCceEEEEecC
Confidence            455899999999999988886  67889864


No 217
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=96.46  E-value=0.0048  Score=30.40  Aligned_cols=24  Identities=29%  Similarity=0.652  Sum_probs=19.9

Q ss_pred             CCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          74 GRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        74 g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      |+.+.|.|.+..+.+.+.+.|+++
T Consensus         1 G~~v~L~C~~~~~~~~~~~~W~~~   24 (64)
T PF00047_consen    1 GSSVTLTCSVSSGPPPTTVTWSKN   24 (64)
T ss_dssp             TSEEEEEEEEEESSSTSEEEEEET
T ss_pred             CCeEEEEeecCCCCCCcEEEEEEC
Confidence            678999999844677889999875


No 218
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=96.43  E-value=0.015  Score=31.10  Aligned_cols=35  Identities=14%  Similarity=0.281  Sum_probs=26.5

Q ss_pred             CEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          61 PKISPGANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        61 p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      |.+...+...+.+|++++|.|...  .+...+.|+++
T Consensus         3 P~L~a~p~~vV~~G~~VtL~C~~~--~~~~~f~l~k~   37 (91)
T cd05751           3 PSLWAEPSSVVPLGKPVTLRCQGP--YGAVEYRLYRE   37 (91)
T ss_pred             CEEEecCCCccCCCCcEEEEEecC--CCCCEEEEEEC
Confidence            556444567889999999999863  56678888864


No 219
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=96.42  E-value=0.013  Score=31.59  Aligned_cols=35  Identities=20%  Similarity=0.343  Sum_probs=25.8

Q ss_pred             CEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          61 PKISPGANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        61 p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      |.|...+...+.+|++++|.|....  +...+.|+|+
T Consensus         2 P~l~a~p~~vV~~G~~VTL~C~~~~--~~~~f~l~k~   36 (94)
T cd05711           2 PFLSAHPSPVVPSGENVTLQCHSDI--RFDRFILYKE   36 (94)
T ss_pred             CEEEecCCCccCCCCeEEEEEecCC--CCCEEEEEEC
Confidence            4554445678889999999998643  4567889876


No 220
>PF11465 Receptor_2B4:  Natural killer cell receptor 2B4;  InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells. It plays a role in activating NK-mediated cytotoxicity through its interaction with CD48 on target cells in a subset of CD8 T cells []. The structure of 2B4 consists of an immunoglobulin variable domain fold and contains two beta-sheets. One of the beta-sheets, the six-stranded sheet, contains structural features that may have a role in ligand recognition and receptor function []. This entry represents the 2B4 immunoglobulin domain.; GO: 0005488 binding; PDB: 2PTU_D 2PTT_B 1Z2K_A.
Probab=96.38  E-value=0.014  Score=32.42  Aligned_cols=41  Identities=20%  Similarity=0.353  Sum_probs=28.3

Q ss_pred             CCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          12 DSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        12 ~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ..++++|.|+.++.+ |+|.|.-++.+..+  ......+++.|+
T Consensus        67 ~~enlaLlIkaAq~q-DSG~Y~LEvT~~sG--~V~~~~FqVsVF  107 (108)
T PF11465_consen   67 TSENLALLIKAAQPQ-DSGLYCLEVTNESG--KVCTKNFQVSVF  107 (108)
T ss_dssp             ETTTTEEEESS-SGG-G-EEEEEEEEETTS--CEEEEEEEEEEE
T ss_pred             eccCceEEEeecCcc-cCceEEEEEEcCCC--cEEEEEEEEEee
Confidence            344568999999999 99999999998643  334445565554


No 221
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=96.34  E-value=0.0044  Score=31.06  Aligned_cols=23  Identities=43%  Similarity=0.846  Sum_probs=18.0

Q ss_pred             CCCcEEEEEEcCCCCCCCeEEEE
Q psy5866          73 EGRAIELVCSTSGGSPDPQISVT   95 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~~~~~W~   95 (98)
                      .+..+.|+|.+..+.+.+.++|+
T Consensus        14 ~~~~~~l~C~~~~~~~~~~~~W~   36 (75)
T PF13927_consen   14 SGGSVTLTCSAEGGPPPPSISWY   36 (75)
T ss_dssp             TTEEEEEEEEESSEESSEEEEEE
T ss_pred             eceeEEEEEEEccccCCeEEEEE
Confidence            33349999999866558899998


No 222
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=96.31  E-value=0.0092  Score=28.51  Aligned_cols=24  Identities=33%  Similarity=0.736  Sum_probs=19.7

Q ss_pred             CCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      +|+.+.|.|.+. +.|.+.+.|++.
T Consensus         1 ~g~~~~l~C~~~-~~~~~~v~W~~~   24 (63)
T smart00408        1 EGQSVTLTCPAE-GDPVPNITWLKD   24 (63)
T ss_pred             CCceEEEEeeCc-cCCCCeEEEEEC
Confidence            478899999964 678889999863


No 223
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=96.28  E-value=0.013  Score=30.80  Aligned_cols=22  Identities=23%  Similarity=0.400  Sum_probs=18.0

Q ss_pred             EEEEEccceeeccCeEEEEEEEECC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      ..|.|.++  . |+|.|.|.|.|..
T Consensus        49 s~L~i~~~--~-d~g~Y~C~A~N~~   70 (81)
T cd05749          49 SVLNVPGL--N-ETSKFSCEAHNAK   70 (81)
T ss_pred             CEEEEccc--c-CCeEEEEEEEecc
Confidence            36888776  6 8999999999963


No 224
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=96.19  E-value=0.013  Score=31.34  Aligned_cols=29  Identities=21%  Similarity=0.248  Sum_probs=23.6

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      .+..+..|+++.|.|.+.  .|.+++.|.++
T Consensus         4 ~~~~v~~G~~v~L~C~~~--~~~~~i~W~~n   32 (87)
T cd05873           4 RQRTFKLGNNAELKCSPK--SNLARVVWKFD   32 (87)
T ss_pred             ceEEEECCCCEEEEEECC--CCCCeEEEEEC
Confidence            346788999999999974  36789999876


No 225
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=96.18  E-value=0.013  Score=31.40  Aligned_cols=29  Identities=14%  Similarity=0.291  Sum_probs=24.2

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      +...+.+|+++.|.|.+. +.+.+.+.|++
T Consensus         5 ~~~~v~~G~~v~L~C~~~-~~~~~~v~W~~   33 (95)
T cd05717           5 QDVTVVEGGTATLKCRVK-NNDNSSLQWSN   33 (95)
T ss_pred             CcEEEcCCCCEEEEEEEC-CCCCceEEEeC
Confidence            456889999999999985 56788999974


No 226
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=96.16  E-value=0.013  Score=31.65  Aligned_cols=28  Identities=18%  Similarity=0.320  Sum_probs=23.6

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      .+..+.+|+.+.|.|.+. |.|. .+.|++
T Consensus         8 ~~~~v~~G~~v~l~C~~~-G~P~-~v~W~k   35 (92)
T cd05866           8 SKVELSVGESKFFTCTAI-GEPE-SIDWYN   35 (92)
T ss_pred             cceEEcCCCeEEEEEEEE-EeCC-eEEEEe
Confidence            446788999999999985 6887 899996


No 227
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=96.14  E-value=0.017  Score=31.62  Aligned_cols=30  Identities=23%  Similarity=0.149  Sum_probs=24.6

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+++.|.|... +.+...+.|+++
T Consensus         6 ~~v~~~~G~~v~L~C~~~-~~~~~~v~W~k~   35 (109)
T cd04983           6 QSLSVQEGENVTLNCNYS-TSTFYYLFWYRQ   35 (109)
T ss_pred             CceEEcCCCCEEEEEEEC-CCCccEEEEEEE
Confidence            346788999999999986 447788999986


No 228
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=96.13  E-value=0.012  Score=31.92  Aligned_cols=26  Identities=19%  Similarity=0.172  Sum_probs=21.8

Q ss_pred             cCCCcEEEEEEcCCCCCCC-eEEEEec
Q psy5866          72 TEGRAIELVCSTSGGSPDP-QISVTLQ   97 (98)
Q Consensus        72 ~~g~~~~l~C~~~~~~p~~-~~~W~~~   97 (98)
                      .+|....|.|.+.+.+|.. .+.|+++
T Consensus        12 ~~~~~~~L~C~~~gFyP~~i~v~W~~~   38 (94)
T cd05766          12 SLSHPHLLVCHVWGFYPPEITVKWFKN   38 (94)
T ss_pred             cCCCCeEEEEEEeeecCCCCEEEEEEC
Confidence            4577899999999888866 8999976


No 229
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=96.01  E-value=0.022  Score=31.72  Aligned_cols=31  Identities=16%  Similarity=0.111  Sum_probs=24.0

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ....+.+|+++.|.|..........+.|++|
T Consensus         7 ~~v~~~~G~~v~L~C~~~~~~~~~~v~Wyrq   37 (116)
T cd07706           7 PDVSVQVGEEVTLNCRYETSWTNYYIFWYKQ   37 (116)
T ss_pred             CceEEcCCCCEEEEEEEeCCCCceEEEEEEE
Confidence            3467889999999998754334567999987


No 230
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=95.96  E-value=0.018  Score=31.95  Aligned_cols=30  Identities=20%  Similarity=0.245  Sum_probs=23.7

Q ss_pred             CceecCCCcEEEEEEcCCC-CCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGG-SPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~-~p~~~~~W~~~   97 (98)
                      ...+.+|++++|.|..... .+.+.+.|++|
T Consensus         7 ~~~~~~G~~v~l~C~~~~~~~~~~~v~Wyrq   37 (116)
T cd04982           7 SITREESKSVTISCKVSGIDFSTTYIHWYRQ   37 (116)
T ss_pred             eEEeCCCCCEEEEEEEeCCCccccEEEEEEE
Confidence            4577889999999997532 46778999986


No 231
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=95.89  E-value=0.069  Score=28.69  Aligned_cols=39  Identities=15%  Similarity=0.323  Sum_probs=27.8

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      .+..+|.+.+++.. |+|..+|.+...   .........+.|+
T Consensus        48 ~~~ktL~~~qv~~q-dSG~WtC~V~~~---~k~~~~~~~V~Vl   86 (88)
T cd07694          48 QDKKTLNLVQLGPN-DSGTWDCIVSVN---SSEKTLKLDIKVL   86 (88)
T ss_pred             CCccEEEeceeCcc-cCCEEEEEEEEC---ceEEEEEeeEEEE
Confidence            36678999999999 999999999753   3333344444443


No 232
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=95.81  E-value=0.021  Score=31.06  Aligned_cols=22  Identities=23%  Similarity=0.395  Sum_probs=19.5

Q ss_pred             cEEEEEEcCCCCCCCeEEEEec
Q psy5866          76 AIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        76 ~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+.|.+.+|+|.+.++|+++
T Consensus        17 ~~va~C~s~~gkP~a~ItW~~~   38 (95)
T cd05719          17 VTVATCVSANGKPPATISWETT   38 (95)
T ss_pred             cEEEEEECCCCcCCCEEEEEeC
Confidence            3678999999999999999975


No 233
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=95.78  E-value=0.023  Score=30.42  Aligned_cols=27  Identities=22%  Similarity=0.320  Sum_probs=22.3

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      ...+..|+.+.|.|.+. |.| +.+.|++
T Consensus         9 ~~~v~~G~~~~l~C~~~-G~p-~~i~W~~   35 (92)
T cd04977           9 QGEISVGESKFFLCQVI-GEP-KDISWFS   35 (92)
T ss_pred             cEEECCCCeEEEEEEeE-eeC-CeEEEEC
Confidence            46788999999999986 566 4899986


No 234
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=95.75  E-value=0.018  Score=31.31  Aligned_cols=21  Identities=24%  Similarity=0.385  Sum_probs=19.1

Q ss_pred             EEEEEEcCCCCCCCeEEEEec
Q psy5866          77 IELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        77 ~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ..+.|.+.+|+|++.++|+++
T Consensus        18 ~va~C~s~~gkPaa~IsW~~~   38 (95)
T cd07703          18 PVAKCVSANGRPPARISWSST   38 (95)
T ss_pred             EEEEEEcCCCCCCcEEEEEcC
Confidence            678999999999999999975


No 235
>smart00409 IG Immunoglobulin.
Probab=95.75  E-value=0.033  Score=28.05  Aligned_cols=28  Identities=36%  Similarity=0.663  Sum_probs=23.1

Q ss_pred             ceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ..+..|+.+.|.|.+.. .+.+.+.|+++
T Consensus         4 ~~~~~g~~~~l~C~~~~-~~~~~~~W~~~   31 (86)
T smart00409        4 VTVKEGESVTLSCEVSG-SPPPEVTWYKQ   31 (86)
T ss_pred             EEEeCCCeEEEEEEEcc-CCCCeEEEEEC
Confidence            46678999999999874 47889999875


No 236
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=95.75  E-value=0.033  Score=28.05  Aligned_cols=28  Identities=36%  Similarity=0.663  Sum_probs=23.1

Q ss_pred             ceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ..+..|+.+.|.|.+.. .+.+.+.|+++
T Consensus         4 ~~~~~g~~~~l~C~~~~-~~~~~~~W~~~   31 (86)
T smart00410        4 VTVKEGESVTLSCEVSG-SPPPEVTWYKQ   31 (86)
T ss_pred             EEEeCCCeEEEEEEEcc-CCCCeEEEEEC
Confidence            46678999999999874 47889999875


No 237
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=95.67  E-value=0.015  Score=30.94  Aligned_cols=26  Identities=23%  Similarity=0.381  Sum_probs=21.2

Q ss_pred             cCCCcEEEEEEcCCCCC-CCeEEEEec
Q psy5866          72 TEGRAIELVCSTSGGSP-DPQISVTLQ   97 (98)
Q Consensus        72 ~~g~~~~l~C~~~~~~p-~~~~~W~~~   97 (98)
                      ..|..+.|.|.+.+..| .+.++|+++
T Consensus        11 ~~~~~~~L~C~a~g~~P~~~~i~W~~~   37 (95)
T cd00098          11 LLGGSVTLTCLATGFYPPDITVTWLKN   37 (95)
T ss_pred             HcCCCeEEEEEEeeEECCCcEEEEEEC
Confidence            46788999999987667 468999975


No 238
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=95.54  E-value=0.038  Score=29.78  Aligned_cols=23  Identities=9%  Similarity=0.216  Sum_probs=20.1

Q ss_pred             eEEEEEccceeeccCeEEEEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      ...+.|.+++.+ |+|.|.|....
T Consensus        54 ~a~f~I~~~~~~-~~G~Y~C~~~~   76 (94)
T cd05711          54 QASFPLGPVTPA-HAGTYRCYGSY   76 (94)
T ss_pred             EEEEEecCCCcc-cCEEEEEEEEC
Confidence            556899999999 99999999764


No 239
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.46  E-value=0.02  Score=31.30  Aligned_cols=27  Identities=15%  Similarity=0.187  Sum_probs=21.6

Q ss_pred             ecCCCcEEEEEEcCCCCC-CCeEEEEec
Q psy5866          71 ATEGRAIELVCSTSGGSP-DPQISVTLQ   97 (98)
Q Consensus        71 ~~~g~~~~l~C~~~~~~p-~~~~~W~~~   97 (98)
                      ...+..++|+|.+.+.+| ...+.|+++
T Consensus        14 ~~~~~~~~L~C~~~gfyP~~i~v~W~~~   41 (100)
T cd07699          14 LEKSGKATLVCLINDFYPGFATVQWKVD   41 (100)
T ss_pred             HccCCCcEEEEEEEeEECCCCEEEEEEC
Confidence            335677899999998888 568999875


No 240
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=95.01  E-value=0.054  Score=29.05  Aligned_cols=24  Identities=17%  Similarity=0.369  Sum_probs=20.1

Q ss_pred             CCcEEEEEEcCCCCCCC-eEEEEec
Q psy5866          74 GRAIELVCSTSGGSPDP-QISVTLQ   97 (98)
Q Consensus        74 g~~~~l~C~~~~~~p~~-~~~W~~~   97 (98)
                      ++.+.|.|.+.+.+|.. .+.|+++
T Consensus        14 ~~~~~L~C~a~gF~P~~i~v~W~~~   38 (93)
T cd07698          14 DGSLTLSCHATGFYPRDIEVTWLRD   38 (93)
T ss_pred             CCcEEEEEEEEEEeCCCcEEEEEEC
Confidence            67799999998777865 8999975


No 241
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=94.95  E-value=0.049  Score=29.94  Aligned_cols=25  Identities=20%  Similarity=0.223  Sum_probs=20.5

Q ss_pred             CCCcEEEEEEcCCCCCCC-eEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPDP-QISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~~-~~~W~~~   97 (98)
                      .+..++|.|.+.+.+|.. .+.|+++
T Consensus        15 ~~~~~tL~C~a~gFyP~~i~v~W~k~   40 (102)
T cd05768          15 LQETATLTCLVKGFSPSDIFVKWLQN   40 (102)
T ss_pred             cCCceEEEEEEeeEeCCCCEEEEEEC
Confidence            456799999999888865 6899875


No 242
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=94.79  E-value=0.096  Score=29.36  Aligned_cols=32  Identities=19%  Similarity=0.330  Sum_probs=23.1

Q ss_pred             CCceecCCCcEEEEEEcCCCC-CCCeEEEEecC
Q psy5866          67 ANPVATEGRAIELVCSTSGGS-PDPQISVTLQV   98 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~-p~~~~~W~~~~   98 (98)
                      ....+.+|++++|.|...... -...+.|++|.
T Consensus         5 ~~~~v~~G~~vtL~C~~~~~~~~~~~~~WYkQ~   37 (117)
T cd04981           5 GPGLVKPGQSLKLSCKASGFTFTSYGVNWVRQA   37 (117)
T ss_pred             CCeEEcCCCCEEEEEEEeCCCcccceEEEEEEC
Confidence            346788999999999864222 13569999873


No 243
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=94.72  E-value=0.066  Score=29.11  Aligned_cols=28  Identities=18%  Similarity=0.254  Sum_probs=21.7

Q ss_pred             eecCCCcEEEEEEcCCC-CC-CCeEEEEec
Q psy5866          70 VATEGRAIELVCSTSGG-SP-DPQISVTLQ   97 (98)
Q Consensus        70 ~~~~g~~~~l~C~~~~~-~p-~~~~~W~~~   97 (98)
                      .+..++.+.|+|.+.+. +| ...++|+++
T Consensus        10 ~l~~~~~~tLtC~v~gf~yP~~i~v~W~r~   39 (96)
T cd07696          10 QLLLTKSVKLTCLVTNLTSPEGVNVTWTRG   39 (96)
T ss_pred             HhccCCCeEEEEEEeCCCCCCCcEEEEEEC
Confidence            34457889999999987 56 457999985


No 244
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=94.53  E-value=0.059  Score=29.22  Aligned_cols=25  Identities=16%  Similarity=0.201  Sum_probs=19.7

Q ss_pred             CCCcEEEEEEcCCCCCC-CeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPD-PQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~-~~~~W~~~   97 (98)
                      .+...+|.|.+.+.+|. ..+.|.++
T Consensus        14 ~~~~~tL~C~a~gFyP~~I~v~W~~~   39 (94)
T cd05767          14 LGEPNTLICFVDNFFPPVLNVTWLKN   39 (94)
T ss_pred             CCCCeEEEEEEEEEECCcCEEEEEEC
Confidence            34557999999988885 57899875


No 245
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=94.34  E-value=0.058  Score=30.41  Aligned_cols=25  Identities=32%  Similarity=0.498  Sum_probs=20.7

Q ss_pred             CCCcEEEEEEcCCCCCC-CeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPD-PQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~-~~~~W~~~   97 (98)
                      ++..+.|.|.+.+.+|. .++.|+++
T Consensus        17 ~~~~~tL~Cla~gFyP~~I~V~W~kn   42 (115)
T cd05769          17 NKRKATLVCLATGFYPDHVSLSWKVN   42 (115)
T ss_pred             cCCCcEEEEEEEeEeCCCcEEEEEEC
Confidence            45678999999988887 48999975


No 246
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=94.12  E-value=0.19  Score=26.99  Aligned_cols=27  Identities=15%  Similarity=0.159  Sum_probs=20.4

Q ss_pred             ceecCCCcEEEEEEcCCC-CCCCeEEEE
Q psy5866          69 PVATEGRAIELVCSTSGG-SPDPQISVT   95 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~-~p~~~~~W~   95 (98)
                      ..+..|++++|+|....+ .|.+.+.|+
T Consensus         9 ~~lL~G~sLtLtl~~~s~s~p~~~i~w~   36 (88)
T cd07694           9 DHVLSGTNLTLTLHGSSNSLPAFKVEWR   36 (88)
T ss_pred             CeeecCCcEEEEEecCCCCCCCccEEEe
Confidence            466789999999998543 445589996


No 247
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=94.10  E-value=0.09  Score=28.47  Aligned_cols=26  Identities=23%  Similarity=0.369  Sum_probs=20.3

Q ss_pred             cCCCcEEEEEEcCCCCCC-CeEEEEec
Q psy5866          72 TEGRAIELVCSTSGGSPD-PQISVTLQ   97 (98)
Q Consensus        72 ~~g~~~~l~C~~~~~~p~-~~~~W~~~   97 (98)
                      ..|....|.|.+.+.+|. ..+.|+++
T Consensus        13 ~~g~~~~L~C~a~gFyP~~i~v~W~~d   39 (93)
T cd05770          13 ENGKPNVLNCYVTGFHPPDIEIRLLKN   39 (93)
T ss_pred             cCCCceEEEEEEEEEeCCCCEEEEEEC
Confidence            346667899999988885 47899975


No 248
>KOG3515|consensus
Probab=93.98  E-value=0.081  Score=38.60  Aligned_cols=40  Identities=18%  Similarity=0.337  Sum_probs=29.8

Q ss_pred             CCCCCEEeC-CCCceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          57 PPQPPKISP-GANPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        57 ~~~~p~i~~-~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      +|-.|.+.. .-+..+..|+.+.|.|.+.+++|.+.+.|+.
T Consensus         4 ~p~~pv~~~~~l~~~~~~g~~v~l~C~v~~~pp~~~~eW~h   44 (741)
T KOG3515|consen    4 PPNVPVCESSSLTVGLRLGEDVPLPCRVNSNPPEIDVEWYH   44 (741)
T ss_pred             CCCCccccCCCCChhhccCCcceeeeecCCCCCCcceEEEe
Confidence            455555421 1233788999999999999888888999985


No 249
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=93.79  E-value=0.043  Score=29.54  Aligned_cols=29  Identities=10%  Similarity=0.151  Sum_probs=22.1

Q ss_pred             ceecCCCcEEEEEEcCCCC----CCCeEEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGS----PDPQISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~----p~~~~~W~~~   97 (98)
                      ..+.+|....|.|....+.    |.|.+.|+++
T Consensus         5 ~~~~~g~~~~l~Cp~~~~~~~~~~~p~i~Wyk~   37 (92)
T cd05757           5 QILFSTKGGKIVCPDLDDFKNENTLPPVQWYKD   37 (92)
T ss_pred             EEEeeccCCEEECCChHHccCCCCCCcEEEeEC
Confidence            4567888899999865332    5789999986


No 250
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=93.77  E-value=0.24  Score=33.87  Aligned_cols=38  Identities=21%  Similarity=0.403  Sum_probs=27.7

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      .++++.+.|++.+ |+|.|+|.+....  .......+.+.|
T Consensus        79 keYsf~~~Nvs~s-dEGrYrCIFYLn~--~EtyrH~I~vrV  116 (500)
T PHA02914         79 KEYSFIEENIGEH-EDGDFKCIFYLGD--NESHKHEILVRK  116 (500)
T ss_pred             ceeEEEecCcccc-cCCcEEEEEEeCC--ceeEEEEEEEEE
Confidence            4688999999999 9999999998742  234444444444


No 251
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=93.76  E-value=0.12  Score=28.15  Aligned_cols=24  Identities=17%  Similarity=0.039  Sum_probs=19.4

Q ss_pred             CCcEEEEEEcCCCCCCC-eEEEEec
Q psy5866          74 GRAIELVCSTSGGSPDP-QISVTLQ   97 (98)
Q Consensus        74 g~~~~l~C~~~~~~p~~-~~~W~~~   97 (98)
                      +....|.|.+.+.+|.. .++|.++
T Consensus        16 ~~~~tL~C~a~gFyP~~I~v~W~kn   40 (96)
T cd07697          16 QGQGIYLCLLENFFPDVIQVHWREG   40 (96)
T ss_pred             CCCEEEEEEEEEEeCCCeEEEEEEC
Confidence            45689999999888854 6899875


No 252
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=93.65  E-value=0.21  Score=27.14  Aligned_cols=29  Identities=17%  Similarity=0.310  Sum_probs=22.3

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      ++..+.+|+++.|+|.+.. .....+.|++
T Consensus         5 ~nvtv~~G~ta~L~C~v~~-~~~~~v~w~~   33 (95)
T cd05881           5 EDVTVVEGEVAIISCRVKN-NDDSVIQLLN   33 (95)
T ss_pred             CceEEcCCCcEEEEEEEcc-CCccEEEEEe
Confidence            4578899999999999864 4455677763


No 253
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=93.49  E-value=0.2  Score=27.86  Aligned_cols=31  Identities=26%  Similarity=0.482  Sum_probs=21.7

Q ss_pred             CCceecCCCcEEEEEEcCCCCC---CCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSP---DPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p---~~~~~W~~~   97 (98)
                      ....+.+|+.++|.|......+   ...+.|+++
T Consensus         6 ~~v~v~~G~~vtL~C~~s~~~~~~~~~~v~W~~~   39 (116)
T cd05715           6 REVYAVNGSDVRLKCTFSSSEPISDDISVTWSFQ   39 (116)
T ss_pred             CeEEEEcCCCeEEEeEEeCCCCcCCceEEEEEEe
Confidence            3457779999999998643222   246899865


No 254
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=93.45  E-value=0.19  Score=26.23  Aligned_cols=21  Identities=14%  Similarity=0.271  Sum_probs=13.6

Q ss_pred             EccceeeccCeEEEEEEEECCC
Q psy5866          20 ISNASFERDNGKFECRLKAAGS   41 (98)
Q Consensus        20 I~~v~~~~d~G~y~C~~~~~~~   41 (98)
                      +.....+ +.+.|+|++.+.+.
T Consensus        49 ~~~~~~d-~g~~~~C~v~h~~l   69 (82)
T cd05761          49 FQVDRED-DGAPIICRVDHPAL   69 (82)
T ss_pred             EEcchhh-CCCEEEEEEeChhc
Confidence            3333344 56799999988543


No 255
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=93.32  E-value=0.23  Score=26.91  Aligned_cols=25  Identities=16%  Similarity=0.291  Sum_probs=19.8

Q ss_pred             CCCcEEEEEEcCCCCCC-CeEEEEec
Q psy5866          73 EGRAIELVCSTSGGSPD-PQISVTLQ   97 (98)
Q Consensus        73 ~g~~~~l~C~~~~~~p~-~~~~W~~~   97 (98)
                      .+..+.|.|.+.+.+|. ..+.|+++
T Consensus        15 ~~~~~~L~C~a~gFyP~~i~vtW~k~   40 (95)
T cd04985          15 SSDSVTLGCLATGFLPEPVTFTWNSG   40 (95)
T ss_pred             CCCcEEEEEEEeeEECCCcEEEEeEC
Confidence            35568999999988885 47899875


No 256
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=93.28  E-value=0.17  Score=27.35  Aligned_cols=24  Identities=25%  Similarity=0.513  Sum_probs=19.5

Q ss_pred             CCcEEEEEEcCCCCCC-CeEEEEec
Q psy5866          74 GRAIELVCSTSGGSPD-PQISVTLQ   97 (98)
Q Consensus        74 g~~~~l~C~~~~~~p~-~~~~W~~~   97 (98)
                      ...+.|.|.+.+.+|. ..+.|+++
T Consensus        14 ~~~~~L~C~a~gFyP~~I~vtW~~d   38 (94)
T cd05847          14 SETIQLLCLISGYTPGTIEVEWLVD   38 (94)
T ss_pred             CCCEEEEEEEEeEECCCCEEEEEEC
Confidence            4558999999988886 67999875


No 257
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=93.19  E-value=0.24  Score=30.36  Aligned_cols=30  Identities=10%  Similarity=0.167  Sum_probs=24.0

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+.+|+++.|.|.-..+...+.+.|.++
T Consensus        24 ~v~V~ege~VtLsCs~t~s~~~~qVtWkK~   53 (189)
T PHA02987         24 KITVSEHVNVKISCNKTSSFNSILITWKKN   53 (189)
T ss_pred             EEEEcCCCCEEEEEecCCCCccceEEEEEc
Confidence            357899999999999643555778999986


No 258
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=93.16  E-value=0.3  Score=27.59  Aligned_cols=31  Identities=19%  Similarity=0.144  Sum_probs=21.9

Q ss_pred             CceecCCCcEEEEEEcCCCCCC--CeEEEEecC
Q psy5866          68 NPVATEGRAIELVCSTSGGSPD--PQISVTLQV   98 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~--~~~~W~~~~   98 (98)
                      ...+..|..++|+|.+.+..-.  -.+.|+||.
T Consensus         7 ~~lv~p~~sv~LsC~~sg~~~s~e~~~~wvRq~   39 (115)
T cd05721           7 PVLASSNGAASLVCEYTYNGFSKEFRASLLKGA   39 (115)
T ss_pred             CeEEcCCCCEEEEEEecCCccccEEEEEEEEeC
Confidence            4567788889999998532222  367899983


No 259
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=93.14  E-value=0.17  Score=27.89  Aligned_cols=30  Identities=13%  Similarity=0.303  Sum_probs=25.1

Q ss_pred             CCceecCCCcEEEEEEcCCCCCCCe-EEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSPDPQ-ISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p~~~-~~W~~~   97 (98)
                      ....+.+|+.+.|.|... .+|+|. +.|.+.
T Consensus        11 ~~~~v~~gE~~~L~V~ie-AYP~p~~~~W~~~   41 (101)
T cd05860          11 TTIFVNAGENLDLIVEYE-AYPKPEHQQWIYM   41 (101)
T ss_pred             ceEEEECCCCEEEEEEEE-eCCCCeeeEEEcC
Confidence            346789999999999985 689997 999864


No 260
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=93.10  E-value=0.28  Score=25.74  Aligned_cols=34  Identities=9%  Similarity=0.134  Sum_probs=19.0

Q ss_pred             EEEccceeeccCeEEEEEEEECCCCCeeeEeeEEE
Q psy5866          18 LIISNASFERDNGKFECRLKAAGSGQDLHSQVYTV   52 (98)
Q Consensus        18 l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l   52 (98)
                      |.+.....+ |...|.|++.+.+......+....|
T Consensus        48 l~~~~~~~d-~g~~~tC~v~h~~l~~~~~~~~~~~   81 (83)
T cd07705          48 VEFQVTRED-DGAEITCSVGHESLHDSDRSTSQRI   81 (83)
T ss_pred             EEEEecchh-CCCEEEEEEECcccCCCCceeEEEe
Confidence            334344455 6679999999864333333333333


No 261
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=92.94  E-value=0.14  Score=27.29  Aligned_cols=28  Identities=18%  Similarity=0.185  Sum_probs=23.0

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+.+|..+.|.|...  .+.+.+.|+++
T Consensus         5 ~~tv~~g~~v~L~C~~~--s~~A~v~W~~n   32 (85)
T cd05872           5 NRTVAPGADVVLPCQLR--SNLASPVWLFN   32 (85)
T ss_pred             EEEEecCCCEEEECCCC--CCCccEEEEEC
Confidence            45788999999999975  35679999876


No 262
>PF08204 V-set_CD47:  CD47 immunoglobulin-like domain;  InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ].; PDB: 2VSC_B 2JJS_D 2JJT_C.
Probab=92.82  E-value=0.2  Score=28.96  Aligned_cols=39  Identities=10%  Similarity=0.198  Sum_probs=23.7

Q ss_pred             CCCCeEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          11 PDSGRYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        11 ~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ...|+++|.+...+.  -.|.|+|.+...   ....+..+.|.+
T Consensus        81 l~kG~aSL~~~~~~a--~~GnYTCeVt~~---~~ege~~i~Lk~  119 (130)
T PF08204_consen   81 LLKGNASLKMDKSDA--VEGNYTCEVTEL---SREGETTIELKY  119 (130)
T ss_dssp             GGGTB--EEEEHHHH--H-EEEEEEEEET---TEEEEEEEEEEE
T ss_pred             hhCCCEEEEEcchhc--cccceEEEEEec---CCCceEEEEEEE
Confidence            346677898887544  479999999875   344444455544


No 263
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=92.67  E-value=0.29  Score=27.30  Aligned_cols=31  Identities=23%  Similarity=0.405  Sum_probs=21.7

Q ss_pred             CCceecCCCcEEEEEEcCCCCC---CCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGSP---DPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p---~~~~~W~~~   97 (98)
                      ....+.+|+++.|.|......+   ...+.|+++
T Consensus         6 ~~v~~~~G~~v~L~C~~s~~~~~~~~~~i~W~~~   39 (115)
T cd05880           6 KEVEAVNGTDVRLKCTFSSSAPIGDTLVITWNFR   39 (115)
T ss_pred             ceEEEEcCCCEEEEEEEEeCCCCCCcEEEEEEEE
Confidence            4567889999999998543222   246999754


No 264
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=91.90  E-value=0.33  Score=26.08  Aligned_cols=30  Identities=27%  Similarity=0.325  Sum_probs=22.9

Q ss_pred             CceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          68 NPVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ...+.+|+++.|.|..........+.|+++
T Consensus        10 ~v~~~~G~~v~L~C~~~~~~~~~~v~W~~~   39 (114)
T PF07686_consen   10 PVTVQEGESVTLPCSYSSSSNQSSVYWYRQ   39 (114)
T ss_dssp             EEEEETTSEEEEEEEEESSSSGSEEEEEEE
T ss_pred             eEEEecCCCEEEEEEEeCCCCcceEEEEEE
Confidence            457889999999999762234568999975


No 265
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=91.61  E-value=0.22  Score=25.98  Aligned_cols=26  Identities=23%  Similarity=0.368  Sum_probs=21.0

Q ss_pred             cCCCcEEEEEEcCCCCCCC-eEEEEec
Q psy5866          72 TEGRAIELVCSTSGGSPDP-QISVTLQ   97 (98)
Q Consensus        72 ~~g~~~~l~C~~~~~~p~~-~~~W~~~   97 (98)
                      ..+..+.|.|.+.+.+|.. .+.|+++
T Consensus         6 ~~~~~~~L~C~v~~f~P~~i~v~W~~~   32 (83)
T PF07654_consen    6 ELGGSVTLTCLVSGFYPKDITVTWLKN   32 (83)
T ss_dssp             HSTSEEEEEEEEEEEBSSTEEEEEEET
T ss_pred             cCCCCEEEEEEEEEEECCCcEEEEEec
Confidence            3478899999999888855 7999864


No 266
>PHA02982 hypothetical protein; Provisional
Probab=91.27  E-value=0.42  Score=29.95  Aligned_cols=32  Identities=16%  Similarity=0.268  Sum_probs=25.5

Q ss_pred             EEEeCCCCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866           7 IDYRPDSGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus         7 ~~~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..+..+....+|+|.+++++ ..|-|+|++...
T Consensus        91 y~~sv~g~~STLTIkk~~i~-N~GCYtc~~ks~  122 (251)
T PHA02982         91 YALSVSGNSSTFTMKKPDPQ-NLGCFTCEAKDA  122 (251)
T ss_pred             EEEEEeccceeEEeccCCcc-cCCceEEEEecC
Confidence            33444455668999999999 999999999873


No 267
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=91.17  E-value=0.18  Score=26.62  Aligned_cols=21  Identities=14%  Similarity=0.487  Sum_probs=17.5

Q ss_pred             EEEccceeeccCeEEEEEEEEC
Q psy5866          18 LIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        18 l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      |.|...... |.|.|+|++.+.
T Consensus        64 l~v~~~~~~-~~~~y~C~v~h~   84 (95)
T cd00098          64 LTVSPSDWN-SGDTYTCVVTHE   84 (95)
T ss_pred             EEECHHHhC-CCCCEEEEEEeC
Confidence            567777777 999999999985


No 268
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=91.01  E-value=0.53  Score=26.31  Aligned_cols=31  Identities=16%  Similarity=0.019  Sum_probs=21.7

Q ss_pred             CCceecCCCcEEEEEEcCCCC-----CCCeEEEEec
Q psy5866          67 ANPVATEGRAIELVCSTSGGS-----PDPQISVTLQ   97 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~-----p~~~~~W~~~   97 (98)
                      ....+.+|+.+.|.|.-....     ....+.|++|
T Consensus         7 ~~v~~~~G~~VtL~C~f~~~~~~~~~~~~~~~Wykq   42 (119)
T cd05712           7 KSVSVQEGLCVLIPCSFSYPADWPVSNGVHGIWYKG   42 (119)
T ss_pred             CEEEEeccccEEEEEEeeCcccccCCCceEEEEEeC
Confidence            346788999999999753221     1245899987


No 269
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=89.62  E-value=0.88  Score=24.98  Aligned_cols=27  Identities=26%  Similarity=0.383  Sum_probs=20.8

Q ss_pred             ecCCCcEEEEEEcCCCC-CC-CeEEEEec
Q psy5866          71 ATEGRAIELVCSTSGGS-PD-PQISVTLQ   97 (98)
Q Consensus        71 ~~~g~~~~l~C~~~~~~-p~-~~~~W~~~   97 (98)
                      ...+..++|+|.+.+.+ |. ..+.|.++
T Consensus        16 l~~~~~atLtClV~~f~~P~~i~V~W~~~   44 (99)
T cd04986          16 LLLGSSASLTCTLSGLRDPEGAVFTWTPS   44 (99)
T ss_pred             hCcCCccEEEEEEeccCCCCCeEEEEEEC
Confidence            33567799999998877 74 57999875


No 270
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=88.44  E-value=1.5  Score=24.20  Aligned_cols=28  Identities=14%  Similarity=0.067  Sum_probs=20.7

Q ss_pred             ceecCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          69 PVATEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        69 ~~~~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ..+.+|+++.|.|.-. ......++|+|.
T Consensus         8 ~~~~~G~~V~L~v~~~-p~~~~~~~W~kg   35 (105)
T cd05774           8 PQVAEGENVLLLVHNL-PENLLAYAWYKG   35 (105)
T ss_pred             CcccCCCCEEEEecCC-CCCceEEEEEcC
Confidence            4677899999999753 233448999974


No 271
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=87.96  E-value=2.2  Score=22.55  Aligned_cols=36  Identities=14%  Similarity=0.125  Sum_probs=21.8

Q ss_pred             EEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      +|++ ..+.+||...|.|++.+.+-.  .......|.|+
T Consensus        45 ~L~~-~p~~eDdG~~~~C~a~~~~l~--~~~~~~~L~V~   80 (82)
T cd05883          45 QLML-KVTKEDDGVPVICLVDHPAVK--DLQTQRYLEVQ   80 (82)
T ss_pred             EEEE-ECchhhCCCEEEEEEcCcccC--CceeeEEEEEE
Confidence            3455 455552555999999986432  24555666665


No 272
>cd05890 Ig2_Nectin-1_like Second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig2_Nectin-1_like: domain similar to the second immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. Nectins also heterophilically trans-interact with other CAMs such as nectin-like molecules (necls); nectin-1 for example, has been shown to trans-interact with necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is associ
Probab=87.67  E-value=1.2  Score=24.36  Aligned_cols=21  Identities=14%  Similarity=0.417  Sum_probs=17.7

Q ss_pred             EEEEEEcCCCCCCCeEEEEec
Q psy5866          77 IELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        77 ~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      +-..|.+.+|+|++.++|.-.
T Consensus        23 ~VA~CiSa~GrPpa~ItW~t~   43 (98)
T cd05890          23 LVATCVSANGKPPSVVRWDTR   43 (98)
T ss_pred             EEEEEEcCCCcCCcEeEEEcc
Confidence            457899889999999999743


No 273
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=85.46  E-value=4.7  Score=27.92  Aligned_cols=36  Identities=17%  Similarity=0.136  Sum_probs=26.3

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      ..+|+|.++..+ ..|-|+|++...   .......-.|.|
T Consensus       345 ~STLTIkka~I~-N~GCY~~~a~~g---~~~~ec~~Cl~V  380 (500)
T PHA02914        345 NSTLTIKKAHIN-NAGCYEAQAFMG---KFKEECRHCFKV  380 (500)
T ss_pred             hceEEeeeEEEE-cCCceEEEEecC---cchhhhhhheEe
Confidence            347999999999 999999999873   344444444444


No 274
>PHA03283 envelope glycoprotein E; Provisional
Probab=85.16  E-value=12  Score=26.85  Aligned_cols=77  Identities=18%  Similarity=0.203  Sum_probs=46.0

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCC-----CEE--------------eCCCCceecCCCc
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQP-----PKI--------------SPGANPVATEGRA   76 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~-----p~i--------------~~~~~~~~~~g~~   76 (98)
                      -.|.|.+++.+ ++|.|+-...+.   .......+.++|..++..     |..              ..=.+....+|++
T Consensus       134 ~~l~I~~at~~-~aGVYtly~r~d---~~~~~~vflvtVk~~~~~~~~~Pp~~~pv~P~~h~a~f~v~nYhS~vf~~GDt  209 (542)
T PHA03283        134 SVLQIQRATPN-IAGVYTLHVSSD---GMMKHSVFFVTVKKPPKQPQTPPAPLVPQVPARHHTDFHVRGYHSRVYSPGDS  209 (542)
T ss_pred             CeeEEEecccc-cCeEEEEEecCC---CceEEEEEEEEecCCCcCCCCCCCCccccCCccCCceEEEecceeEEecCCCc
Confidence            45999999999 999999988864   234444455666541111     110              1112345778888


Q ss_pred             EEEEEEcCCCC----CCCeEEEEe
Q psy5866          77 IELVCSTSGGS----PDPQISVTL   96 (98)
Q Consensus        77 ~~l~C~~~~~~----p~~~~~W~~   96 (98)
                      +.++-......    -...+.|+.
T Consensus       210 f~lsi~l~s~~~d~~fs~~i~Wyy  233 (542)
T PHA03283        210 FDLSVHLESDIGDPSFSATIDWYY  233 (542)
T ss_pred             eeEeEEEeeccCCCCceEEEEEEE
Confidence            87765543222    135688874


No 275
>PF01688 Herpes_gI:  Alphaherpesvirus glycoprotein I;  InterPro: IPR002874 This family consists of glycoprotein I from various members of the alphaherpesvirinae. These include Human herpesvirus 1 (HHV-1), Human herpesvirus 3 (HHV-3) and Suid herpesvirus 1 (Pseudorabies virus). Glycoprotein I (gI) is important during natural infection, mutants lacking gI produce smaller lesions at the site of infection and show reduced neuronal spread []. gI forms a heterodimeric complex with gE; this complex displays Fc receptor activity (binds to the Fc region of immunoglobulin) []. Glycoproteins are also important in the production of virus-neutralizing antibodies and cell mediated immunity []. The alphaherpesviridae have a dsDNA genome and have no RNA stage during viral replication.; GO: 0033643 host cell part
Probab=84.24  E-value=4.5  Score=24.29  Aligned_cols=26  Identities=27%  Similarity=0.208  Sum_probs=22.0

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      +...-|+|++-+++ |+|.|.-++.-.
T Consensus       121 ~~~~lL~i~~p~~~-dsG~Y~lRV~l~  146 (161)
T PF01688_consen  121 ENGVLLRIRNPRPE-DSGIYYLRVWLD  146 (161)
T ss_pred             CcceEEEeCCCCcc-cceEEEEEEEEC
Confidence            33456999999999 999999999875


No 276
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=83.50  E-value=2.5  Score=22.14  Aligned_cols=22  Identities=18%  Similarity=0.244  Sum_probs=13.6

Q ss_pred             EEEccceeeccCeEEEEEEEECC
Q psy5866          18 LIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        18 l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      |.+..-... +...|.|++.+.+
T Consensus        48 L~~~~~~~d-~g~~ytC~v~h~~   69 (83)
T cd05884          48 LDFRVDRSD-DGVAIICRVDHES   69 (83)
T ss_pred             EEEEccccc-CCCEEEEEEechh
Confidence            344433344 5569999998853


No 277
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=82.61  E-value=1.9  Score=22.09  Aligned_cols=22  Identities=14%  Similarity=0.285  Sum_probs=16.8

Q ss_pred             EEEEEccceeeccCeEEEEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      -+|.|..+..+ ..|.|.|.+.+
T Consensus        33 ~tlnLGs~~~D-PRG~Y~C~~s~   54 (69)
T cd07691          33 TLLDLGSRIND-PRGTYSCKESE   54 (69)
T ss_pred             cEEeccCcccC-CCcceEecCcc
Confidence            45667777777 89999998754


No 278
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=81.29  E-value=4.7  Score=22.62  Aligned_cols=30  Identities=20%  Similarity=0.235  Sum_probs=21.3

Q ss_pred             CCceecCCCcEEEEEEcCCCC---CCCeEEEEe
Q psy5866          67 ANPVATEGRAIELVCSTSGGS---PDPQISVTL   96 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~---p~~~~~W~~   96 (98)
                      ....+..|+.+.|.|......   +...+.|..
T Consensus         6 ~ev~a~~G~~v~L~C~f~~~~~~~~~~~v~W~~   38 (116)
T cd05879           6 REVYGTVGSDVTLSCSFWSSEWISDDISFTWHY   38 (116)
T ss_pred             ceEEEEcCCcEEEEEEEecCCCCCCcEEEEEEE
Confidence            446788899999999975322   345799943


No 279
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=80.88  E-value=1.7  Score=28.11  Aligned_cols=24  Identities=21%  Similarity=0.319  Sum_probs=20.5

Q ss_pred             EEEEEccceeeccCeEEEEEEEECC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAG   40 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~   40 (98)
                      ..|.+.+...+ ++|.|+|...-..
T Consensus        37 G~L~~~~F~es-mSG~YTCtLsYk~   60 (271)
T PF07354_consen   37 GKLMFKNFQES-MSGSYTCTLSYKP   60 (271)
T ss_pred             ceEEeeccccc-cCCceEEEEEEEe
Confidence            35999999999 9999999987653


No 280
>KOG1480|consensus
Probab=80.80  E-value=0.71  Score=34.16  Aligned_cols=24  Identities=33%  Similarity=0.649  Sum_probs=21.1

Q ss_pred             eEEEEEccceeeccCeEEEEEEEEC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ...+.|..+... |.|.|+|++.+-
T Consensus       182 d~~li~~~arls-d~~nytc~a~ni  205 (909)
T KOG1480|consen  182 DHNLIISQARLS-DSGNYTCEATNI  205 (909)
T ss_pred             cCCccccchhhh-hcccceeeeehh
Confidence            446889999999 999999999884


No 281
>PHA03290 envelope glycoprotein I; Provisional
Probab=78.21  E-value=8.7  Score=25.88  Aligned_cols=26  Identities=15%  Similarity=0.221  Sum_probs=22.2

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ....-|+|++-+++ |+|.|.-++.-.
T Consensus       126 e~~vLL~I~~P~~~-DSGiY~LRV~Ld  151 (357)
T PHA03290        126 DAEIIFKINKPGIE-DAGIYLLLVQLD  151 (357)
T ss_pred             CcceEEEeCCCCcc-cCeeEEEEEEeC
Confidence            33456999999999 999999999875


No 282
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=76.56  E-value=5.1  Score=20.30  Aligned_cols=21  Identities=19%  Similarity=0.610  Sum_probs=14.4

Q ss_pred             EEEccceeeccCeEEEEEEEEC
Q psy5866          18 LIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        18 l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      |.|.....+ +...|+|.+...
T Consensus        50 L~v~~~~~~-~~~~~tC~V~H~   70 (75)
T smart00407       50 LTVSASTWE-SGDTYTCQVTHE   70 (75)
T ss_pred             EEEccccCC-CCCEEEEEEEEc
Confidence            344444556 777999999874


No 283
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=71.20  E-value=7.1  Score=26.32  Aligned_cols=22  Identities=14%  Similarity=0.181  Sum_probs=18.7

Q ss_pred             cEEEEEEcCCCCCCC-eEEEEec
Q psy5866          76 AIELVCSTSGGSPDP-QISVTLQ   97 (98)
Q Consensus        76 ~~~l~C~~~~~~p~~-~~~W~~~   97 (98)
                      .+.|+|.|.+.+|.. .+.|.++
T Consensus       216 ~~tL~C~A~GFYP~~I~v~W~kd  238 (338)
T PHA02865        216 NTTLFCTFDSHYPSSVAAKWYNS  238 (338)
T ss_pred             CceEEEEEEeEeCCccEEEEEec
Confidence            579999999999954 7899876


No 284
>PHA03286 envelope glycoprotein E; Provisional
Probab=71.17  E-value=34  Score=24.24  Aligned_cols=78  Identities=15%  Similarity=0.120  Sum_probs=47.2

Q ss_pred             EEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECC----CCCCE-------------EeCCCCceecCCCcEE
Q psy5866          16 YDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTP----PQPPK-------------ISPGANPVATEGRAIE   78 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~----~~~p~-------------i~~~~~~~~~~g~~~~   78 (98)
                      -.|.|.+++.+ ++|+|+-...+..  .......+.+.|...    +.++.             +..-.+.....|+++.
T Consensus       127 ~~L~I~nAt~q-naGiYtly~rnd~--~~~~~~vflVtV~~~~~~r~p~~~~pv~p~~~~~~f~l~ny~S~lF~~GDTF~  203 (492)
T PHA03286        127 KELTILNASSQ-NAGIYIRYSRNGT--RTAVMDVLVVWVSGHGRARDPTMNIPITPPSTRVDLSLKNFKAFLYNVGDTVD  203 (492)
T ss_pred             CceEEeecccc-ccceEEEEEcCCC--CcEEEEEEEEEEecCCCCCCCCcccCCCCcccceEEEEecccceEecCCCeEE
Confidence            35999999999 9999999887641  244555556666311    11111             1111345677889887


Q ss_pred             EEEEcC----CCCCCCeEEEEe
Q psy5866          79 LVCSTS----GGSPDPQISVTL   96 (98)
Q Consensus        79 l~C~~~----~~~p~~~~~W~~   96 (98)
                      ++-...    .+.-...+.|+.
T Consensus       204 vSv~l~~~~~d~~Fsl~i~W~y  225 (492)
T PHA03286        204 ASVTAHLTNWAGAFSLEFRVLF  225 (492)
T ss_pred             EEEEEeecccCCCceEEEEEEE
Confidence            666543    122245788874


No 285
>PHA03292 envelope glycoprotein I; Provisional
Probab=70.55  E-value=14  Score=25.36  Aligned_cols=24  Identities=25%  Similarity=0.278  Sum_probs=21.3

Q ss_pred             eEEEEEccceeeccCeEEEEEEEEC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..-|+|++-+++ |+|.|.-++.-.
T Consensus       127 ~vLL~I~~P~~~-DSGiY~LRV~Ld  150 (413)
T PHA03292        127 NVLLNITGPQPA-DSGAYILRVKLD  150 (413)
T ss_pred             ceEEEeCCCCcc-cceeEEEEEEeC
Confidence            356999999999 999999999875


No 286
>PHA03289 envelope glycoprotein I; Provisional
Probab=68.50  E-value=16  Score=24.61  Aligned_cols=24  Identities=25%  Similarity=0.310  Sum_probs=21.3

Q ss_pred             eEEEEEccceeeccCeEEEEEEEEC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..-|+|++-+++ |+|.|.-++.-.
T Consensus       121 gvLL~I~~Pr~~-DSGiYyLRV~Ld  144 (352)
T PHA03289        121 GLLLTIIEPRMS-DTGIYYIRVSLA  144 (352)
T ss_pred             ceEEEeCCCCcc-cCeeEEEEEEeC
Confidence            446899999999 999999999875


No 287
>PHA03042 CD47-like protein; Provisional
Probab=68.48  E-value=27  Score=22.97  Aligned_cols=23  Identities=13%  Similarity=0.268  Sum_probs=15.2

Q ss_pred             eEEEEEccceeeccCeEEEEEEEEC
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ..+|+..... . -.|.|+|++...
T Consensus        70 ~aSL~~~f~~-~-l~GNYTCEv~~l   92 (286)
T PHA03042         70 TSSLKFNFSK-N-LSGNYTCEAINK   92 (286)
T ss_pred             ceEEEEeccc-c-CCCceeEEEeec
Confidence            3456554432 2 479999999875


No 288
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=65.42  E-value=7.4  Score=19.72  Aligned_cols=22  Identities=23%  Similarity=0.474  Sum_probs=13.5

Q ss_pred             cCCCcEEEEEEcCCCCCCCeEEEEec
Q psy5866          72 TEGRAIELVCSTSGGSPDPQISVTLQ   97 (98)
Q Consensus        72 ~~g~~~~l~C~~~~~~p~~~~~W~~~   97 (98)
                      ..|..++|+|....    ..+.|.++
T Consensus         5 isGTtVtlTCP~~~----~~i~W~~n   26 (65)
T cd07692           5 ISGTTVTVTCPLSG----DDIKWKKN   26 (65)
T ss_pred             EeccEEEEECCCCC----CCceEEeC
Confidence            45777888886432    12777654


No 289
>PHA03052 Hypothetical protein; Provisional
Probab=64.42  E-value=17  Score=18.64  Aligned_cols=29  Identities=17%  Similarity=0.286  Sum_probs=20.2

Q ss_pred             CceecCCCcEEEEEEcCCCCCC--CeEEEEe
Q psy5866          68 NPVATEGRAIELVCSTSGGSPD--PQISVTL   96 (98)
Q Consensus        68 ~~~~~~g~~~~l~C~~~~~~p~--~~~~W~~   96 (98)
                      ...+..|..+++.|.+.-|.|.  +.+.|..
T Consensus         6 ~i~~slGs~ltI~Ckv~lg~g~~~a~V~W~~   36 (69)
T PHA03052          6 GIVTSLGSNLTITCKVSLRPPTTDADVFWIS   36 (69)
T ss_pred             cEEEEccCCceEeEEEEecCCCcceEEEEEe
Confidence            3566788999999998755553  3466653


No 290
>PF05790 C2-set:  Immunoglobulin C2-set domain;  InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C2-set domains, which are Ig-like domains resembling the antibody constant domain. C2-set domains are found primarily in the mammalian T-cell surface antigens CD2 (Cluster of Differentiation 2), CD4 and CD80, as well as in vascular (VCAM) and intercellular (ICAM) cell adhesion molecules. CD2 mediates T-cell adhesion via its ectodomain, and signal transduction utilising its 117-amino acid cytoplasmic tail []. CD2 displays structural and functional similarities with African swine fever virus (ASFV) LMW8-DR, a protein that is involved in cell-cell adhesion and immune response modulation, suggesting a possible role in the pathogenesis of ASFV infection []. CD4 is the primary receptor for HIV-1. CD4 has four immunoglobulin-like domains in its extracellular region that share the same structure, but can differ in sequence. Certain extracellular domains may be involved in dimerisation [].; GO: 0007155 cell adhesion, 0016021 integral to membrane; PDB: 1CID_A 1CDU_A 1WIQ_B 2NY4_B 2NY2_B 1WIP_B 1WIO_A 3S4S_G 1CDY_A 3S5L_G ....
Probab=64.09  E-value=20  Score=18.82  Aligned_cols=20  Identities=20%  Similarity=0.405  Sum_probs=15.3

Q ss_pred             EEEccceeeccCeEEEEEEEE
Q psy5866          18 LIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        18 l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      +........ |+|...|.|..
T Consensus        45 ~~~~~~~~~-d~G~w~C~a~~   64 (80)
T PF05790_consen   45 VSTFTPTTE-DSGTWVCTASD   64 (80)
T ss_dssp             EEEESBTCG-GSEEEEEEEEE
T ss_pred             EEEecCCCC-CCEEEEEEEcC
Confidence            345566678 99999999953


No 291
>PF06214 SLAM:  Signaling lymphocytic activation molecule (SLAM) protein;  InterPro: IPR010407 This entry is found in several mammalian signalling lymphocytic activation molecule (SLAM) proteins. Optimal T cell activation and expansion require engagement of the TCR plus co-stimulatory signals delivered through accessory molecules. SLAM, a 70 kDa co-stimulatory molecule belonging to the Ig superfamily, is defined as a human cell surface molecule that mediates CD28-independent proliferation of human T cells and IFN-gamma production by human Th1 and Th2 clones []. SLAM has also been recognised as a receptor for Measles virus [].; GO: 0004872 receptor activity, 0046649 lymphocyte activation, 0009986 cell surface, 0016021 integral to membrane; PDB: 3ALX_D 3ALZ_B 3ALW_A.
Probab=60.80  E-value=21  Score=20.23  Aligned_cols=21  Identities=29%  Similarity=0.316  Sum_probs=14.4

Q ss_pred             EEEEEccceeeccCeEEEEEEE
Q psy5866          16 YDLIISNASFERDNGKFECRLK   37 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~   37 (98)
                      .+|.|..-+.+ |+|+|.-...
T Consensus       103 LsL~Il~SrkE-~EGWYfmtlE  123 (126)
T PF06214_consen  103 LSLEILESRKE-DEGWYFMTLE  123 (126)
T ss_dssp             TEEEETT--GG-G-EEEEEEEE
T ss_pred             ceeehhccccc-cCceEEEEee
Confidence            46899999999 9999976554


No 292
>PHA03282 envelope glycoprotein E; Provisional
Probab=60.46  E-value=21  Score=25.38  Aligned_cols=38  Identities=18%  Similarity=0.208  Sum_probs=25.3

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTV   54 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v   54 (98)
                      +.+|.|.+++.+ |+|.|.-.+..... ...+...+.|.|
T Consensus       123 n~tl~l~~a~~~-DsG~Y~L~~~~~~~-~~~~~~~v~l~V  160 (540)
T PHA03282        123 NGTLVLREARET-DSGMYVLSVSRAPN-STAARAVVFLVV  160 (540)
T ss_pred             cceEEEeecccc-CCceEEEEecCCCC-chhheEEEEEEe
Confidence            446999999999 99999988654211 122344455555


No 293
>PF11327 DUF3129:  Protein of unknown function (DUF3129);  InterPro: IPR021476  This eukaryotic family of proteins has no known function. 
Probab=56.98  E-value=32  Score=21.10  Aligned_cols=31  Identities=23%  Similarity=0.613  Sum_probs=23.6

Q ss_pred             CCCCeEEEEEccceeeccCeEEEEEEEECCCC
Q psy5866          11 PDSGRYDLIISNASFERDNGKFECRLKAAGSG   42 (98)
Q Consensus        11 ~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~~~   42 (98)
                      ...+...+++..|.-+ =+|.|+|.......+
T Consensus        88 ~~gG~i~mt~hQVN~D-GaGP~~C~iD~tg~g  118 (184)
T PF11327_consen   88 TAGGSISMTIHQVNAD-GAGPFTCDIDETGTG  118 (184)
T ss_pred             cCCCEEEEEEEEecCC-CCcCeEEEECCCCCc
Confidence            3466778888888876 699999999775443


No 294
>PHA03291 envelope glycoprotein I; Provisional
Probab=55.89  E-value=50  Score=22.68  Aligned_cols=25  Identities=16%  Similarity=-0.012  Sum_probs=21.7

Q ss_pred             CeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          14 GRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        14 ~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      ...-|+|.+...+ |+|.|.-++...
T Consensus       127 ~~vLL~i~~P~~~-DsGiYvLRV~vd  151 (401)
T PHA03291        127 RQPLLRARGAARA-VVGLYVLRVWVE  151 (401)
T ss_pred             cceEEEecCCCcc-cceeEEEEEEeC
Confidence            3456899999999 999999999875


No 295
>PF10651 DUF2479:  Domain of unknown function (DUF2479);  InterPro: IPR018913  This domain is found in phage from a number of different bacteria including (Listeria phage A118 (Bacteriophage A118)). It is thought to be a putative long tail fibre protein.; PDB: 4DIV_L 3UH8_A.
Probab=50.80  E-value=53  Score=19.64  Aligned_cols=46  Identities=20%  Similarity=0.305  Sum_probs=28.2

Q ss_pred             EeCCCCeEEEEEccceeeccCeEEEEEEEECC--CCCeeeEeeEEEEEE
Q psy5866           9 YRPDSGRYDLIISNASFERDNGKFECRLKAAG--SGQDLHSQVYTVTVL   55 (98)
Q Consensus         9 ~~~~~~~~~l~I~~v~~~~d~G~y~C~~~~~~--~~~~~~~~~~~l~v~   55 (98)
                      .+..+|.+...|.+-.+. ..|.|.|.+....  .+.......+.+.|.
T Consensus        77 ~d~~~G~i~y~lp~~~l~-~~G~v~a~~~i~~~~~~~~~~t~~F~F~V~  124 (170)
T PF10651_consen   77 VDPTNGIIQYTLPDEFLK-HVGKVKAQLFIYYNGDGQSISTANFTFEVE  124 (170)
T ss_dssp             EETTTTEEEEE--TTTTH-SSEEEEEEEEEEEESSSEEEE---EEEEEE
T ss_pred             EcCcCcEEEEEECHHHhc-cCcEEEEEEEEEECCCCCEEEEeeEEEEEe
Confidence            356788888999888888 8999999876543  223334444555554


No 296
>PHA03282 envelope glycoprotein E; Provisional
Probab=50.40  E-value=56  Score=23.41  Aligned_cols=26  Identities=19%  Similarity=0.323  Sum_probs=22.3

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .+..+|.+.|+..+ ++|.|-|.+..+
T Consensus       330 ~n~VdL~F~nAp~s-aSGLYVfVl~yN  355 (540)
T PHA03282        330 GHTVNLQLRDASEA-SGGLYVCVVYVN  355 (540)
T ss_pred             CCccceEecCCCcc-cCceEEEEEEEC
Confidence            44558999999999 999999998874


No 297
>COG5475 Uncharacterized small protein [Function unknown]
Probab=50.36  E-value=26  Score=17.21  Aligned_cols=21  Identities=29%  Similarity=0.488  Sum_probs=14.9

Q ss_pred             EEEEEccceeeccCeEEEEEEEEC
Q psy5866          16 YDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        16 ~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      -..+|+..+.+   |.|+|+-.+.
T Consensus        18 P~Mtvs~~ss~---Gmy~C~Wf~g   38 (60)
T COG5475          18 PRMTVSGYSSD---GMYECRWFDG   38 (60)
T ss_pred             ceEEEeccccC---CeEEEEEecC
Confidence            34677776543   9999998764


No 298
>KOG4597|consensus
Probab=49.28  E-value=24  Score=25.19  Aligned_cols=37  Identities=16%  Similarity=0.319  Sum_probs=28.0

Q ss_pred             eEEEEEccceeeccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      -..|.|-+.... |+|+|.|.+.+-   .......+.+.+.
T Consensus       256 tcql~ic~ewq~-~a~w~tCs~rcg---~g~~~rdv~c~s~  292 (560)
T KOG4597|consen  256 TCQLVICNEWQA-DAGWYTCSARCG---AGFLRRDVPCSSV  292 (560)
T ss_pred             eeeEEEcchhhc-CCCceeeccccc---cceeeccceeeee
Confidence            456888899999 999999999883   5555556666553


No 299
>PF10572 UPF0556:  Uncharacterised protein family UPF0556;  InterPro: IPR018887  This family of proteins has no known function. 
Probab=48.94  E-value=58  Score=19.59  Aligned_cols=30  Identities=20%  Similarity=0.344  Sum_probs=18.6

Q ss_pred             eccCeEEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          26 ERDNGKFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        26 ~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      ++|.+.|.|.+....+........+.+.|.
T Consensus        69 s~d~~~~sC~I~RPqgkSYL~F~qFkaev~   98 (158)
T PF10572_consen   69 SDDNGHYSCIIWRPQGKSYLFFTQFKAEVK   98 (158)
T ss_pred             cCCCCceEEEEECCCCCcEEEEEEEEEEEe
Confidence            337889999988754333444445555554


No 300
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=43.48  E-value=53  Score=23.12  Aligned_cols=26  Identities=23%  Similarity=0.199  Sum_probs=19.1

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .+...|++.|+..+ ++|.|-|.+..+
T Consensus       266 ~~~~~l~f~~a~~~-~sGLYv~V~~~n  291 (439)
T PF02480_consen  266 SNGVDLQFTNAPES-ASGLYVFVVYYN  291 (439)
T ss_dssp             TTSSSEEESS--GG-G-EEEEEEEEET
T ss_pred             CCCcceEecCCCcc-cCceEEEEEEEC
Confidence            34456999999999 999999999874


No 301
>PHA03112 IL-18 binding protein; Provisional
Probab=41.29  E-value=65  Score=19.03  Aligned_cols=26  Identities=15%  Similarity=0.224  Sum_probs=18.8

Q ss_pred             ecCCCcEEEEEEcCCCCCC-CeEEEEe
Q psy5866          71 ATEGRAIELVCSTSGGSPD-PQISVTL   96 (98)
Q Consensus        71 ~~~g~~~~l~C~~~~~~p~-~~~~W~~   96 (98)
                      ..+++.+.|+|.+....|. .-+.|+.
T Consensus        35 ~k~~~~vvL~C~gcs~fp~fS~lYWl~   61 (141)
T PHA03112         35 TKETEKVVLECRGCSYFPKFSYVYWLI   61 (141)
T ss_pred             cCCCCEEEEEEECccCCCCceEEEEEc
Confidence            4458889999998744454 5678984


No 302
>PHA03240 envelope glycoprotein M; Provisional
Probab=38.60  E-value=15  Score=23.26  Aligned_cols=19  Identities=26%  Similarity=0.469  Sum_probs=16.0

Q ss_pred             eEEEEEccceeeccCeEEEE
Q psy5866          15 RYDLIISNASFERDNGKFEC   34 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C   34 (98)
                      +.+|.|.++..+ |+|+|.-
T Consensus       104 NstL~i~~vn~s-d~~nYcr  122 (258)
T PHA03240        104 NSTLIIAHLNLS-DAGEYCR  122 (258)
T ss_pred             cceEEEEEEeec-Ccchhhh
Confidence            457999999999 9999743


No 303
>PF06328 Lep_receptor_Ig:  Ig-like C2-type domain;  InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) []. The two cysteine residues form a disulphide bridge.; PDB: 3L5H_A 1P9M_A 1I1R_A 2D9Q_B.
Probab=38.34  E-value=66  Score=17.18  Aligned_cols=30  Identities=23%  Similarity=0.384  Sum_probs=19.2

Q ss_pred             CCceecCCCcEEEEEEcCCCCC----CCeEEEEe
Q psy5866          67 ANPVATEGRAIELVCSTSGGSP----DPQISVTL   96 (98)
Q Consensus        67 ~~~~~~~g~~~~l~C~~~~~~p----~~~~~W~~   96 (98)
                      +...+..|.+++.+|....+..    +..+.|..
T Consensus        11 ~~pvv~lGS~vtasC~l~~~c~~~~~a~~I~Wkl   44 (89)
T PF06328_consen   11 PSPVVSLGSNVTASCVLKQNCSHSVNASQIVWKL   44 (89)
T ss_dssp             SSSEEETTS-EEEEEEE-CCCHCT-STTCEEEEC
T ss_pred             CCCEEeCCCCEEEEEEEECCCCCCcccceEEEEE
Confidence            3456778999999999765433    34577764


No 304
>PHA03286 envelope glycoprotein E; Provisional
Probab=37.21  E-value=1.1e+02  Score=21.94  Aligned_cols=22  Identities=18%  Similarity=0.166  Sum_probs=19.8

Q ss_pred             EEEEccceeeccCeEEEEEEEEC
Q psy5866          17 DLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      +|++.|+..+ ++|.|-|.+.-.
T Consensus       308 nL~f~nA~~s-~SGLYVfVl~yN  329 (492)
T PHA03286        308 SFRLANAQPT-DAGLYVVVALYN  329 (492)
T ss_pred             ceeecCCCcc-cCceEEEEEEEC
Confidence            4899999999 999999998874


No 305
>PF01082 Cu2_monooxygen:  Copper type II ascorbate-dependent monooxygenase, N-terminal domain;  InterPro: IPR000323 Copper type II, ascorbate-dependent monooxygenases [] are a class of enzymes that requires copper as a cofactor and which uses ascorbate as an electron donor. This family contains two related enzymes, Dopamine-beta-monooxygenase (1.14.17.1 from EC) and Peptidyl-glycine alpha-amidating monooxygenase (1.14.17.3 from EC). There are a few regions of sequence similarities between these two enzymes, two of these regions contain clusters of conserved histidine residues which are most probably involved in binding copper.; GO: 0004497 monooxygenase activity, 0005507 copper ion binding, 0016715 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced ascorbate as one donor, and incorporation of one atom of oxygen, 0055114 oxidation-reduction process; PDB: 1YI9_A 3MLL_A 1SDW_A 3MID_A 1YIP_A 3PHM_A 3MIC_A 3MIB_A 1OPM_A 3MIG_A ....
Probab=33.10  E-value=76  Score=18.15  Aligned_cols=24  Identities=17%  Similarity=0.372  Sum_probs=15.9

Q ss_pred             eEEEEEccc-eeeccCeEEEEEEEEC
Q psy5866          15 RYDLIISNA-SFERDNGKFECRLKAA   39 (98)
Q Consensus        15 ~~~l~I~~v-~~~~d~G~y~C~~~~~   39 (98)
                      .+.|+..++ -+. +...|.|.+...
T Consensus         3 ~~dl~~~~v~vP~-~~t~Y~C~~~~l   27 (132)
T PF01082_consen    3 TFDLLMPNVTVPS-QDTTYWCFVFKL   27 (132)
T ss_dssp             -EEEE-SSB---S-SSSEEEEEEEE-
T ss_pred             eEEEEcCCcCcCC-CCCeEEEEEEEC
Confidence            466888889 555 778999998874


No 306
>TIGR00864 PCC polycystin cation channel protein. Note: this model has been restricted to the amino half because for technical reasons.
Probab=32.70  E-value=3.8e+02  Score=24.24  Aligned_cols=70  Identities=20%  Similarity=0.285  Sum_probs=44.9

Q ss_pred             ceeeccCeEEEEEEEECCCCCeeeEeeEEEEEECCCCCCEEeCCCCceecCCCcEEEEEEcCCCCCCCeEEEEe
Q psy5866          23 ASFERDNGKFECRLKAAGSGQDLHSQVYTVTVLTPPQPPKISPGANPVATEGRAIELVCSTSGGSPDPQISVTL   96 (98)
Q Consensus        23 v~~~~d~G~y~C~~~~~~~~~~~~~~~~~l~v~~~~~~p~i~~~~~~~~~~g~~~~l~C~~~~~~p~~~~~W~~   96 (98)
                      .... +.|.|.-.+...+. .........+.|..+.....+.. ....+..|+.+.+++....|. ..++.|-.
T Consensus      1834 ~Tf~-~aG~ytV~L~AsN~-vs~~~~s~~~~VQe~I~~L~L~a-s~~~~~~n~~v~fsa~l~~GS-~Vtf~w~f 1903 (2740)
T TIGR00864      1834 MTFP-DAGTFAIRLNASNA-VSGKSASREFFAEEPIFGLELKA-SKKIAAIGEKVEFQILLAAGS-AVNFRLQI 1903 (2740)
T ss_pred             EecC-CCeEEEEEEEEEcc-cCcceeeeeEEEEEecceEEEec-ccccccCCCEEEEEEEecCCC-ceEEEEEe
Confidence            4677 89999887654322 23444556677776655444432 334677889999999876544 67777753


No 307
>PHA03189 UL14 tegument protein; Provisional
Probab=31.28  E-value=1.7e+02  Score=19.87  Aligned_cols=17  Identities=29%  Similarity=0.591  Sum_probs=13.8

Q ss_pred             cceeeccCeEEEEEEEEC
Q psy5866          22 NASFERDNGKFECRLKAA   39 (98)
Q Consensus        22 ~v~~~~d~G~y~C~~~~~   39 (98)
                      ++.-+ .+|.|+|...|.
T Consensus       139 ~v~t~-taG~Y~CvLrN~  155 (348)
T PHA03189        139 RVSTS-TAGMYECVLRNE  155 (348)
T ss_pred             EEEec-ccceEEEEeccc
Confidence            55666 899999999885


No 308
>PHA03283 envelope glycoprotein E; Provisional
Probab=30.32  E-value=64  Score=23.37  Aligned_cols=26  Identities=27%  Similarity=0.337  Sum_probs=22.1

Q ss_pred             CCeEEEEEccceeeccCeEEEEEEEEC
Q psy5866          13 SGRYDLIISNASFERDNGKFECRLKAA   39 (98)
Q Consensus        13 ~~~~~l~I~~v~~~~d~G~y~C~~~~~   39 (98)
                      .+...|.+.|+..+ ++|.|-|.+...
T Consensus       312 ~~~v~L~f~nap~~-~SGLYVfVv~yN  337 (542)
T PHA03283        312 QNRVDLLFKNAPAS-ASGLYVFVLLYN  337 (542)
T ss_pred             CCCcceEeccCCcc-cCceEEEEEEEC
Confidence            34467999999999 999999998874


No 309
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=28.27  E-value=35  Score=14.95  Aligned_cols=10  Identities=30%  Similarity=0.969  Sum_probs=7.7

Q ss_pred             eeccCeEEEEE
Q psy5866          25 FERDNGKFECR   35 (98)
Q Consensus        25 ~~~d~G~y~C~   35 (98)
                      .. ++|.|.|.
T Consensus        20 ~~-~dG~~yC~   29 (36)
T PF11781_consen   20 YS-DDGFYYCD   29 (36)
T ss_pred             Ec-cCCEEEhh
Confidence            44 88999994


No 310
>cd00501 Peptidase_C15 Pyroglutamyl peptidase (PGP) type I, also known as pyrrolidone carboxyl peptidase (pcp) type I:  Enzymes responsible for cleaving pyroglutamate (pGlu) from the N-terminal end of specialized proteins. The N-terminal pGlu protects these proteins from proteolysis by other proteases until the pGlu is removed by a PGP.  PGPs are cysteine proteases with a Cys-His-Glu/Asp catalytic triad. Type I PGPs are found in a wide variety of prokaryotes and eukaryotes. It is not clear whether the functional form is a monomer, a homodimer, or a homotetramer.
Probab=25.83  E-value=42  Score=20.50  Aligned_cols=15  Identities=27%  Similarity=0.561  Sum_probs=10.8

Q ss_pred             cceeeccCeEEEEEE
Q psy5866          22 NASFERDNGKFECRL   36 (98)
Q Consensus        22 ~v~~~~d~G~y~C~~   36 (98)
                      .+..++|+|.|-|-.
T Consensus       130 ~~~~S~dAG~YlCn~  144 (194)
T cd00501         130 PARVSNDAGTYLCNH  144 (194)
T ss_pred             CceEcCCCCceeeHH
Confidence            345565999999943


No 311
>PF07430 PP1:  Phloem filament protein PP1;  InterPro: IPR009994 This domain represents a conserved region approximately 200 residues long, four copies of which are found within the plant phloem filament protein PP1. This is one of the constituents of the proteinaceous filaments found in the sieve elements of Cucurbita phloem [].
Probab=24.09  E-value=1.9e+02  Score=18.13  Aligned_cols=35  Identities=20%  Similarity=0.124  Sum_probs=21.0

Q ss_pred             ceeEEEEeCCCCeEEEEEcccee-eccCeEEEEEEEE
Q psy5866           3 KVEIIDYRPDSGRYDLIISNASF-ERDNGKFECRLKA   38 (98)
Q Consensus         3 ~~~~~~~~~~~~~~~l~I~~v~~-~~d~G~y~C~~~~   38 (98)
                      .|...++..++.++.|+|....- . ..|.|+..+.-
T Consensus       153 eGw~q~l~~d~ikYrLhI~AkDg~G-~~~~YeAvV~~  188 (202)
T PF07430_consen  153 EGWYQDLGNDGIKYRLHIVAKDGLG-RLGNYEAVVWE  188 (202)
T ss_pred             eEEEEeccCCCceEEEEEEeecCCC-CcCceEEEEEE
Confidence            34445555555667777776654 4 55777765544


No 312
>KOG0200|consensus
Probab=23.41  E-value=87  Score=22.88  Aligned_cols=23  Identities=26%  Similarity=0.476  Sum_probs=20.0

Q ss_pred             eEEEEEccceeeccCeEEEEEEEE
Q psy5866          15 RYDLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        15 ~~~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      .+.+.+..+..+ |.|.|+|.+.+
T Consensus        12 ~~~~~~~~~~~~-~~~~y~~~~~~   34 (609)
T KOG0200|consen   12 HWFLIIDSVVPG-DKGFYTCLVSN   34 (609)
T ss_pred             cceEEEEEEEec-CCccEEEEEec
Confidence            456888889999 99999999987


No 313
>COG3536 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.91  E-value=97  Score=17.58  Aligned_cols=19  Identities=16%  Similarity=0.307  Sum_probs=10.2

Q ss_pred             EEEEccceeeccCeEEEEEEEE
Q psy5866          17 DLIISNASFERDNGKFECRLKA   38 (98)
Q Consensus        17 ~l~I~~v~~~~d~G~y~C~~~~   38 (98)
                      ...|..+.+.   |.|-.+...
T Consensus        59 ~V~i~~i~p~---GnYavri~F   77 (120)
T COG3536          59 NVQIRDIEPV---GNYAVRILF   77 (120)
T ss_pred             cceEEEeEec---CceEEEEEe
Confidence            3555555444   666655554


No 314
>PRK13194 pyrrolidone-carboxylate peptidase; Provisional
Probab=21.29  E-value=41  Score=21.09  Aligned_cols=15  Identities=20%  Similarity=0.487  Sum_probs=10.7

Q ss_pred             cceeeccCeEEEEEE
Q psy5866          22 NASFERDNGKFECRL   36 (98)
Q Consensus        22 ~v~~~~d~G~y~C~~   36 (98)
                      .+..++|+|.|-|-.
T Consensus       130 p~~~S~dAG~ylCN~  144 (208)
T PRK13194        130 PAVLSYSAGTYLCNY  144 (208)
T ss_pred             CcEEeCCCccchhHH
Confidence            345555999999943


No 315
>PF12539 Csm1:  Chromosome segregation protein Csm1/Pcs1;  InterPro: IPR020981  Saccharomyces cerevisiae Csm1 is part of the monopolin complex. Csm1 forms a complex with Mde4 and promotes monoorientation during meiosis []. It plays a mitotic role in DNA replication [] and is required for condensin recruitment to the replication fork barrier site and rDNA repeat segregation []. This entry also contains the Schizosaccharomyces pombe homologue to Csm1, Pcs1. Pcs1 forms a complex with Mde4 and acts in the central kinetochore domain to clamp microtubule binding sites together[]. The two complexes (Csm1/Lrs4 and Pcs1/Mde4) contribute to the prevention of merotelic attachment [].; GO: 0005515 protein binding; PDB: 3N4S_C 3N4R_B 3N7N_A 3N4X_B.
Probab=21.25  E-value=1.6e+02  Score=15.99  Aligned_cols=32  Identities=25%  Similarity=0.477  Sum_probs=20.7

Q ss_pred             EEEccceeeccCe-EEEEEEEECCCCCeeeEeeEEEEEE
Q psy5866          18 LIISNASFERDNG-KFECRLKAAGSGQDLHSQVYTVTVL   55 (98)
Q Consensus        18 l~I~~v~~~~d~G-~y~C~~~~~~~~~~~~~~~~~l~v~   55 (98)
                      |+|.++... ++| .|-|.....+   +  .-.++|.+.
T Consensus        14 l~V~~~~ed-~~~~~FDc~Qtg~n---G--tl~ykL~i~   46 (90)
T PF12539_consen   14 LIVRNVKED-DSGLWFDCIQTGRN---G--TLHYKLGID   46 (90)
T ss_dssp             EEEEEEEEE-SSCEEEEEEEE---------EEEEEEEEE
T ss_pred             eEEEEEEEC-CCCcEEEEEEcCCC---c--EEEEEEEec
Confidence            788999888 877 8899887642   2  344555553


Done!