Diaphorina citri psyllid: psy5880

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33

MVGLDESTCSRILSRVFRSGEWGCTPTHNMLSSFARMRAWVLQFWLLGILKFGDVAHYFVVNVSSPNTANLRKLQAKDQLKHLLKTVVETRNQLALKPLPPILVKIAPDLSLDEKKDIADVVLDSVKGILKFGDVAHYFVVNVSSPNTANLRKLQAKDQLKHLLKTVVETRNQLAVKPLPPILVKIAPDLSLDEKKDIADVVLDSKCKVDGLIVSNTTVDRYEYLDARYKEETGGLSGEPLRNKSTELISEMYKLTKGKLPIIGVGGVFSGKDAFEKIKAGASLVQIYTSFVYHGPPLVTRIKSELEELLQKEGYNSVSQAVGAAHKS

ccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccHHcHHHHHHHHHHHHcccccccEEEccccccHHHHHHHHHHccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccHHHHHcccccc

MVGLDESTCSRILSRVFRSGEWGCTPTHNMLSSFARMRAWVLQFWLLGILKFGDVAHYFVVNVSSPNTANLRKLQAKDQLKHLLKTVVETRNQLALKPLPPILVKIAPDLSLDEKKDIADVVLDSVKGILKFGDVAHYFVVNVSSPNTANLRKLQAKDQLKHLLKTVVETRNQLAVKPLPPILVKIAPDLSLDEKKDIADVVLDSKCKVDGLIVSNTTVDRYEYLDARYK*****LSGEPLRNKSTELISEMYKLTKGKLPIIGVGGVFSGKDAFEKIKAGASLVQIYTSFVYHGPPLVTRIKSELEELLQKEGYNSV**********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Dihydroorotate dehydrogenase (quinone), mitochondrial	In the de novo pyrimidine biosynthesic pathway, catalyzes the stereospecific oxidation of (S)-dihydroorotate to orotate with reduction of flavin and the transfer of electrons to ubiquinone, which is part of the repiratory chain. Does not use fumarate and NAD as electron acceptors.	confident	P32747
Dihydroorotate dehydrogenase (quinone)	Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.	confident	B0R808
Dihydroorotate dehydrogenase (quinone)	Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.	confident	Q9HMK2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0010181 [MF]	FMN binding	probable	GO:0043168, GO:0050662, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:1901265, GO:0003674, GO:0043167, GO:1901363, GO:0032553, GO:0005488
GO:0006206 [BP]	pyrimidine nucleobase metabolic process	probable	GO:0006139, GO:0044710, GO:0044238, GO:1901564, GO:0071704, GO:0009987, GO:0006725, GO:0044237, GO:0009112, GO:0034641, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0072527, GO:0044281, GO:0055086, GO:0046483
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0048039 [MF]	ubiquinone binding	probable	GO:0003674, GO:0048038, GO:0048037, GO:0005488
GO:0005743 [CC]	mitochondrial inner membrane	probable	GO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0072528 [BP]	pyrimidine-containing compound biosynthetic process	probable	GO:1901576, GO:0044271, GO:1901566, GO:0071704, GO:0046483, GO:0009987, GO:0009058, GO:0044237, GO:0044249, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901564, GO:0018130, GO:1901362, GO:1901360, GO:0072527
GO:0005758 [CC]	mitochondrial intermembrane space	probable	GO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.3.-.-	Acting on the CH-CH group of donors.	probable
1.3.5.-	With a quinone or related compound as acceptor.	probable
1.3.5.2	Dihydroorotate dehydrogenase (quinone).	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I65, chain A
Confidence level:very confident
Coverage over the Query: 107-327
View the alignment between query and template
View the model in PyMOL

Template: 3ZWT, chain A
Confidence level:very confident
Coverage over the Query: 64-328
View the alignment between query and template
View the model in PyMOL

Template: 3I65, chain A
Confidence level:very confident
Coverage over the Query: 19-216
View the alignment between query and template
View the model in PyMOL