Diaphorina citri psyllid: psy5894

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230---

MADKLGLNPDIRELKLGSSFTNANKGSSFHTLRYDFKPASMDPNEVAKLDVGESNQVTVTVPHGSRETVFKGSHKPYQKECVLIIDNVTGEITLEKLSNNIQLKKTRTAPTNKTDTSHVMPSAIPLSRLKKKTSGKANNNHKTKSGNNLSVPPSIPRHSPLQTSPSYFSPPHTKSPTAPFKSPSPGQGSSLSPMVNSLPALGLDDIGLIEGTVTAKVLSSRNRRENEDRLGES

ccccccccccEEEEEEccccccccccccEEEEEEcccccccccccccEEEEcccccEEEEcccccccEEEEcccccccccEEEEEEcccccEEEEEccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*****G**PDIRELKLGSSFTNANKGSSFHTLRYDFKPASMDPNEV******ESNQVTVTVPHGSRETVFKGSHKPYQKECVLIIDNVTGEITLEKLSNNIQLK***********************************************************************************************ALGLDDIGLIEGTVTAK*****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ELL-associated factor 1	Acts as a transcriptional transactivator of ELL and ELL2 elongation activities.	confident	Q9D4C5
ELL-associated factor 2	Acts as a transcriptional transactivator of TCEA1 elongation activity (By similarity). Acts as a transcriptional transactivator of ELL and ELL2 elongation activities. Potent inducer of apoptosis in prostatic and non-prostatic cell lines. Inhibits prostate tumor growth in vivo.	confident	Q96CJ1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005654 [CC]	nucleoplasm	probable	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0006917 [BP]	induction of apoptosis	probable	GO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!