Diaphorina citri psyllid: psy5901


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MKKPTLLKKLVSLAAVSSGSFALFSGINIYQNNENYYNNVLLPILFKFDAETAHNIAIWTAKYKLLPKSVYEDPPQLASQVWNLKFPNPLAELRTQKPTEVSIQGPPTVSISGVEPQVPKPV
ccccHHHHHHHHHHHHHHHHHHHHHHEEEECccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccccccccccccccccccccHHcccccccccccccccccccccEECccccccc
******LKKLVSLAAVSSGSFALFSGINIYQNNENYYNNVLLPILFKFDAETAHNIAIWTAKYKLLPKSVYEDPPQLASQVWNLKFPNPLAELRTQKPTEVSIQGPPTVSISGVEPQVPKP*
xxxxxxxxxHHHHHHHHHHxxHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKPTLLKKLVSLAAVSSGSFALFSGINIYQNNENYYNNVLLPILFKFDAETAHNIAIWTAKYKLLPKSVYEDPPQLASQVWNLKFPNPLAELRTQKPTEVSIQGPPTVSISGVEPQVPKPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dihydroorotate dehydrogenase (quinone) Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.confidentB9JR03

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I65, chain A
Confidence level:very confident
Coverage over the Query: 30-118
View the alignment between query and template
View the model in PyMOL