Diaphorina citri psyllid: psy5923


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MDRGTYGETFPMELDGVVVFEEDYIQDRKVFGQVVCSFRYGREEDEILGLNFQKELYLASEQIYPRSEKQHTSLTKMQTQNSQHPVWV
cccccccccccccccEEEEEcccccccCEEEEEEEEEEEcccccccccccccHHHHHHHHcccccccccccccccHHHHHHccccccc
MDRGTYGETFPMELDGVVVFEEDYIQDRKVFGQVVCSFRYGREEDEILGLNFQKELYLASEQIY***************QNSQHPVWV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRGTYGETFPMELDGVVVFEEDYIQDRKVFGQVVCSFRYGREEDEILGLNFQKELYLASEQIYPRSEKQHTSLTKMQTQNSQHPVWV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosrestin-2 Regulates photoreceptor cell deactivation. Arr1 and Arr2 proteins are mediators of rhodopsin inactivation and are essential for the termination of the phototransduction cascade.confidentP15372

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009966 [BP]regulation of signal transductionprobableGO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0050789
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0016029 [CC]subrhabdomeral cisternaprobableGO:0005737, GO:0005575, GO:0031984, GO:0005783, GO:0044444, GO:0044463, GO:0044464, GO:0097425, GO:0005623, GO:0043231, GO:0044446, GO:0044432, GO:0043229, GO:0016028, GO:0005622, GO:0044424, GO:0042995, GO:0043227, GO:0043226, GO:0044422, GO:0005790
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0006897 [BP]endocytosisprobableGO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0045202 [CC]synapseprobableGO:0005575
GO:0019220 [BP]regulation of phosphate metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0031400 [BP]negative regulation of protein modification processprobableGO:0032269, GO:0032268, GO:0010605, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031324, GO:0031323, GO:0051248, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0031399, GO:0009892, GO:0050789, GO:0048523
GO:0002046 [MF]opsin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043086 [BP]negative regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044092, GO:0008150, GO:0065009, GO:0050789
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UGU, chain A
Confidence level:very confident
Coverage over the Query: 8-88
View the alignment between query and template
View the model in PyMOL