BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy5946
         (63 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2FTC|D Chain D, Structural Model For The Large Subunit Of The Mammalian
           Mitochondrial Ribosome
 pdb|3IY9|D Chain D, Leishmania Tarentolae Mitochondrial Large Ribosomal
           Subunit Model
          Length = 175

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 25/40 (62%)

Query: 4   VLGLTSTLSIKLMQDDLHIVKDLVLPVDDPKYLENLVEER 43
            LGL   L++KL QDDLHI+  L LP  DP+YL  L   R
Sbjct: 75  ALGLKVALTVKLAQDDLHIMDSLELPTGDPQYLTELAHYR 114


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.138    0.374 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,630,645
Number of Sequences: 62578
Number of extensions: 46378
Number of successful extensions: 85
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 84
Number of HSP's gapped (non-prelim): 1
length of query: 63
length of database: 14,973,337
effective HSP length: 34
effective length of query: 29
effective length of database: 12,845,685
effective search space: 372524865
effective search space used: 372524865
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)