RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy5955
         (134 letters)



>gnl|CDD|187657 cd08954, KR_1_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of
           fatty acid synthase (FAS), subgroup 1, complex (x) SDRs.
            NADP-dependent KR domain of the multidomain type I FAS,
           a complex SDR family. This subfamily also includes
           proteins identified as polyketide synthase (PKS), a
           protein with related modular protein architecture and
           similar function. It includes the KR domains of
           mammalian and chicken FAS, and Dictyostelium discoideum
           putative polyketide synthases (PKSs). These KR domains
           contain two subdomains, each of which is related to SDR
           Rossmann fold domains. However, while the C-terminal
           subdomain has an active site similar to the other SDRs
           and a NADP-binding capability, the N-terminal SDR-like
           subdomain is truncated and lacks these functions,
           serving a supportive structural role. In some instances,
           such as porcine FAS, an enoyl reductase (a Rossman fold
           NAD-binding domain of the medium-chain
           dehydrogenase/reductase, MDR family) module is inserted
           between the sub-domains. Fatty acid synthesis occurs via
           the stepwise elongation of a chain (which is attached to
           acyl carrier protein, ACP) with 2-carbon units.
           Eukaryotic systems consists of large, multifunctional
           synthases (type I) while bacterial, type II systems, use
           single function proteins. Fungal fatty acid synthesis
           uses a dodecamer of 6 alpha and 6 beta subunits. In
           mammalian type FAS cycles,  ketoacyl synthase forms
           acetoacetyl-ACP which is reduced by the NADP-dependent
           beta-ketoacyl reductase (KR), forming
           beta-hydroxyacyl-ACP, which is in turn dehydrated by
           dehydratase to a beta-enoyl intermediate, which is
           reduced by NADP-dependent beta-enoyl reductase (ER);
           this KR and ER are members of the SDR family. This KR
           subfamily has an active site tetrad with a similar 3D
           orientation compared to archetypical SDRs, but the
           active site Lys and Asn residue positions are swapped.
           The characteristic NADP-binding is typical of the
           multidomain  complex SDRs, with a GGXGXXG NADP binding
           motif. SDRs are a functionally diverse family of
           oxidoreductases that have a single domain with a
           structurally conserved Rossmann fold (alpha/beta folding
           pattern with a central beta-sheet), an NAD(P)(H)-binding
           region, and a structurally diverse C-terminal region.
           Classical SDRs are typically about 250 residues long,
           while extended SDRs are approximately 350 residues.
           Sequence identity between different SDR enzymes are
           typically in the 15-30% range, but the enzymes share the
           Rossmann fold NAD-binding motif and characteristic
           NAD-binding and catalytic sequence patterns. These
           enzymes catalyze a wide range of activities including
           the metabolism of steroids, cofactors, carbohydrates,
           lipids, aromatic compounds, and amino acids, and act in
           redox sensing. Classical SDRs have an TGXXX[AG]XG
           cofactor binding motif and a YXXXK active site motif,
           with the Tyr residue of the active site motif serving as
           a critical catalytic residue (Tyr-151, human
           prostaglandin dehydrogenase (PGDH) numbering). In
           addition to the Tyr and Lys, there is often an upstream
           Ser (Ser-138, PGDH numbering) and/or an Asn (Asn-107,
           PGDH numbering) contributing to the active site; while
           substrate binding is in the C-terminal region, which
           determines specificity. The standard reaction mechanism
           is a 4-pro-S hydride transfer and proton relay involving
           the conserved Tyr and Lys, a water molecule stabilized
           by Asn, and nicotinamide. Extended SDRs have additional
           elements in the C-terminal region, and typically have a
           TGXXGXXG cofactor binding motif. Complex (multidomain)
           SDRs such as ketoreductase domains of fatty acid
           synthase have a GGXGXXG NAD(P)-binding motif and an
           altered active site motif (YXXXN). Fungal type KRs have
           a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs
           have lost catalytic activity and/or have an unusual
           NAD(P)-binding motif and missing or unusual active site
           residues. Reactions catalyzed within the SDR family
           include isomerization, decarboxylation, epimerization,
           C=N bond reduction, dehydratase activity,
           dehalogenation, Enoyl-CoA reduction, and
           carbonyl-alcohol oxidoreduction.
          Length = 452

 Score = 40.5 bits (95), Expect = 9e-05
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 3/62 (4%)

Query: 3   CVKQEPGGLGARCVFITDAK--QPPFSPSSPTYAPLLAK-DLLYNVYRAGTWGSMRHILL 59
             ++EP     RC+F+++    + P   +   Y   + K   + NVY++G+WG  RH+LL
Sbjct: 145 YFREEPQLKLIRCLFVSNLNSQKEPIIRNGKVYYERVKKNSNIKNVYKSGSWGDFRHLLL 204

Query: 60  DT 61
           D 
Sbjct: 205 DL 206


>gnl|CDD|219059 pfam06491, Disulph_isomer, Disulphide isomerase.  This family of
           proteins has disulphide isomerase activity, EC:5.3.4.1.
           It has a similar fold to thioredoxin, with an
           alpha-beta-alpha-beta-alpha-beta-beta-alpha topology. It
           has a conserved CGC motif in the loop immediately
           downstream of the first beta strand. This motif is
           essential for activity.
          Length = 136

 Score = 25.3 bits (56), Expect = 9.1
 Identities = 8/24 (33%), Positives = 14/24 (58%)

Query: 24  PPFSPSSPTYAPLLAKDLLYNVYR 47
             + PSSP+ A L   +L++ + R
Sbjct: 90  EGYPPSSPSMALLKDGELVHMIER 113


>gnl|CDD|220028 pfam08811, DUF1800, Protein of unknown function (DUF1800).  This is
           a family of large bacterial proteins of unknown
           function.
          Length = 463

 Score = 25.7 bits (57), Expect = 9.4
 Identities = 9/20 (45%), Positives = 10/20 (50%)

Query: 23  QPPFSPSSPTYAPLLAKDLL 42
           QPPF P SP   P  A   +
Sbjct: 356 QPPFRPPSPDGYPDGAAGWV 375


>gnl|CDD|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase -
          Rhodanese Homology Domain. This domain is believed to
          serve as a polysulfide binding and transferase domain
          in anaerobic gram-negative bacteria, functioning in
          oxidative phosphorylation with polysulfide-sulfur as a
          terminal electron acceptor. The active site contains
          the same conserved cysteine that is the catalytic
          residue in other Rhodanese Homology Domain proteins.
          Length = 103

 Score = 25.1 bits (55), Expect = 9.6
 Identities = 10/26 (38%), Positives = 13/26 (50%)

Query: 28 PSSPTYAPLLAKDLLYNVYRAGTWGS 53
          P SP + P  A+D  +  Y A  W S
Sbjct: 49 PDSPYHKPAFAEDKPFVFYCASGWRS 74


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.320    0.137    0.428 

Gapped
Lambda     K      H
   0.267   0.0775    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 6,782,408
Number of extensions: 580244
Number of successful extensions: 426
Number of sequences better than 10.0: 1
Number of HSP's gapped: 425
Number of HSP's successfully gapped: 9
Length of query: 134
Length of database: 10,937,602
Length adjustment: 86
Effective length of query: 48
Effective length of database: 7,123,158
Effective search space: 341911584
Effective search space used: 341911584
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (24.5 bits)