Diaphorina citri psyllid: psy6003


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MTLKHHTNRSFLVANSHLGLCHIIYCSDGFCRLTGFSRAEVMQQDAICKFLHGPLTSQHAVQVVKEALAAGVEKHFEILYYKKDGKYSSVGGSYGDITPVSPVVPVHTI
ccccccccccEEEEccccccccEEEEccHHHHHccccHHHHccccccccccccccccHHHHHHHHHHHHcccEEEEEEEEEEccccccccccccEEEEEEEEccccccc
*******NRSFLVANSHLGLCHIIYCSDGFCRLTGFSRAEVMQQDAICKFLHGPLTSQHAVQVVKEALAAGVEKHFEILYYKKDGKYSSVGGSYGDITPVSPVVPV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLKHHTNRSFLVANSHLGLCHIIYCSDGFCRLTGFSRAEVMQQDAICKFLHGPLTSQHAVQVVKEALAAGVEKHFEILYYKKDGKYSSVGGSYGDITPVSPVVPVHTI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051291 [BP]protein heterooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0005242 [MF]inward rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015276, GO:0022857, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0015077, GO:0015267, GO:0022836, GO:0005249, GO:0022834, GO:0022839, GO:0022838, GO:0015079
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006813 [BP]potassium ion transportprobableGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0034220 [BP]ion transmembrane transportprobableGO:0009987, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0044763, GO:0008150, GO:0051234, GO:0055085, GO:0044699
GO:0034765 [BP]regulation of ion transmembrane transportprobableGO:0051049, GO:0050794, GO:0065007, GO:0034762, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0W, chain A
Confidence level:very confident
Coverage over the Query: 4-93
View the alignment between query and template
View the model in PyMOL