Query         psy6014
Match_columns 69
No_of_seqs    34 out of 36
Neff          2.6 
Searched_HMMs 46136
Date          Sat Aug 17 00:22:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6014.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6014hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3955|consensus               99.9 2.7E-24 5.9E-29  166.6   1.1   65    2-66     78-144 (361)
  2 KOG3955|consensus               97.6   2E-05 4.2E-10   62.2   0.7   61    2-63     54-115 (361)
  3 PF03567 Sulfotransfer_2:  Sulf  54.6    0.11 2.4E-06   33.7  -7.3   50    2-62     19-68  (253)
  4 PF04622 ERG2_Sigma1R:  ERG2 an  34.3      22 0.00047   26.3   1.1   26   36-61     73-100 (216)
  5 PF06377 Adipokin_hormo:  Adipo  29.6      20 0.00044   21.4   0.3   19   46-66      4-24  (48)
  6 KOG4710|consensus               29.3      32 0.00069   25.4   1.3   22   38-61     68-89  (170)
  7 PF07663 EIIBC-GUT_C:  Sorbitol  26.4      16 0.00035   24.6  -0.6   12   40-51     69-80  (93)
  8 PF08212 Lipocalin_2:  Lipocali  22.5      61  0.0013   20.9   1.5   13   34-46    101-113 (143)
  9 TIGR00825 EIIBC-GUT PTS system  22.2      40 0.00087   27.1   0.7   13   39-51    305-317 (331)
 10 PRK10477 outer membrane lipopr  18.8      74  0.0016   21.5   1.4   13   34-46    132-144 (177)

No 1  
>KOG3955|consensus
Probab=99.88  E-value=2.7e-24  Score=166.64  Aligned_cols=65  Identities=54%  Similarity=1.217  Sum_probs=61.7

Q ss_pred             CccceecceecccCCCCCCeecccCCeeeeecCCCCCceeEEEecccceeecccccchhh--ccccc
Q psy6014           2 GNSTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTGWKCGLHADWTEL--TSCVH   66 (69)
Q Consensus         2 tgGTtfgrhLV~~l~l~~pC~C~~~~krc~C~RP~~~~~WLFSRySTGW~CGLHADwTEL--t~CV~   66 (69)
                      |+||||+|+|||+..+++||.|+..+|+|.|.|+.+++|||||||||||.|||||||||+  ..|++
T Consensus        78 ~~~tt~~~~~~r~y~~~~p~~~~~~~~~~~~~~~~~~~twlfsr~s~g~~~glhad~te~vv~~~~~  144 (361)
T KOG3955|consen   78 TGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTESVVDGKRD  144 (361)
T ss_pred             cCCCCCcchhhhhhhhcchhhhhhcccccCCCccceeeeeeccccccccceeeecchhhhhccceec
Confidence            799999999999999999999999999999999999999999999999999999999998  35554


No 2  
>KOG3955|consensus
Probab=97.58  E-value=2e-05  Score=62.23  Aligned_cols=61  Identities=8%  Similarity=-0.216  Sum_probs=57.1

Q ss_pred             CccceecceecccCCCCCCeecccCCeeeeecCCCCCceeEEE-ecccceeecccccchhhcc
Q psy6014           2 GNSTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFS-RYSTGWKCGLHADWTELTS   63 (69)
Q Consensus         2 tgGTtfgrhLV~~l~l~~pC~C~~~~krc~C~RP~~~~~WLFS-RySTGW~CGLHADwTELt~   63 (69)
                      +++|. |.+|+...+...+|.+..+.+.|.|.++...++|+++ +.+++|.++.|+||+++.+
T Consensus        54 ~~~~~-~~~~~~~~~~~i~~~~~~~~~~tt~~~~~~r~y~~~~p~~~~~~~~~~~~~~~~~~~  115 (361)
T KOG3955|consen   54 GDLLR-KVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRE  115 (361)
T ss_pred             ecccc-cccccccCCCccccccccccCCCCCcchhhhhhhhcchhhhhhcccccCCCccceee
Confidence            45666 9999999999999999999999999999999999999 9999999999999999876


No 3  
>PF03567 Sulfotransfer_2:  Sulfotransferase family;  InterPro: IPR005331 This entry consists of a number of carbohydrate sulphotransferases that transfer sulphate to carbohydrate groups in glycoproteins and glycolipids. These include:    Carbohydrate sulphotransferases 8 and 9, which transfer sulphate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans []. They function in the biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulphation of their carbohydrate structures.     Carbohydrate sulphotransferase 10, which transfers sulphate to position 3 of the terminal glucuronic acid in both protein- and lipid-linked oligosaccharides []. It directs the biosynthesis of the HNK-1 carbohydrate structure, a sulphated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult.      Carbohydrate sulphotransferases 11 - 13, which catalyze the transfer of sulphate to position 4 of the GalNAc residue of chondroitin []. Chondroitin sulphate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Some, thought not all, of these enzymes also transfer sulphate to dermatan.     Carbohydrate sulphotransferase D4ST1, which transfers sulphate to position 4 of the GalNAc residue of dermatan sulphate [].     Heparan sulphate 2-O-sulphotransferase (HS2ST). Heparan sulphate (HS) is a co-receptor for a number of growth factors, morphogens, and adhesion proteins. HS biosynthetic modifications may determine the strength and outcome of HS-ligand interactions. Mice that lack HS2ST undergo developmental failure only after midgestation,the most dramatic effect being the complete failure of kidney development [].     Heparan-sulphate 6-O-sulphotransferase (HS6ST), which catalyses the transfer of sulphate from adenosine 3'-phosphate, 5'-phosphosulphate to the 6th position of the N -sulphoglucosamine residue in heparan sulphate [].     Chondroitin 6-sulphotransferase catalyses the transfer of sulphate to position 6 of the N-acetylgalactosamine residue of chondroitin [].  ; GO: 0008146 sulfotransferase activity, 0016021 integral to membrane; PDB: 3F5F_A.
Probab=54.65  E-value=0.11  Score=33.68  Aligned_cols=50  Identities=26%  Similarity=0.268  Sum_probs=29.8

Q ss_pred             CccceecceecccCCCCCCeecccCCeeeeecCCCCCceeEEEecccceeecccccchhhc
Q psy6014           2 GNSTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTGWKCGLHADWTELT   62 (69)
Q Consensus         2 tgGTtfgrhLV~~l~l~~pC~C~~~~krc~C~RP~~~~~WLFSRySTGW~CGLHADwTELt   62 (69)
                      ||||++..-|-....          + .+.+..|..++.|+..++..+|.....++++++.
T Consensus        19 ~g~Ts~~~~l~~~~~----------~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   68 (253)
T PF03567_consen   19 TGGTSLKSILRRLYG----------K-EFTKDNPSIPENWLHFKRYCGWGHIEFRDLSELS   68 (253)
T ss_dssp             SSHHHHHHHHHHHHH----------G-S---HHHHHHHH-GGG-SEEEEES-----GGGGT
T ss_pred             HHHHHHHHHHHHHhh----------h-hhhccccccccccccccchhhhhhHHHhHHhhcc
Confidence            788888877766543          2 5556566666789988889999999999998883


No 4  
>PF04622 ERG2_Sigma1R:  ERG2 and Sigma1 receptor like protein;  InterPro: IPR006716 This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor. C-8 sterol isomerase (delta-8--delta-7 sterol isomerase), catalyses a reaction in ergosterol biosynthesis, which results in unsaturation at C-7 in the B ring of sterols []. Sigma 1 receptor is a low molecular mass mammalian protein located in the endoplasmic reticulum [], which interacts with endogenous steroid hormones, such as progesterone and testosterone []. It also binds the sigma ligands, which are a set of chemically unrelated drugs including haloperidol, pentazocine, and ditolylguanidine []. Sigma1 effectors are not well understood, but sigma1 agonists have been observed to affect NMDA receptor function, the alpha-adrenergic system and opioid analgesia.; GO: 0000247 C-8 sterol isomerase activity, 0006696 ergosterol biosynthetic process, 0005783 endoplasmic reticulum
Probab=34.26  E-value=22  Score=26.31  Aligned_cols=26  Identities=35%  Similarity=0.622  Sum_probs=22.3

Q ss_pred             CCCceeEEEec--ccceeecccccchhh
Q psy6014          36 NRHEVWLFSRY--STGWKCGLHADWTEL   61 (69)
Q Consensus        36 ~~~~~WLFSRy--STGW~CGLHADwTEL   61 (69)
                      ...+.|+|+-.  ..|.+|=|||-.||.
T Consensus        73 ~~~~~WvfnnaGGamG~m~iLHaS~tEY  100 (216)
T PF04622_consen   73 SNDSEWVFNNAGGAMGSMCILHASITEY  100 (216)
T ss_pred             CCCCceEEECCCchhhhhhhhhhhhHhH
Confidence            44679999985  679999999999997


No 5  
>PF06377 Adipokin_hormo:  Adipokinetic hormone;  InterPro: IPR010475 This family consists of several insect adipokinetic hormone as well as the related crustacean red pigment concentrating hormone (RPCH) []. Flight activity of insects comprises one of the most intense biochemical processes known in nature, and therefore provides an attractive model system to study the hormonal regulation of metabolism during physical exercise. In long-distance flying insects, such as the migratory locust, both carbohydrate and lipid reserves are utilised as fuels for sustained flight activity. The mobilisation of these energy stores in Locusta migratoria (Migratory locust) is mediated by three structurally related adipokinetic hormones (AKHs), which are all capable of stimulating the release of both carbohydrates and lipids from the fat body [].; GO: 0005179 hormone activity
Probab=29.58  E-value=20  Score=21.39  Aligned_cols=19  Identities=26%  Similarity=0.646  Sum_probs=11.2

Q ss_pred             cccceeecccccchhh--ccccc
Q psy6014          46 YSTGWKCGLHADWTEL--TSCVH   66 (69)
Q Consensus        46 ySTGW~CGLHADwTEL--t~CV~   66 (69)
                      ||+||  |=-+-=++.  .+|.+
T Consensus         4 FSp~W--GKRs~~~~~~~~~C~~   24 (48)
T PF06377_consen    4 FSPGW--GKRSAGARGRADDCKS   24 (48)
T ss_pred             cCCCc--ccccccCCCCCCCCCC
Confidence            89999  755444443  34543


No 6  
>KOG4710|consensus
Probab=29.27  E-value=32  Score=25.36  Aligned_cols=22  Identities=32%  Similarity=0.623  Sum_probs=18.2

Q ss_pred             CceeEEEecccceeecccccchhh
Q psy6014          38 HEVWLFSRYSTGWKCGLHADWTEL   61 (69)
Q Consensus        38 ~~~WLFSRySTGW~CGLHADwTEL   61 (69)
                      ...|||.+|-||  |++|-.=+|+
T Consensus        68 ~H~WlfRd~~tg--~~~lVn~~ei   89 (170)
T KOG4710|consen   68 THSWLFRDYYTG--ERMLVNSQEI   89 (170)
T ss_pred             CceeEEeeccCC--ceeEEcceee
Confidence            368999999999  8888776665


No 7  
>PF07663 EIIBC-GUT_C:  Sorbitol phosphotransferase enzyme II C-terminus;  InterPro: IPR011638 The Gut family consists only of glucitol-specific permeases, but these occur both in Gram-negative and Gram-positive bacteria. Escherichia coli contains IIA protein, IIC protein and IIBC protein. This entry represents the C-terminal conserved region of the IIBC component.; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system, 0016021 integral to membrane
Probab=26.42  E-value=16  Score=24.62  Aligned_cols=12  Identities=42%  Similarity=0.523  Sum_probs=10.1

Q ss_pred             eeEEEeccccee
Q psy6014          40 VWLFSRYSTGWK   51 (69)
Q Consensus        40 ~WLFSRySTGW~   51 (69)
                      .=||||+.||..
T Consensus        69 avL~SR~itGp~   80 (93)
T PF07663_consen   69 AVLYSRFITGPL   80 (93)
T ss_pred             hhhhhhhhcccH
Confidence            569999999964


No 8  
>PF08212 Lipocalin_2:  Lipocalin-like domain;  InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ]. This is an eight stranded antiparallel beta-barrel with a repeated + 1 topology enclosing a internal ligand binding site [, ]. The name 'lipocalin' has been proposed [] for this protein family, but cytosolic fatty-acid binding proteins are also included. The sequences of most members of the family, the core or kernal lipocalins, are characterised by three short conserved stretches of residues, while others, the outlier lipocalin group, share only one or two of these [, ]. Proteins known to belong to this family include alpha-1-microglobulin (protein HC); alpha-1-acid glycoprotein (orosomucoid) []; aphrodisin; apolipoprotein D; beta-lactoglobulin; complement component C8 gamma chain []; crustacyanin []; epididymal-retinoic acid binding protein (E-RABP) []; insectacyanin; odorant-binding protein (OBP); human pregnancy-associated endometrial alpha-2 globulin; probasin (PB), a rat prostatic protein; prostaglandin D synthase (5.3.99.2 from EC) []; purpurin; Von Ebner's gland protein (VEGP) []; and lizard epididymal secretory protein IV (LESP IV) [].; GO: 0005488 binding; PDB: 3EBW_B 1QWD_A 2ACO_A 3MBT_A.
Probab=22.46  E-value=61  Score=20.93  Aligned_cols=13  Identities=38%  Similarity=0.968  Sum_probs=10.3

Q ss_pred             CCCCCceeEEEec
Q psy6014          34 RPNRHEVWLFSRY   46 (69)
Q Consensus        34 RP~~~~~WLFSRy   46 (69)
                      .|+.+..|++||=
T Consensus       101 ~~~~~~~WILsR~  113 (143)
T PF08212_consen  101 SPDREYLWILSRT  113 (143)
T ss_dssp             ECCCCEEEEEESS
T ss_pred             cCCCCEEEEEeCC
Confidence            4677789999994


No 9  
>TIGR00825 EIIBC-GUT PTS system, glucitol/sorbitol-specific, IIBC component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Gut family consists only of glucitol-specific permeases, but these occur both in Gram-negative and Gram-positive bacteria.E. coli consists of IIA protein, a IIC protein and a IIBC protein. This family is specific for the IIBC component.
Probab=22.21  E-value=40  Score=27.06  Aligned_cols=13  Identities=38%  Similarity=0.399  Sum_probs=10.5

Q ss_pred             ceeEEEeccccee
Q psy6014          39 EVWLFSRYSTGWK   51 (69)
Q Consensus        39 ~~WLFSRySTGW~   51 (69)
                      ..=|||||.||..
T Consensus       305 PsVLySRFltG~~  317 (331)
T TIGR00825       305 PSVLVSRFMTGAP  317 (331)
T ss_pred             cceeeeccccccH
Confidence            3579999999965


No 10 
>PRK10477 outer membrane lipoprotein Blc; Provisional
Probab=18.81  E-value=74  Score=21.50  Aligned_cols=13  Identities=38%  Similarity=0.948  Sum_probs=10.5

Q ss_pred             CCCCCceeEEEec
Q psy6014          34 RPNRHEVWLFSRY   46 (69)
Q Consensus        34 RP~~~~~WLFSRy   46 (69)
                      .|+.+..||+||=
T Consensus       132 ~~~~~~~wIlsR~  144 (177)
T PRK10477        132 GPDRDYLWILSRT  144 (177)
T ss_pred             cCCCCEEEEEeCC
Confidence            5677889999983


Done!