Query psy6014
Match_columns 69
No_of_seqs 34 out of 36
Neff 2.6
Searched_HMMs 46136
Date Sat Aug 17 00:22:05 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy6014.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6014hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG3955|consensus 99.9 2.7E-24 5.9E-29 166.6 1.1 65 2-66 78-144 (361)
2 KOG3955|consensus 97.6 2E-05 4.2E-10 62.2 0.7 61 2-63 54-115 (361)
3 PF03567 Sulfotransfer_2: Sulf 54.6 0.11 2.4E-06 33.7 -7.3 50 2-62 19-68 (253)
4 PF04622 ERG2_Sigma1R: ERG2 an 34.3 22 0.00047 26.3 1.1 26 36-61 73-100 (216)
5 PF06377 Adipokin_hormo: Adipo 29.6 20 0.00044 21.4 0.3 19 46-66 4-24 (48)
6 KOG4710|consensus 29.3 32 0.00069 25.4 1.3 22 38-61 68-89 (170)
7 PF07663 EIIBC-GUT_C: Sorbitol 26.4 16 0.00035 24.6 -0.6 12 40-51 69-80 (93)
8 PF08212 Lipocalin_2: Lipocali 22.5 61 0.0013 20.9 1.5 13 34-46 101-113 (143)
9 TIGR00825 EIIBC-GUT PTS system 22.2 40 0.00087 27.1 0.7 13 39-51 305-317 (331)
10 PRK10477 outer membrane lipopr 18.8 74 0.0016 21.5 1.4 13 34-46 132-144 (177)
No 1
>KOG3955|consensus
Probab=99.88 E-value=2.7e-24 Score=166.64 Aligned_cols=65 Identities=54% Similarity=1.217 Sum_probs=61.7
Q ss_pred CccceecceecccCCCCCCeecccCCeeeeecCCCCCceeEEEecccceeecccccchhh--ccccc
Q psy6014 2 GNSTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTGWKCGLHADWTEL--TSCVH 66 (69)
Q Consensus 2 tgGTtfgrhLV~~l~l~~pC~C~~~~krc~C~RP~~~~~WLFSRySTGW~CGLHADwTEL--t~CV~ 66 (69)
|+||||+|+|||+..+++||.|+..+|+|.|.|+.+++|||||||||||.|||||||||+ ..|++
T Consensus 78 ~~~tt~~~~~~r~y~~~~p~~~~~~~~~~~~~~~~~~~twlfsr~s~g~~~glhad~te~vv~~~~~ 144 (361)
T KOG3955|consen 78 TGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTGWSCGLHADWTESVVDGKRD 144 (361)
T ss_pred cCCCCCcchhhhhhhhcchhhhhhcccccCCCccceeeeeeccccccccceeeecchhhhhccceec
Confidence 799999999999999999999999999999999999999999999999999999999998 35554
No 2
>KOG3955|consensus
Probab=97.58 E-value=2e-05 Score=62.23 Aligned_cols=61 Identities=8% Similarity=-0.216 Sum_probs=57.1
Q ss_pred CccceecceecccCCCCCCeecccCCeeeeecCCCCCceeEEE-ecccceeecccccchhhcc
Q psy6014 2 GNSTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFS-RYSTGWKCGLHADWTELTS 63 (69)
Q Consensus 2 tgGTtfgrhLV~~l~l~~pC~C~~~~krc~C~RP~~~~~WLFS-RySTGW~CGLHADwTELt~ 63 (69)
+++|. |.+|+...+...+|.+..+.+.|.|.++...++|+++ +.+++|.++.|+||+++.+
T Consensus 54 ~~~~~-~~~~~~~~~~~i~~~~~~~~~~tt~~~~~~r~y~~~~p~~~~~~~~~~~~~~~~~~~ 115 (361)
T KOG3955|consen 54 GDLLR-KVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRE 115 (361)
T ss_pred ecccc-cccccccCCCccccccccccCCCCCcchhhhhhhhcchhhhhhcccccCCCccceee
Confidence 45666 9999999999999999999999999999999999999 9999999999999999876
No 3
>PF03567 Sulfotransfer_2: Sulfotransferase family; InterPro: IPR005331 This entry consists of a number of carbohydrate sulphotransferases that transfer sulphate to carbohydrate groups in glycoproteins and glycolipids. These include: Carbohydrate sulphotransferases 8 and 9, which transfer sulphate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans []. They function in the biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulphation of their carbohydrate structures. Carbohydrate sulphotransferase 10, which transfers sulphate to position 3 of the terminal glucuronic acid in both protein- and lipid-linked oligosaccharides []. It directs the biosynthesis of the HNK-1 carbohydrate structure, a sulphated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult. Carbohydrate sulphotransferases 11 - 13, which catalyze the transfer of sulphate to position 4 of the GalNAc residue of chondroitin []. Chondroitin sulphate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Some, thought not all, of these enzymes also transfer sulphate to dermatan. Carbohydrate sulphotransferase D4ST1, which transfers sulphate to position 4 of the GalNAc residue of dermatan sulphate []. Heparan sulphate 2-O-sulphotransferase (HS2ST). Heparan sulphate (HS) is a co-receptor for a number of growth factors, morphogens, and adhesion proteins. HS biosynthetic modifications may determine the strength and outcome of HS-ligand interactions. Mice that lack HS2ST undergo developmental failure only after midgestation,the most dramatic effect being the complete failure of kidney development []. Heparan-sulphate 6-O-sulphotransferase (HS6ST), which catalyses the transfer of sulphate from adenosine 3'-phosphate, 5'-phosphosulphate to the 6th position of the N -sulphoglucosamine residue in heparan sulphate []. Chondroitin 6-sulphotransferase catalyses the transfer of sulphate to position 6 of the N-acetylgalactosamine residue of chondroitin []. ; GO: 0008146 sulfotransferase activity, 0016021 integral to membrane; PDB: 3F5F_A.
Probab=54.65 E-value=0.11 Score=33.68 Aligned_cols=50 Identities=26% Similarity=0.268 Sum_probs=29.8
Q ss_pred CccceecceecccCCCCCCeecccCCeeeeecCCCCCceeEEEecccceeecccccchhhc
Q psy6014 2 GNSTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTGWKCGLHADWTELT 62 (69)
Q Consensus 2 tgGTtfgrhLV~~l~l~~pC~C~~~~krc~C~RP~~~~~WLFSRySTGW~CGLHADwTELt 62 (69)
||||++..-|-.... + .+.+..|..++.|+..++..+|.....++++++.
T Consensus 19 ~g~Ts~~~~l~~~~~----------~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 68 (253)
T PF03567_consen 19 TGGTSLKSILRRLYG----------K-EFTKDNPSIPENWLHFKRYCGWGHIEFRDLSELS 68 (253)
T ss_dssp SSHHHHHHHHHHHHH----------G-S---HHHHHHHH-GGG-SEEEEES-----GGGGT
T ss_pred HHHHHHHHHHHHHhh----------h-hhhccccccccccccccchhhhhhHHHhHHhhcc
Confidence 788888877766543 2 5556566666789988889999999999998883
No 4
>PF04622 ERG2_Sigma1R: ERG2 and Sigma1 receptor like protein; InterPro: IPR006716 This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor. C-8 sterol isomerase (delta-8--delta-7 sterol isomerase), catalyses a reaction in ergosterol biosynthesis, which results in unsaturation at C-7 in the B ring of sterols []. Sigma 1 receptor is a low molecular mass mammalian protein located in the endoplasmic reticulum [], which interacts with endogenous steroid hormones, such as progesterone and testosterone []. It also binds the sigma ligands, which are a set of chemically unrelated drugs including haloperidol, pentazocine, and ditolylguanidine []. Sigma1 effectors are not well understood, but sigma1 agonists have been observed to affect NMDA receptor function, the alpha-adrenergic system and opioid analgesia.; GO: 0000247 C-8 sterol isomerase activity, 0006696 ergosterol biosynthetic process, 0005783 endoplasmic reticulum
Probab=34.26 E-value=22 Score=26.31 Aligned_cols=26 Identities=35% Similarity=0.622 Sum_probs=22.3
Q ss_pred CCCceeEEEec--ccceeecccccchhh
Q psy6014 36 NRHEVWLFSRY--STGWKCGLHADWTEL 61 (69)
Q Consensus 36 ~~~~~WLFSRy--STGW~CGLHADwTEL 61 (69)
...+.|+|+-. ..|.+|=|||-.||.
T Consensus 73 ~~~~~WvfnnaGGamG~m~iLHaS~tEY 100 (216)
T PF04622_consen 73 SNDSEWVFNNAGGAMGSMCILHASITEY 100 (216)
T ss_pred CCCCceEEECCCchhhhhhhhhhhhHhH
Confidence 44679999985 679999999999997
No 5
>PF06377 Adipokin_hormo: Adipokinetic hormone; InterPro: IPR010475 This family consists of several insect adipokinetic hormone as well as the related crustacean red pigment concentrating hormone (RPCH) []. Flight activity of insects comprises one of the most intense biochemical processes known in nature, and therefore provides an attractive model system to study the hormonal regulation of metabolism during physical exercise. In long-distance flying insects, such as the migratory locust, both carbohydrate and lipid reserves are utilised as fuels for sustained flight activity. The mobilisation of these energy stores in Locusta migratoria (Migratory locust) is mediated by three structurally related adipokinetic hormones (AKHs), which are all capable of stimulating the release of both carbohydrates and lipids from the fat body [].; GO: 0005179 hormone activity
Probab=29.58 E-value=20 Score=21.39 Aligned_cols=19 Identities=26% Similarity=0.646 Sum_probs=11.2
Q ss_pred cccceeecccccchhh--ccccc
Q psy6014 46 YSTGWKCGLHADWTEL--TSCVH 66 (69)
Q Consensus 46 ySTGW~CGLHADwTEL--t~CV~ 66 (69)
||+|| |=-+-=++. .+|.+
T Consensus 4 FSp~W--GKRs~~~~~~~~~C~~ 24 (48)
T PF06377_consen 4 FSPGW--GKRSAGARGRADDCKS 24 (48)
T ss_pred cCCCc--ccccccCCCCCCCCCC
Confidence 89999 755444443 34543
No 6
>KOG4710|consensus
Probab=29.27 E-value=32 Score=25.36 Aligned_cols=22 Identities=32% Similarity=0.623 Sum_probs=18.2
Q ss_pred CceeEEEecccceeecccccchhh
Q psy6014 38 HEVWLFSRYSTGWKCGLHADWTEL 61 (69)
Q Consensus 38 ~~~WLFSRySTGW~CGLHADwTEL 61 (69)
...|||.+|-|| |++|-.=+|+
T Consensus 68 ~H~WlfRd~~tg--~~~lVn~~ei 89 (170)
T KOG4710|consen 68 THSWLFRDYYTG--ERMLVNSQEI 89 (170)
T ss_pred CceeEEeeccCC--ceeEEcceee
Confidence 368999999999 8888776665
No 7
>PF07663 EIIBC-GUT_C: Sorbitol phosphotransferase enzyme II C-terminus; InterPro: IPR011638 The Gut family consists only of glucitol-specific permeases, but these occur both in Gram-negative and Gram-positive bacteria. Escherichia coli contains IIA protein, IIC protein and IIBC protein. This entry represents the C-terminal conserved region of the IIBC component.; GO: 0008982 protein-N(PI)-phosphohistidine-sugar phosphotransferase activity, 0009401 phosphoenolpyruvate-dependent sugar phosphotransferase system, 0016021 integral to membrane
Probab=26.42 E-value=16 Score=24.62 Aligned_cols=12 Identities=42% Similarity=0.523 Sum_probs=10.1
Q ss_pred eeEEEeccccee
Q psy6014 40 VWLFSRYSTGWK 51 (69)
Q Consensus 40 ~WLFSRySTGW~ 51 (69)
.=||||+.||..
T Consensus 69 avL~SR~itGp~ 80 (93)
T PF07663_consen 69 AVLYSRFITGPL 80 (93)
T ss_pred hhhhhhhhcccH
Confidence 569999999964
No 8
>PF08212 Lipocalin_2: Lipocalin-like domain; InterPro: IPR000566 Proteins which transport small hydrophobic molecules such as steroids, bilins, retinoids, and lipids share limited regions of sequence homology and a common tertiary structure architecture [, , , , ]. This is an eight stranded antiparallel beta-barrel with a repeated + 1 topology enclosing a internal ligand binding site [, ]. The name 'lipocalin' has been proposed [] for this protein family, but cytosolic fatty-acid binding proteins are also included. The sequences of most members of the family, the core or kernal lipocalins, are characterised by three short conserved stretches of residues, while others, the outlier lipocalin group, share only one or two of these [, ]. Proteins known to belong to this family include alpha-1-microglobulin (protein HC); alpha-1-acid glycoprotein (orosomucoid) []; aphrodisin; apolipoprotein D; beta-lactoglobulin; complement component C8 gamma chain []; crustacyanin []; epididymal-retinoic acid binding protein (E-RABP) []; insectacyanin; odorant-binding protein (OBP); human pregnancy-associated endometrial alpha-2 globulin; probasin (PB), a rat prostatic protein; prostaglandin D synthase (5.3.99.2 from EC) []; purpurin; Von Ebner's gland protein (VEGP) []; and lizard epididymal secretory protein IV (LESP IV) [].; GO: 0005488 binding; PDB: 3EBW_B 1QWD_A 2ACO_A 3MBT_A.
Probab=22.46 E-value=61 Score=20.93 Aligned_cols=13 Identities=38% Similarity=0.968 Sum_probs=10.3
Q ss_pred CCCCCceeEEEec
Q psy6014 34 RPNRHEVWLFSRY 46 (69)
Q Consensus 34 RP~~~~~WLFSRy 46 (69)
.|+.+..|++||=
T Consensus 101 ~~~~~~~WILsR~ 113 (143)
T PF08212_consen 101 SPDREYLWILSRT 113 (143)
T ss_dssp ECCCCEEEEEESS
T ss_pred cCCCCEEEEEeCC
Confidence 4677789999994
No 9
>TIGR00825 EIIBC-GUT PTS system, glucitol/sorbitol-specific, IIBC component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Gut family consists only of glucitol-specific permeases, but these occur both in Gram-negative and Gram-positive bacteria.E. coli consists of IIA protein, a IIC protein and a IIBC protein. This family is specific for the IIBC component.
Probab=22.21 E-value=40 Score=27.06 Aligned_cols=13 Identities=38% Similarity=0.399 Sum_probs=10.5
Q ss_pred ceeEEEeccccee
Q psy6014 39 EVWLFSRYSTGWK 51 (69)
Q Consensus 39 ~~WLFSRySTGW~ 51 (69)
..=|||||.||..
T Consensus 305 PsVLySRFltG~~ 317 (331)
T TIGR00825 305 PSVLVSRFMTGAP 317 (331)
T ss_pred cceeeeccccccH
Confidence 3579999999965
No 10
>PRK10477 outer membrane lipoprotein Blc; Provisional
Probab=18.81 E-value=74 Score=21.50 Aligned_cols=13 Identities=38% Similarity=0.948 Sum_probs=10.5
Q ss_pred CCCCCceeEEEec
Q psy6014 34 RPNRHEVWLFSRY 46 (69)
Q Consensus 34 RP~~~~~WLFSRy 46 (69)
.|+.+..||+||=
T Consensus 132 ~~~~~~~wIlsR~ 144 (177)
T PRK10477 132 GPDRDYLWILSRT 144 (177)
T ss_pred cCCCCEEEEEeCC
Confidence 5677889999983
Done!