Query         psy6018
Match_columns 111
No_of_seqs    45 out of 47
Neff          2.6 
Searched_HMMs 46136
Date          Sat Aug 17 00:26:33 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6018.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6018hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3955|consensus              100.0 3.3E-35 7.2E-40  244.0   1.0  109    3-111    46-157 (361)
  2 KOG3955|consensus               98.7 5.4E-09 1.2E-13   88.1   1.7   77   16-95     38-115 (361)
  3 PF03567 Sulfotransfer_2:  Sulf  98.3 5.4E-09 1.2E-13   73.8  -6.3   73   18-102     3-77  (253)
  4 PF09907 DUF2136:  Uncharacteri  76.3     5.9 0.00013   26.9   4.1   45    5-49     28-72  (76)
  5 COG4680 Uncharacterized protei  71.8     7.2 0.00016   28.6   3.9   40   11-50     52-91  (98)
  6 PF06990 Gal-3-0_sulfotr:  Gala  45.1     9.1  0.0002   32.6   0.6   30   25-54     68-102 (402)
  7 KOG3922|consensus               36.3      20 0.00043   31.4   1.3   43    3-46     54-100 (361)
  8 PF05578 Peptidase_S31:  Pestiv  30.4      28 0.00062   28.2   1.3   18   17-36    122-140 (211)
  9 PF04622 ERG2_Sigma1R:  ERG2 an  27.7      31 0.00066   27.7   1.0   26   68-93     73-100 (216)
 10 PF10272 Tmpp129:  Putative tra  26.9      18 0.00038   31.1  -0.5   11   68-78    331-341 (358)
 11 TIGR03421 FeS_CyaY iron donor   23.7      61  0.0013   22.9   1.8   40   69-109    54-100 (102)
 12 PRK12390 1-aminocyclopropane-1  23.6      58  0.0013   26.0   1.9   19   20-42    311-329 (337)
 13 PF06377 Adipokin_hormo:  Adipo  22.3      30 0.00066   22.3   0.1   19   78-98      4-24  (48)
 14 KOG3489|consensus               21.7      45 0.00096   24.0   0.8   13   91-103    56-68  (86)
 15 PF15627 CEP76-C2:  CEP76 C2 do  21.7   1E+02  0.0022   23.7   2.8   47   27-76      9-67  (156)
 16 TIGR02683 upstrm_HI1419 probab  21.0      95  0.0021   20.7   2.3   21   16-36     60-81  (95)

No 1  
>KOG3955|consensus
Probab=100.00  E-value=3.3e-35  Score=244.03  Aligned_cols=109  Identities=48%  Similarity=0.932  Sum_probs=103.7

Q ss_pred             cccccccccCCCc-eeeecCCCcEEEEEEeeccCCceeeeeeeccCCCCCCcccccCceeeeecCCCCCCeeEEEeeece
Q psy6018           3 YDYENDEATGSND-QRFDINAHDVMVFLHIQKTGGTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTG   81 (111)
Q Consensus         3 y~y~~~~~~~~~~-~~Fdi~~~dViVfLHIQKTgGTtFgrhLV~~l~l~~pC~c~~~~Krc~C~rP~~~etWLFSRyStG   81 (111)
                      |.|+++.+++... +.|+++++|+|||+|||||+||||+|+|||+..+.+||.|+.++|+|.|.+|..+|||||||||||
T Consensus        46 ~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~tt~~~~~~r~y~~~~p~~~~~~~~~~~~~~~~~~~twlfsr~s~g  125 (361)
T KOG3955|consen   46 VPRYNFTRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKRETWLFSRFSTG  125 (361)
T ss_pred             eeEEEEEEecccccccccccCCCccccccccccCCCCCcchhhhhhhhcchhhhhhcccccCCCccceeeeeeccccccc
Confidence            6788888888876 899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeeccccchhhh--hhhhhHhhhcccccccCC
Q psy6018          82 WKCGLHADWTEL--TSCVHSELDKNEGHVQRR  111 (111)
Q Consensus        82 W~CGLHADwTEL--t~CV~~~l~k~~g~~~kR  111 (111)
                      |.|||||||||+  ..|++..+++..+...+|
T Consensus       126 ~~~glhad~te~vv~~~~~~~~r~~~~~~~~r  157 (361)
T KOG3955|consen  126 WSCGLHADWTESVVDGKRDARLRPSRWRIFKR  157 (361)
T ss_pred             cceeeecchhhhhccceeccccChhhhhhccc
Confidence            999999999999  899999999998887765


No 2  
>KOG3955|consensus
Probab=98.70  E-value=5.4e-09  Score=88.10  Aligned_cols=77  Identities=5%  Similarity=-0.236  Sum_probs=71.3

Q ss_pred             eeeecCCCcEEEEEEeeccCCceeeeeeeccCCCCCCcccccCceeeeecCCCCCCeeEEE-eeeceeeeccccchhhhh
Q psy6018          16 QRFDINAHDVMVFLHIQKTGGTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFS-RYSTGWKCGLHADWTELT   94 (111)
Q Consensus        16 ~~Fdi~~~dViVfLHIQKTgGTtFgrhLV~~l~l~~pC~c~~~~Krc~C~rP~~~etWLFS-RyStGW~CGLHADwTELt   94 (111)
                      .++++.+  |++|+||+++++|+ |.+|+.......+|.|..+.+.|+|.++...+.|+++ +.+++|.|+.|+||++++
T Consensus        38 ~~~~~~~--~~~~~~~~~~~~~~-~~~~~~~~~~~i~~~~~~~~~~tt~~~~~~r~y~~~~p~~~~~~~~~~~~~~~~~~  114 (361)
T KOG3955|consen   38 EDESSAR--FVPRYNFTRGDLLR-KVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQLEQPCECRVGQKKCTCHRPGKR  114 (361)
T ss_pred             hhccccc--eeeEEEEEEecccc-cccccccCCCccccccccccCCCCCcchhhhhhhhcchhhhhhcccccCCCcccee
Confidence            3444444  99999999999999 9999999999999999999999999999999999999 999999999999999997


Q ss_pred             h
Q psy6018          95 S   95 (111)
Q Consensus        95 ~   95 (111)
                      +
T Consensus       115 ~  115 (361)
T KOG3955|consen  115 E  115 (361)
T ss_pred             e
Confidence            6


No 3  
>PF03567 Sulfotransfer_2:  Sulfotransferase family;  InterPro: IPR005331 This entry consists of a number of carbohydrate sulphotransferases that transfer sulphate to carbohydrate groups in glycoproteins and glycolipids. These include:    Carbohydrate sulphotransferases 8 and 9, which transfer sulphate to position 4 of non-reducing N-acetylgalactosamine (GalNAc) residues in both N-glycans and O-glycans []. They function in the biosynthesis of glycoprotein hormones lutropin and thyrotropin, by mediating sulphation of their carbohydrate structures.     Carbohydrate sulphotransferase 10, which transfers sulphate to position 3 of the terminal glucuronic acid in both protein- and lipid-linked oligosaccharides []. It directs the biosynthesis of the HNK-1 carbohydrate structure, a sulphated glucuronyl-lactosaminyl residue carried by many neural recognition molecules, which is involved in cell interactions during ontogenetic development and in synaptic plasticity in the adult.      Carbohydrate sulphotransferases 11 - 13, which catalyze the transfer of sulphate to position 4 of the GalNAc residue of chondroitin []. Chondroitin sulphate constitutes the predominant proteoglycan present in cartilage and is distributed on the surfaces of many cells and extracellular matrices. Some, thought not all, of these enzymes also transfer sulphate to dermatan.     Carbohydrate sulphotransferase D4ST1, which transfers sulphate to position 4 of the GalNAc residue of dermatan sulphate [].     Heparan sulphate 2-O-sulphotransferase (HS2ST). Heparan sulphate (HS) is a co-receptor for a number of growth factors, morphogens, and adhesion proteins. HS biosynthetic modifications may determine the strength and outcome of HS-ligand interactions. Mice that lack HS2ST undergo developmental failure only after midgestation,the most dramatic effect being the complete failure of kidney development [].     Heparan-sulphate 6-O-sulphotransferase (HS6ST), which catalyses the transfer of sulphate from adenosine 3'-phosphate, 5'-phosphosulphate to the 6th position of the N -sulphoglucosamine residue in heparan sulphate [].     Chondroitin 6-sulphotransferase catalyses the transfer of sulphate to position 6 of the N-acetylgalactosamine residue of chondroitin [].  ; GO: 0008146 sulfotransferase activity, 0016021 integral to membrane; PDB: 3F5F_A.
Probab=98.34  E-value=5.4e-09  Score=73.78  Aligned_cols=73  Identities=32%  Similarity=0.409  Sum_probs=39.8

Q ss_pred             eecCCCcEEEEEEeeccCCceeeeeeeccCCCCCCcccccCceeeeecCCCCCCeeEEEeeeceeeeccccchhhh--hh
Q psy6018          18 FDINAHDVMVFLHIQKTGGTSFGRHLVSDLDLQRPCSCQRKKKRCYCFRPNRHEVWLFSRYSTGWKCGLHADWTEL--TS   95 (111)
Q Consensus        18 Fdi~~~dViVfLHIQKTgGTtFgrhLV~~l~l~~pC~c~~~~Krc~C~rP~~~etWLFSRyStGW~CGLHADwTEL--t~   95 (111)
                      |-|..++.|||+||+|||||++..-|-....          + .+.+..|..++.|+..++..+|.+...++++++  ..
T Consensus         3 ~~~~~~~~i~f~~ipK~g~Ts~~~~l~~~~~----------~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   71 (253)
T PF03567_consen    3 FIISPKHKIIFCHIPKTGGTSLKSILRRLYG----------K-EFTKDNPSIPENWLHFKRYCGWGHIEFRDLSELSRQE   71 (253)
T ss_dssp             ----S--EEEE---SSSSHHHHHHHHHHHHH----------G-S---HHHHHHHH-GGG-SEEEEES-----GGGGT-SS
T ss_pred             CccCCCCcEEEEecCCHHHHHHHHHHHHHhh----------h-hhhccccccccccccccchhhhhhHHHhHHhhcchhh
Confidence            5677899999999999999999877766533          3 666666777789999999999999999999999  55


Q ss_pred             hhhHhhh
Q psy6018          96 CVHSELD  102 (111)
Q Consensus        96 CV~~~l~  102 (111)
                      + +..++
T Consensus        72 ~-~~~~~   77 (253)
T PF03567_consen   72 F-DRILN   77 (253)
T ss_dssp             -------
T ss_pred             c-ccccc
Confidence            5 55444


No 4  
>PF09907 DUF2136:  Uncharacterized protein conserved in bacteria (DUF2136);  InterPro: IPR018669  HigB (YgjN) is the toxin of the HigB-HigA toxin-antitoxin system, acting as a translation-dependent mRNA interferase. HigB inhibits protein synthesis by cleaving translated mRNAs within the coding region []. ; GO: 0016788 hydrolase activity, acting on ester bonds
Probab=76.30  E-value=5.9  Score=26.90  Aligned_cols=45  Identities=11%  Similarity=0.210  Sum_probs=35.3

Q ss_pred             cccccccCCCceeeecCCCcEEEEEEeeccCCceeeeeeeccCCC
Q psy6018           5 YENDEATGSNDQRFDINAHDVMVFLHIQKTGGTSFGRHLVSDLDL   49 (111)
Q Consensus         5 y~~~~~~~~~~~~Fdi~~~dViVfLHIQKTgGTtFgrhLV~~l~l   49 (111)
                      |.++..+.++-+-|||.|+..=+.+-|+=..+..|-|++.++-+-
T Consensus        28 f~~ad~v~~~~~vFnI~GN~yRlI~~I~f~~~~v~Ir~igTHaEY   72 (76)
T PF09907_consen   28 FPSADIVKNNRVVFNIGGNKYRLIAKIDFERQIVYIRFIGTHAEY   72 (76)
T ss_pred             CcchhhhcCCEEEEEcCCCcEEEEEEEEeCceEEEEEEeecHHHh
Confidence            445555556777899999988888888888999999999877543


No 5  
>COG4680 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=71.82  E-value=7.2  Score=28.59  Aligned_cols=40  Identities=15%  Similarity=0.166  Sum_probs=33.5

Q ss_pred             cCCCceeeecCCCcEEEEEEeeccCCceeeeeeeccCCCC
Q psy6018          11 TGSNDQRFDINAHDVMVFLHIQKTGGTSFGRHLVSDLDLQ   50 (111)
Q Consensus        11 ~~~~~~~Fdi~~~dViVfLHIQKTgGTtFgrhLV~~l~l~   50 (111)
                      ..++.+-|||+|++.=+.+||----+--|.|+++++-+-.
T Consensus        52 ~~Dnr~Vfdi~GN~yRLIvhv~y~~~ki~IkfvgTHkEYD   91 (98)
T COG4680          52 YLDNRVVFDIGGNKYRLIVHVAYEFHKIFIKFVGTHKEYD   91 (98)
T ss_pred             eccceEEEEcCCCEEEEEEEEEeecceEEeeeeecchhhh
Confidence            4566777999999999999998888889999998876644


No 6  
>PF06990 Gal-3-0_sulfotr:  Galactose-3-O-sulfotransferase ;  InterPro: IPR009729 This family consists of several mammalian galactose-3-O-sulphotransferase proteins. Gal-3-O-sulphotransferase is thought to play a critical role in 3'-sulphation of N-acetyllactosamine in both O- and N-glycans [].; GO: 0001733 galactosylceramide sulfotransferase activity, 0009058 biosynthetic process, 0005794 Golgi apparatus, 0016021 integral to membrane
Probab=45.13  E-value=9.1  Score=32.56  Aligned_cols=30  Identities=30%  Similarity=0.493  Sum_probs=21.1

Q ss_pred             EEEEEEeeccCCceeeeeeec-----cCCCCCCcc
Q psy6018          25 VMVFLHIQKTGGTSFGRHLVS-----DLDLQRPCS   54 (111)
Q Consensus        25 ViVfLHIQKTgGTtFgrhLV~-----~l~l~~pC~   54 (111)
                      =||||..-|||+||+--=|-|     +|..--|-.
T Consensus        68 nIvFlKTHKTgSSTv~nIL~Rfg~~~nL~~alP~~  102 (402)
T PF06990_consen   68 NIVFLKTHKTGSSTVQNILFRFGEKHNLTFALPRG  102 (402)
T ss_pred             eEEEEecCCcccHHHHHHHHHHHHHcCCEEecCCC
Confidence            499999999999997644443     445455533


No 7  
>KOG3922|consensus
Probab=36.31  E-value=20  Score=31.36  Aligned_cols=43  Identities=28%  Similarity=0.522  Sum_probs=29.0

Q ss_pred             cccccccccCCC----ceeeecCCCcEEEEEEeeccCCceeeeeeecc
Q psy6018           3 YDYENDEATGSN----DQRFDINAHDVMVFLHIQKTGGTSFGRHLVSD   46 (111)
Q Consensus         3 y~y~~~~~~~~~----~~~Fdi~~~dViVfLHIQKTgGTtFgrhLV~~   46 (111)
                      |.|...++.-.+    +..+|..-..|+||.-+-|||.|||=- |.++
T Consensus        54 ~qyl~~~~~t~d~~r~~~~~~~~~~~vViyNRVpKtGStTf~n-iayd  100 (361)
T KOG3922|consen   54 YQYLKSTGQTSDNVRDDNNTDKEEMEVVIYNRVPKTGSTTFVN-IAYD  100 (361)
T ss_pred             hhhhccccccccCCCCCcccccccceEEEEecCCCccchhHHH-HHHH
Confidence            445444443333    334777778899999999999999954 4444


No 8  
>PF05578 Peptidase_S31:  Pestivirus NS3 polyprotein peptidase S31;  InterPro: IPR000280 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This group of serine peptidases belong to MEROPS peptidase family S31 (clan PA(S)). The type example is pestivirus NS3 polyprotein peptidase from bovine viral diarrhea virus, which is Type 1 pestivirus. The pestiviruses are single-stranded RNA viruses whose genomes encode one large polyprotein []. The p80 endopeptidase resides towards the middle of the polyprotein and is responsible for processing all non-structural pestivirus proteins [, ]. The p80 enzyme is similar to other proteases in the PA(S) clan and is predicted to have a fold similar to that of chymotrypsin [, ]. An HDS catalytic triad has been identified [].; GO: 0004252 serine-type endopeptidase activity, 0006508 proteolysis
Probab=30.41  E-value=28  Score=28.18  Aligned_cols=18  Identities=44%  Similarity=0.780  Sum_probs=13.1

Q ss_pred             eeecCC-CcEEEEEEeeccCC
Q psy6018          17 RFDINA-HDVMVFLHIQKTGG   36 (111)
Q Consensus        17 ~Fdi~~-~dViVfLHIQKTgG   36 (111)
                      .-||+| .+-|  +|.|||||
T Consensus       122 a~nisgtkga~--vhlqk~gg  140 (211)
T PF05578_consen  122 ATNISGTKGAM--VHLQKTGG  140 (211)
T ss_pred             ccccccCcceE--EEEeccCC
Confidence            356776 5555  49999999


No 9  
>PF04622 ERG2_Sigma1R:  ERG2 and Sigma1 receptor like protein;  InterPro: IPR006716 This family consists of the fungal C-8 sterol isomerase and mammalian sigma1 receptor. C-8 sterol isomerase (delta-8--delta-7 sterol isomerase), catalyses a reaction in ergosterol biosynthesis, which results in unsaturation at C-7 in the B ring of sterols []. Sigma 1 receptor is a low molecular mass mammalian protein located in the endoplasmic reticulum [], which interacts with endogenous steroid hormones, such as progesterone and testosterone []. It also binds the sigma ligands, which are a set of chemically unrelated drugs including haloperidol, pentazocine, and ditolylguanidine []. Sigma1 effectors are not well understood, but sigma1 agonists have been observed to affect NMDA receptor function, the alpha-adrenergic system and opioid analgesia.; GO: 0000247 C-8 sterol isomerase activity, 0006696 ergosterol biosynthetic process, 0005783 endoplasmic reticulum
Probab=27.69  E-value=31  Score=27.68  Aligned_cols=26  Identities=35%  Similarity=0.622  Sum_probs=22.5

Q ss_pred             CCCCeeEEEee--eceeeeccccchhhh
Q psy6018          68 NRHEVWLFSRY--STGWKCGLHADWTEL   93 (111)
Q Consensus        68 ~~~etWLFSRy--StGW~CGLHADwTEL   93 (111)
                      ...+.|+|+-.  ..|+.|=|||-.||.
T Consensus        73 ~~~~~WvfnnaGGamG~m~iLHaS~tEY  100 (216)
T PF04622_consen   73 SNDSEWVFNNAGGAMGSMCILHASITEY  100 (216)
T ss_pred             CCCCceEEECCCchhhhhhhhhhhhHhH
Confidence            55689999975  679999999999997


No 10 
>PF10272 Tmpp129:  Putative transmembrane protein precursor;  InterPro: IPR018801  This entry consists of proteins conserved from worms to humans. They are purported to be transmembrane protein-precursors but their function is unknown. 
Probab=26.92  E-value=18  Score=31.09  Aligned_cols=11  Identities=27%  Similarity=0.661  Sum_probs=7.8

Q ss_pred             CCCCeeEEEee
Q psy6018          68 NRHEVWLFSRY   78 (111)
Q Consensus        68 ~~~etWLFSRy   78 (111)
                      ...|+||-||-
T Consensus       331 ~~~~~Wl~~~~  341 (358)
T PF10272_consen  331 QHPETWLSGKC  341 (358)
T ss_pred             CChhhhhcCCC
Confidence            45689998763


No 11 
>TIGR03421 FeS_CyaY iron donor protein CyaY. Members of this protein family are the iron-sulfur cluster (FeS) metabolism protein CyaY, a homolog of eukaryotic frataxin. ISC is one of several bacterial systems for FeS assembly; we find by Partial Phylogenetic Profiling vs. the ISC system that CyaY most like work with the ISC system for FeS cluster biosynthesis. A study of of cyaY mutants in Salmonella enterica bears this out. Although the trusted cutoff is set low enough to include eukaryotic frataxin sequences, a narrower, exception-type model (TIGR03421) identifies identifies members of that specific set.
Probab=23.73  E-value=61  Score=22.88  Aligned_cols=40  Identities=23%  Similarity=0.513  Sum_probs=26.3

Q ss_pred             CCCeeEEEeeeceeeecc-ccch------hhhhhhhhHhhhccccccc
Q psy6018          69 RHEVWLFSRYSTGWKCGL-HADW------TELTSCVHSELDKNEGHVQ  109 (111)
Q Consensus        69 ~~etWLFSRyStGW~CGL-HADw------TELt~CV~~~l~k~~g~~~  109 (111)
                      ..+.||-|+ |.|+.=.. -+.|      .||..++...|.+.-|..+
T Consensus        54 ~~QIWlasp-sG~~hF~~~~~~Wi~~r~g~~l~~~L~~~~~~~~g~~v  100 (102)
T TIGR03421        54 LHQIWLAAK-SGGFHFDYDGGAWIDTRDGEELWALLARACSEQAGEPV  100 (102)
T ss_pred             hhhheeecC-CCCccceecCCEEEECCCCcHHHHHHHHHHHHHhCCcc
Confidence            456999999 76642111 0223      4788888888888877665


No 12 
>PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional
Probab=23.60  E-value=58  Score=26.04  Aligned_cols=19  Identities=16%  Similarity=0.307  Sum_probs=13.6

Q ss_pred             cCCCcEEEEEEeeccCCceeeee
Q psy6018          20 INAHDVMVFLHIQKTGGTSFGRH   42 (111)
Q Consensus        20 i~~~dViVfLHIQKTgGTtFgrh   42 (111)
                      |...+-+||+|   ||| ++|++
T Consensus       311 ~~~~~~vv~~h---tgg-~~~~~  329 (337)
T PRK12390        311 FPEGSKVLYAH---LGG-VPALN  329 (337)
T ss_pred             CCCCCeEEEEe---CCC-hHhhh
Confidence            44566899999   899 55543


No 13 
>PF06377 Adipokin_hormo:  Adipokinetic hormone;  InterPro: IPR010475 This family consists of several insect adipokinetic hormone as well as the related crustacean red pigment concentrating hormone (RPCH) []. Flight activity of insects comprises one of the most intense biochemical processes known in nature, and therefore provides an attractive model system to study the hormonal regulation of metabolism during physical exercise. In long-distance flying insects, such as the migratory locust, both carbohydrate and lipid reserves are utilised as fuels for sustained flight activity. The mobilisation of these energy stores in Locusta migratoria (Migratory locust) is mediated by three structurally related adipokinetic hormones (AKHs), which are all capable of stimulating the release of both carbohydrates and lipids from the fat body [].; GO: 0005179 hormone activity
Probab=22.34  E-value=30  Score=22.32  Aligned_cols=19  Identities=26%  Similarity=0.646  Sum_probs=12.0

Q ss_pred             eeceeeeccccchhhh--hhhhh
Q psy6018          78 YSTGWKCGLHADWTEL--TSCVH   98 (111)
Q Consensus        78 yStGW~CGLHADwTEL--t~CV~   98 (111)
                      ||+||  |=-+-=++.  .+|.+
T Consensus         4 FSp~W--GKRs~~~~~~~~~C~~   24 (48)
T PF06377_consen    4 FSPGW--GKRSAGARGRADDCKS   24 (48)
T ss_pred             cCCCc--ccccccCCCCCCCCCC
Confidence            89999  765544444  55654


No 14 
>KOG3489|consensus
Probab=21.73  E-value=45  Score=23.99  Aligned_cols=13  Identities=38%  Similarity=0.654  Sum_probs=10.7

Q ss_pred             hhhhhhhhHhhhc
Q psy6018          91 TELTSCVHSELDK  103 (111)
Q Consensus        91 TELt~CV~~~l~k  103 (111)
                      |=|++||+++||-
T Consensus        56 ~ClsnCV~RfiDt   68 (86)
T KOG3489|consen   56 TCLSNCVNRFIDT   68 (86)
T ss_pred             HHHHHHHHHHHHH
Confidence            4479999999984


No 15 
>PF15627 CEP76-C2:  CEP76 C2 domain
Probab=21.70  E-value=1e+02  Score=23.71  Aligned_cols=47  Identities=36%  Similarity=0.719  Sum_probs=32.5

Q ss_pred             EEEEeeccCCceeeeeeeccCCCCCCcccc------c------CceeeeecCCCCCCeeEEE
Q psy6018          27 VFLHIQKTGGTSFGRHLVSDLDLQRPCSCQ------R------KKKRCYCFRPNRHEVWLFS   76 (111)
Q Consensus        27 VfLHIQKTgGTtFgrhLV~~l~l~~pC~c~------~------~~Krc~C~rP~~~etWLFS   76 (111)
                      .|||+|-=||..|=.||..- + .++|+-.      .      +--.|.| .|.=+|.-||-
T Consensus         9 ~yL~l~vlgGkAFld~l~~~-~-~~~~s~~~l~l~f~~QRF~S~~Vp~~~-eP~f~e~Flf~   67 (156)
T PF15627_consen    9 RYLHLRVLGGKAFLDHLQEP-E-GQVCSTFTLHLHFRGQRFRSKPVPCAC-EPDFNEEFLFE   67 (156)
T ss_pred             eEEEEEEeCchhHhhhhhcc-C-CCCceEEEEEEEecCceEecCCccccc-CCCCCCcEEEE
Confidence            69999999999998888642 1 4566431      1      1226777 78777888874


No 16 
>TIGR02683 upstrm_HI1419 probable addiction module killer protein. Members of this strictly bacterial protein family are small, at roughly 100 amino acids. The gene is almost invariably the upstream member of a gene pair, where the downstream member is a predicted DNA-binding protein from a clade within Pfam helix-turn-helix family pfam01381. These gene pairs, when found on the bacterial chromosome, often are located with prophage regions, but also in both integrated plasmid regions and near housekeeping genes. Analysis suggests that the gene pair may serve as an addiction module.
Probab=20.96  E-value=95  Score=20.73  Aligned_cols=21  Identities=14%  Similarity=0.183  Sum_probs=15.9

Q ss_pred             eeeecCCCcEEEEEE-eeccCC
Q psy6018          16 QRFDINAHDVMVFLH-IQKTGG   36 (111)
Q Consensus        16 ~~Fdi~~~dViVfLH-IQKTgG   36 (111)
                      +-|.+.+..++|.|| .+|++=
T Consensus        60 iif~~~~~~~vvll~gf~Kk~q   81 (95)
T TIGR02683        60 VYFTQRGKVIILLLCGGDKSTQ   81 (95)
T ss_pred             EEEEEECCEEEEEEeCEeccCc
Confidence            447888888888888 777763


Done!