Diaphorina citri psyllid: psy6030


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MVSSHLIWNIVKNNNAYLMKADNIKKWFSKEPGNLPNLASFKYSGLIHSKTIHIQPTADNKGFACVTKRATKKPTADNKGFACVTKRATKKTLSGHVDIGSARMDARLYIFEMGLMSA
cccccEEEEEEEcccEEEEEEccccccECccccccccccccccccccccCEEEEEEcccccEEEEEEEccccccccccccCEEEEcHHHHHHHHHHHHcccccccHHHHHHHHccccc
**SSHLIWNIVKNNNAYLMKADNIKKWFSKEPGNLPNLASFKYSGLIHSKTIHIQPTADNKGFACVTKRAT****ADNKGFACVTKRATKKTLSGHVDIGSARMDARLYIFEMGLM**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVSSHLIWNIVKNNNAYLMKADNIKKWFSKEPGNLPNLASFKYSGLIHSKTIHIQPTADNKGFACVTKRATKKPTADNKGFACVTKRATKKTLSGHVDIGSARMDARLYIFEMGLMSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L28 confidentQ9GS21
60S ribosomal protein L28 confidentQ9VZS5
60S ribosomal protein L28-2 confidentQ9M0E2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022625 [CC]cytosolic large ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A18, chain O
Confidence level:very confident
Coverage over the Query: 2-114
View the alignment between query and template
View the model in PyMOL