Query         psy6045
Match_columns 105
No_of_seqs    114 out of 212
Neff          4.0 
Searched_HMMs 46136
Date          Sat Aug 17 01:07:28 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6045.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6045hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PRK05767 rpl44e 50S ribosomal  100.0   1E-52 2.2E-57  292.1   5.9   91    4-95      1-91  (92)
  2 KOG3464|consensus              100.0 4.4E-52 9.6E-57  293.4   0.2  102    3-104     1-104 (106)
  3 PTZ00157 60S ribosomal protein 100.0 3.5E-49 7.5E-54  270.6   5.3   84    3-86      1-84  (84)
  4 COG1631 RPL42A Ribosomal prote 100.0 9.8E-49 2.1E-53  272.7   5.0   93    4-96      1-94  (94)
  5 PF00935 Ribosomal_L44:  Riboso 100.0   8E-42 1.7E-46  230.8   3.1   77   19-95      1-77  (77)
  6 PRK00504 rpmG 50S ribosomal pr  96.1  0.0033 7.1E-08   39.5   1.4   16    9-24     32-47  (50)
  7 CHL00104 rpl33 ribosomal prote  95.7  0.0056 1.2E-07   40.5   1.4   17    9-25     47-63  (66)
  8 TIGR01023 rpmG_bact ribosomal   95.5   0.008 1.7E-07   38.2   1.5   17    9-25     36-52  (54)
  9 COG0267 RpmG Ribosomal protein  95.4  0.0075 1.6E-07   38.2   1.3   17    9-25     32-48  (50)
 10 PF00471 Ribosomal_L33:  Riboso  95.4  0.0074 1.6E-07   37.5   1.2   16    9-24     30-45  (48)
 11 PRK00595 rpmG 50S ribosomal pr  95.4  0.0086 1.9E-07   37.8   1.4   17    9-25     35-51  (53)
 12 PF08772 NOB1_Zn_bind:  Nin one  90.0     0.2 4.3E-06   33.7   1.6   23    7-29     20-42  (73)
 13 COG2023 RPR2 RNase P subunit R  74.8     2.6 5.7E-05   30.3   2.2   19   70-88     81-99  (105)
 14 PF14205 Cys_rich_KTR:  Cystein  74.7     2.2 4.7E-05   27.6   1.6   19   11-29     28-46  (55)
 15 COG1326 Uncharacterized archae  72.5     1.5 3.2E-05   34.7   0.6   21    8-28      3-24  (201)
 16 PF04032 Rpr2:  RNAse P Rpr2/Rp  68.9     8.2 0.00018   24.7   3.4   14    7-20     42-55  (85)
 17 PRK03954 ribonuclease P protei  68.6     3.1 6.8E-05   30.3   1.5   22   69-90     91-112 (121)
 18 PF03811 Zn_Tnp_IS1:  InsA N-te  63.0     8.3 0.00018   22.5   2.3   29    9-44      3-31  (36)
 19 COG4332 Uncharacterized protei  62.0     9.3  0.0002   30.3   3.1   50   12-89     18-68  (203)
 20 KOG2463|consensus               60.5      10 0.00022   32.5   3.3   59   11-71    257-315 (376)
 21 KOG3507|consensus               60.5     2.3   5E-05   28.1  -0.4   21   72-92     38-60  (62)
 22 KOG1597|consensus               60.3     5.6 0.00012   33.3   1.7   22   13-34      2-23  (308)
 23 PF14803 Nudix_N_2:  Nudix N-te  58.2     5.5 0.00012   23.0   0.9   14   13-26      2-15  (34)
 24 PF06107 DUF951:  Bacterial pro  51.0      12 0.00025   24.3   1.7   17   69-85     29-45  (57)
 25 PF09986 DUF2225:  Uncharacteri  51.0      32  0.0007   26.4   4.5   57   11-84      5-61  (214)
 26 PF06353 DUF1062:  Protein of u  50.3      11 0.00024   27.9   1.7   22   68-89     10-32  (142)
 27 PF13240 zinc_ribbon_2:  zinc-r  48.8     9.1  0.0002   20.2   0.8    9   13-21      1-9   (23)
 28 smart00659 RPOLCX RNA polymera  47.3      16 0.00034   22.0   1.8   22   71-92     19-42  (44)
 29 PF13248 zf-ribbon_3:  zinc-rib  46.4     7.1 0.00015   20.8   0.1    9   11-19     16-24  (26)
 30 PRK03824 hypA hydrogenase nick  42.8      16 0.00034   26.5   1.5   14   12-25    108-121 (135)
 31 PF09855 DUF2082:  Nucleic-acid  42.5      36 0.00078   22.1   3.0   15   69-83     34-48  (64)
 32 PF09297 zf-NADH-PPase:  NADH p  40.6      11 0.00024   20.7   0.3   12   11-22      3-14  (32)
 33 PHA02998 RNA polymerase subuni  40.2      50  0.0011   26.2   4.0   21   69-89    169-189 (195)
 34 PHA02768 hypothetical protein;  38.9     9.6 0.00021   24.4  -0.1   15   69-83      3-17  (55)
 35 PF00096 zf-C2H2:  Zinc finger,  35.1      22 0.00048   17.3   0.9   11   72-82      1-11  (23)
 36 PF10601 zf-LITAF-like:  LITAF-  33.5      44 0.00096   21.2   2.4   25    9-34      5-29  (73)
 37 PF15494 SRCR_2:  Scavenger rec  32.8      28  0.0006   23.2   1.4   13   68-80     85-97  (98)
 38 PF05876 Terminase_GpA:  Phage   32.4      37  0.0008   29.7   2.4   14   69-82    227-240 (557)
 39 COG4481 Uncharacterized protei  32.2      32  0.0007   22.5   1.6   17   69-85     32-48  (60)
 40 PF04828 GFA:  Glutathione-depe  31.6      20 0.00044   22.3   0.5   18    7-24     44-61  (92)
 41 COG3634 AhpF Alkyl hydroperoxi  31.3      22 0.00047   31.5   0.8   18    3-20    327-350 (520)
 42 smart00661 RPOL9 RNA polymeras  31.1      23  0.0005   20.6   0.7   12   71-82     20-31  (52)
 43 PF01096 TFIIS_C:  Transcriptio  30.8      40 0.00087   19.5   1.7   13   69-81     26-38  (39)
 44 COG1998 RPS31 Ribosomal protei  30.2      25 0.00053   22.5   0.7   11    9-19     17-27  (51)
 45 PRK00432 30S ribosomal protein  28.9      27 0.00058   21.5   0.7   10   10-19     19-28  (50)
 46 PF13465 zf-H2C2_2:  Zinc-finge  28.5      33 0.00073   17.9   1.0   10   72-81     15-24  (26)
 47 COG1885 Uncharacterized protei  28.1      29 0.00062   25.4   0.9   13   11-23     49-61  (115)
 48 PF02150 RNA_POL_M_15KD:  RNA p  27.5      26 0.00055   20.0   0.4    8   73-80     22-29  (35)
 49 PF00301 Rubredoxin:  Rubredoxi  25.2      46   0.001   20.3   1.3   13   71-83      1-13  (47)
 50 smart00440 ZnF_C2C2 C2C2 Zinc   25.0      56  0.0012   19.0   1.6   13   69-81     26-38  (40)
 51 PF13912 zf-C2H2_6:  C2H2-type   24.5      43 0.00093   16.9   0.9   11   72-82      2-12  (27)
 52 PF14353 CpXC:  CpXC protein     24.2      59  0.0013   22.5   1.9   48   13-83      3-50  (128)
 53 PF14690 zf-ISL3:  zinc-finger   23.6      45 0.00098   19.0   1.0   10   12-21      3-12  (47)
 54 smart00355 ZnF_C2H2 zinc finge  21.8      26 0.00056   16.5  -0.2   11   72-82      1-11  (26)
 55 PF11023 DUF2614:  Protein of u  21.6      38 0.00082   24.8   0.5   11   11-21     69-79  (114)
 56 PF08882 Acetone_carb_G:  Aceto  21.6      51  0.0011   24.0   1.1   20   10-31     73-92  (112)
 57 TIGR03831 YgiT_finger YgiT-typ  21.5      80  0.0017   17.5   1.8   23   74-96      1-23  (46)
 58 PF13894 zf-C2H2_4:  C2H2-type   21.2      51  0.0011   15.4   0.8   11   72-82      1-11  (24)
 59 COG0375 HybF Zn finger protein  21.1      57  0.0012   23.6   1.3   19    7-25     82-100 (115)
 60 PF06677 Auto_anti-p27:  Sjogre  21.0      45 0.00097   19.9   0.6    9    9-17     32-40  (41)
 61 PF12171 zf-C2H2_jaz:  Zinc-fin  21.0      48   0.001   17.1   0.7    9   12-20      2-10  (27)
 62 smart00714 LITAF Possible memb  20.3      52  0.0011   20.6   0.9   17    4-20     45-61  (67)
 63 PF03716 WCCH:  WCCH motif ;  I  20.3      49  0.0011   17.9   0.6   10   12-21      6-15  (25)
 64 PF04606 Ogr_Delta:  Ogr/Delta-  20.0      49  0.0011   19.6   0.7   14   69-82     23-38  (47)

No 1  
>PRK05767 rpl44e 50S ribosomal protein L44e; Validated
Probab=100.00  E-value=1e-52  Score=292.06  Aligned_cols=91  Identities=43%  Similarity=0.690  Sum_probs=89.9

Q ss_pred             cccCceeeecCcCCCCccceEEEEeecCccccccccceeeeeeccCCCCcccccccccccccceeEEEEEecccccccee
Q psy6045           4 VNVPKQRRTFCKKCKIHKVHKVTQYKKSKERKACQGRRRYDRKQAGYGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQL   83 (105)
Q Consensus         4 m~iPK~~~tyCp~C~kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~k~aK~TKKi~Lrl~C~eC~~~~~~   83 (105)
                      ||||++++||||+|++||+|+||||++|++|++|||+|||||+|+|||||++|||+ +|||||||||+|+|++|++++++
T Consensus         1 m~~PK~~~tyCp~CkkHt~HkV~qyKkGK~s~~a~G~Rry~Rkq~GygGq~kpv~~-~aK~TKKi~Lr~~C~~C~~~~~~   79 (92)
T PRK05767          1 MKMPKKIRTYCPYCKTHTEHEVEKVKKGKRSELKWGQRQYRRKTIGYGGKFSPVPG-GAKPTKKVDLRYRCTECGKAHTR   79 (92)
T ss_pred             CCCCccccccCcCCCCcccEEEEEEecCCcChhHHhhhHHHhhccccCCcCCcccC-CCccceeEEEEEEecccChhhcc
Confidence            89999999999999999999999999999999999999999999999999999998 99999999999999999999999


Q ss_pred             cceeeeeeEecc
Q psy6045          84 PLKRCKHFELGG   95 (105)
Q Consensus        84 ~~~R~KkfElg~   95 (105)
                      +++||++|||++
T Consensus        80 ~~~R~k~fEl~e   91 (92)
T PRK05767         80 EGFRAKKFELVE   91 (92)
T ss_pred             ccceeeeEEEec
Confidence            999999999985


No 2  
>KOG3464|consensus
Probab=100.00  E-value=4.4e-52  Score=293.40  Aligned_cols=102  Identities=75%  Similarity=1.209  Sum_probs=100.1

Q ss_pred             ccccCceeeecCcCCCCccceEEEEeecCccccccccceeeeeeccCCCCcccccccccccccceeEEEEEecc--cccc
Q psy6045           3 HVNVPKQRRTFCKKCKIHKVHKVTQYKKSKERKACQGRRRYDRKQAGYGGQTKPIFRKKAKTTKKIVLRMECTE--CKYR   80 (105)
Q Consensus         3 mm~iPK~~~tyCp~C~kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~k~aK~TKKi~Lrl~C~e--C~~~   80 (105)
                      |||||++++|||++|++|+.|+|+||++|++|++|||.|||||+|+||||||+|||+++|||||||||||||.|  |.+.
T Consensus         1 mvnvpkT~~tfc~kc~kh~~hkVtq~k~gk~s~~aQgkr~YdrkqsGygGQTKpIf~KkaKtTKKiVlrLec~e~~Cksk   80 (106)
T KOG3464|consen    1 MVNVPKTRKTFCKKCGKHTAHKVTQYKKGKDSLYAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLRLECCEPKCKSK   80 (106)
T ss_pred             CCccCCCCcchhhhhcccchhhhhhhhhcccchHhhcCcccccccCCCCccccHHHHHHhhhhhhheeeeeeecccccch
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999664  9999


Q ss_pred             ceecceeeeeeEeccceeccCccc
Q psy6045          81 KQLPLKRCKHFELGGDKKRKVQTK  104 (105)
Q Consensus        81 ~~~~~~R~KkfElg~~kk~~~~~~  104 (105)
                      +|++++||+|||||||++++|++|
T Consensus        81 ~~l~iKrcKhfelGg~kk~kg~~i  104 (106)
T KOG3464|consen   81 RQLAIKRCKHFELGGDKKRKGQAI  104 (106)
T ss_pred             hhhhhhhhceeeecCccccccccc
Confidence            999999999999999999999998


No 3  
>PTZ00157 60S ribosomal protein L36a; Provisional
Probab=100.00  E-value=3.5e-49  Score=270.64  Aligned_cols=84  Identities=71%  Similarity=1.147  Sum_probs=82.4

Q ss_pred             ccccCceeeecCcCCCCccceEEEEeecCccccccccceeeeeeccCCCCcccccccccccccceeEEEEEeccccccce
Q psy6045           3 HVNVPKQRRTFCKKCKIHKVHKVTQYKKSKERKACQGRRRYDRKQAGYGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQ   82 (105)
Q Consensus         3 mm~iPK~~~tyCp~C~kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~k~aK~TKKi~Lrl~C~eC~~~~~   82 (105)
                      |||||++++||||+|++||+|+||||++|++|++|||+|||||+|+|||||++|||+++|||||||||+|+|++|+++++
T Consensus         1 mv~~PK~~~tyC~~C~kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~~kaK~TKKi~Lrl~C~~C~~~~~   80 (84)
T PTZ00157          1 MVNVPKNRKTYCKKCGKHTSHKVSQYKKGKESLFAQGKRRYDRKQSGYGGQTKPIFRKKAKTTKKIVLKLECTKCKSKRQ   80 (84)
T ss_pred             CCcccccccccCcCCCCCccEEEEEeccCCcChhHHhhhhhhhhccCcCCcCccccCccccccceeEEEEEecccCceeE
Confidence            99999999999999999999999999999999999999999999999999999999989999999999999999999999


Q ss_pred             ecce
Q psy6045          83 LPLK   86 (105)
Q Consensus        83 ~~~~   86 (105)
                      .+++
T Consensus        81 ~~~k   84 (84)
T PTZ00157         81 KVLK   84 (84)
T ss_pred             eccC
Confidence            8874


No 4  
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=9.8e-49  Score=272.65  Aligned_cols=93  Identities=51%  Similarity=0.869  Sum_probs=90.9

Q ss_pred             cccCceeeecCcCCCCccceEEEEeecCccccccccceeeeeeccCCCCcccccccccccccceeEEEEEecccccccee
Q psy6045           4 VNVPKQRRTFCKKCKIHKVHKVTQYKKSKERKACQGRRRYDRKQAGYGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQL   83 (105)
Q Consensus         4 m~iPK~~~tyCp~C~kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~k~aK~TKKi~Lrl~C~eC~~~~~~   83 (105)
                      |||||+++||||+|++||.|+||+|++|++|+|+||+|||+|+|+|||||++|+|.++|||||||||+|+|++||++|++
T Consensus         1 mkiPK~~~tyCp~CkkhT~H~V~~~kkgk~s~l~~gqRr~~R~~~GyGg~~rp~p~g~~KptKKv~Lr~~Ct~Cgkah~~   80 (94)
T COG1631           1 MKIPKKRRTYCPYCKKHTIHKVERVKKGKASELAWGQRRYRRKQSGYGGQPRPVPKGKAKPTKKVDLRLRCTECGKAHQR   80 (94)
T ss_pred             CCCCcceeecCcccccceeeeeeehhcCCcchhhHHHHHHHHHhcccCCcCCcccCccCCccceEEEEEEehhhcccccc
Confidence            89999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             -cceeeeeeEeccc
Q psy6045          84 -PLKRCKHFELGGD   96 (105)
Q Consensus        84 -~~~R~KkfElg~~   96 (105)
                       +++|+++|||+++
T Consensus        81 ~~~~Rakr~Elve~   94 (94)
T COG1631          81 TPGFRAKRFELVEE   94 (94)
T ss_pred             CcceeeeeEEEecC
Confidence             5999999999864


No 5  
>PF00935 Ribosomal_L44:  Ribosomal protein L44;  InterPro: IPR000552 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of mammalian [], Trypanosoma brucei, Caenorhabditis elegans and fungal L44, and Haloarcula marismortui LA [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZS_r 1S1I_Z 3O5H_f 3O58_f 3IZR_r 1M1K_4 3CCQ_3 3CCL_3 3CME_3 1K73_4 ....
Probab=100.00  E-value=8e-42  Score=230.84  Aligned_cols=77  Identities=69%  Similarity=1.052  Sum_probs=62.1

Q ss_pred             CccceEEEEeecCccccccccceeeeeeccCCCCcccccccccccccceeEEEEEeccccccceecceeeeeeEecc
Q psy6045          19 IHKVHKVTQYKKSKERKACQGRRRYDRKQAGYGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQLPLKRCKHFELGG   95 (105)
Q Consensus        19 kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~k~aK~TKKi~Lrl~C~eC~~~~~~~~~R~KkfElg~   95 (105)
                      +||+|+|+||++|++|++|||+|||||+|+|||||++|+|+++|||||||||+|+|++|+++++++++||++|||+.
T Consensus         1 kHt~HkV~~yKkgK~s~~a~G~Rry~Rk~~GygGq~kp~~~~kaK~TKKi~Lrl~C~~C~~~~~~~~~R~kkfEl~E   77 (77)
T PF00935_consen    1 KHTEHKVSQYKKGKASPLAQGKRRYDRKQKGYGGQTKPVFRKKAKTTKKIVLRLECTECGKAHMRPGKRCKKFELVE   77 (77)
T ss_dssp             EEEEEEEEE---S--SSTSHHHHHHHHTSSSSSSCCSSS-S----SSEBBEEEEEETTTS-EEEEE-BBESS-EEC-
T ss_pred             CCcceEEEEeccCCcChHHHhhhhhhhhccccCCccccccccCCcccccEEEEEEeCCCCcccccccceeEEEEecC
Confidence            59999999999999999999999999999999999999999999999999999999999999999999999999973


No 6  
>PRK00504 rpmG 50S ribosomal protein L33; Validated
Probab=96.07  E-value=0.0033  Score=39.55  Aligned_cols=16  Identities=38%  Similarity=1.045  Sum_probs=14.4

Q ss_pred             eeeecCcCCCCccceE
Q psy6045           9 QRRTFCKKCKIHKVHK   24 (105)
Q Consensus         9 ~~~tyCp~C~kHt~Hk   24 (105)
                      ..+-|||.|++||.|+
T Consensus        32 elkKycp~c~khtlhk   47 (50)
T PRK00504         32 ELKKFCPRCNKHTLHK   47 (50)
T ss_pred             EEECcCCCCCCeEeee
Confidence            4678999999999997


No 7  
>CHL00104 rpl33 ribosomal protein L33
Probab=95.70  E-value=0.0056  Score=40.53  Aligned_cols=17  Identities=35%  Similarity=0.821  Sum_probs=14.7

Q ss_pred             eeeecCcCCCCccceEE
Q psy6045           9 QRRTFCKKCKIHKVHKV   25 (105)
Q Consensus         9 ~~~tyCp~C~kHt~HkV   25 (105)
                      +.+-|||.|++||.|+=
T Consensus        47 elkKycp~c~kHtlhkE   63 (66)
T CHL00104         47 ELKKFCPYCYKHTIHKE   63 (66)
T ss_pred             EEECcCCCCCCEeeEee
Confidence            46789999999999974


No 8  
>TIGR01023 rpmG_bact ribosomal protein L33, bacterial type. This model describes bacterial ribosomal protein L33 and its chloroplast and mitochondrial equivalents.
Probab=95.47  E-value=0.008  Score=38.18  Aligned_cols=17  Identities=35%  Similarity=0.864  Sum_probs=14.9

Q ss_pred             eeeecCcCCCCccceEE
Q psy6045           9 QRRTFCKKCKIHKVHKV   25 (105)
Q Consensus         9 ~~~tyCp~C~kHt~HkV   25 (105)
                      ..+-|||.|++|+.|+-
T Consensus        36 ~lkKycp~~~khtlhkE   52 (54)
T TIGR01023        36 ELRKYCPVCRKHVLHKE   52 (54)
T ss_pred             EEECcCCCCCCeEeEEe
Confidence            46789999999999974


No 9  
>COG0267 RpmG Ribosomal protein L33 [Translation, ribosomal structure and biogenesis]
Probab=95.45  E-value=0.0075  Score=38.15  Aligned_cols=17  Identities=29%  Similarity=0.860  Sum_probs=14.7

Q ss_pred             eeeecCcCCCCccceEE
Q psy6045           9 QRRTFCKKCKIHKVHKV   25 (105)
Q Consensus         9 ~~~tyCp~C~kHt~HkV   25 (105)
                      +.+-|||.|++||.|+=
T Consensus        32 elkKycp~~~khtlhkE   48 (50)
T COG0267          32 ELKKYCPVCRKHTLHKE   48 (50)
T ss_pred             EEEecCcccccEEEEee
Confidence            46789999999999973


No 10 
>PF00471 Ribosomal_L33:  Ribosomal protein L33;  InterPro: IPR001705 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L33 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L33 has been shown to be on the surface of 50S subunit. L33 belongs to a family of ribosomal proteins which, on the basis of sequence similarities [, , ], groups:  Eubacterial L33. Algal and plant chloroplast L33. Cyanelle L33.   L33 is a small protein of 49 to 66 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3PIO_1 3PIP_1 3PYT_3 3MS1_3 3F1F_6 3F1H_6 3MRZ_3 3PYO_3 3D5B_6 3D5D_6 ....
Probab=95.43  E-value=0.0074  Score=37.45  Aligned_cols=16  Identities=31%  Similarity=1.045  Sum_probs=14.2

Q ss_pred             eeeecCcCCCCccceE
Q psy6045           9 QRRTFCKKCKIHKVHK   24 (105)
Q Consensus         9 ~~~tyCp~C~kHt~Hk   24 (105)
                      ..+-|||.|++||.|+
T Consensus        30 ~lkKycp~~~khtlhk   45 (48)
T PF00471_consen   30 ELKKYCPRCRKHTLHK   45 (48)
T ss_dssp             EEEEEETSSSSEEEEE
T ss_pred             eEeccCCCCCCEecEE
Confidence            4678999999999996


No 11 
>PRK00595 rpmG 50S ribosomal protein L33; Validated
Probab=95.40  E-value=0.0086  Score=37.80  Aligned_cols=17  Identities=18%  Similarity=0.284  Sum_probs=14.7

Q ss_pred             eeeecCcCCCCccceEE
Q psy6045           9 QRRTFCKKCKIHKVHKV   25 (105)
Q Consensus         9 ~~~tyCp~C~kHt~HkV   25 (105)
                      ..+-|||.|++|+.|+-
T Consensus        35 ~lkKycp~~~khtlhkE   51 (53)
T PRK00595         35 ELKKYDPVLRKHVLHKE   51 (53)
T ss_pred             EEECcCCCCCCEEeEEe
Confidence            45789999999999974


No 12 
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=89.97  E-value=0.2  Score=33.65  Aligned_cols=23  Identities=22%  Similarity=0.498  Sum_probs=10.9

Q ss_pred             CceeeecCcCCCCccceEEEEee
Q psy6045           7 PKQRRTFCKKCKIHKVHKVTQYK   29 (105)
Q Consensus         7 PK~~~tyCp~C~kHt~HkV~qyK   29 (105)
                      +..-+-|||+|+.+|..+|+-+=
T Consensus        20 ~~~~k~FCp~CGn~TL~rvsvsv   42 (73)
T PF08772_consen   20 KDMTKQFCPKCGNATLKRVSVSV   42 (73)
T ss_dssp             S-SS--S-SSS--S--EEEE-B-
T ss_pred             CCCCceeCcccCCCcceEEEEEE
Confidence            34557899999999999998764


No 13 
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=74.84  E-value=2.6  Score=30.28  Aligned_cols=19  Identities=26%  Similarity=0.590  Sum_probs=14.8

Q ss_pred             EEEEeccccccceecceee
Q psy6045          70 LRMECTECKYRKQLPLKRC   88 (105)
Q Consensus        70 Lrl~C~eC~~~~~~~~~R~   88 (105)
                      |..+|.+||...--+..|.
T Consensus        81 v~vtC~~CG~~~R~p~~r~   99 (105)
T COG2023          81 VVVTCLECGTIRRYPYGRE   99 (105)
T ss_pred             EEEEecCCCcEEEeccccc
Confidence            8889999999866666543


No 14 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=74.67  E-value=2.2  Score=27.63  Aligned_cols=19  Identities=37%  Similarity=0.698  Sum_probs=15.8

Q ss_pred             eecCcCCCCccceEEEEee
Q psy6045          11 RTFCKKCKIHKVHKVTQYK   29 (105)
Q Consensus        11 ~tyCp~C~kHt~HkV~qyK   29 (105)
                      --|||+|+.-+.-.|.+.+
T Consensus        28 PlyCpKCK~EtlI~v~~~~   46 (55)
T PF14205_consen   28 PLYCPKCKQETLIDVKQLK   46 (55)
T ss_pred             cccCCCCCceEEEEeeccE
Confidence            3799999999988887754


No 15 
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=72.46  E-value=1.5  Score=34.73  Aligned_cols=21  Identities=19%  Similarity=0.309  Sum_probs=16.0

Q ss_pred             ceeeecCcCCC-CccceEEEEe
Q psy6045           8 KQRRTFCKKCK-IHKVHKVTQY   28 (105)
Q Consensus         8 K~~~tyCp~C~-kHt~HkV~qy   28 (105)
                      ..+..+||.|+ .-++|+|-.-
T Consensus         3 ~~iy~~Cp~Cg~eev~hEVik~   24 (201)
T COG1326           3 EEIYIECPSCGSEEVSHEVIKE   24 (201)
T ss_pred             ceEEEECCCCCcchhhHHHHHh
Confidence            35678999999 5777888654


No 16 
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=68.92  E-value=8.2  Score=24.68  Aligned_cols=14  Identities=50%  Similarity=1.009  Sum_probs=8.2

Q ss_pred             CceeeecCcCCCCc
Q psy6045           7 PKQRRTFCKKCKIH   20 (105)
Q Consensus         7 PK~~~tyCp~C~kH   20 (105)
                      |...+++|++|+..
T Consensus        42 ~~~kr~~Ck~C~~~   55 (85)
T PF04032_consen   42 PEIKRTICKKCGSL   55 (85)
T ss_dssp             TTCCCTB-TTT--B
T ss_pred             hHHhcccccCCCCE
Confidence            44567999999983


No 17 
>PRK03954 ribonuclease P protein component 4; Validated
Probab=68.64  E-value=3.1  Score=30.25  Aligned_cols=22  Identities=23%  Similarity=0.395  Sum_probs=16.8

Q ss_pred             EEEEEeccccccceecceeeee
Q psy6045          69 VLRMECTECKYRKQLPLKRCKH   90 (105)
Q Consensus        69 ~Lrl~C~eC~~~~~~~~~R~Kk   90 (105)
                      .|.++|.+||...-.|..+-++
T Consensus        91 ~vvitCl~CG~~kR~P~~~~~k  112 (121)
T PRK03954         91 HVVITCLECGHIMRYPYLREVK  112 (121)
T ss_pred             eEEEECccCCCEEeeccchhhh
Confidence            5789999999987666665554


No 18 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=63.04  E-value=8.3  Score=22.49  Aligned_cols=29  Identities=24%  Similarity=0.523  Sum_probs=17.6

Q ss_pred             eeeecCcCCCCccceEEEEeecCccccccccceeee
Q psy6045           9 QRRTFCKKCKIHKVHKVTQYKKSKERKACQGRRRYD   44 (105)
Q Consensus         9 ~~~tyCp~C~kHt~HkV~qyKkGK~s~~aqG~Rry~   44 (105)
                      ++.-.||+|.....    -||.|+.+.   |.+||+
T Consensus         3 ~i~v~CP~C~s~~~----v~k~G~~~~---G~qryr   31 (36)
T PF03811_consen    3 KIDVHCPRCQSTEG----VKKNGKSPS---GHQRYR   31 (36)
T ss_pred             cEeeeCCCCCCCCc----ceeCCCCCC---CCEeEe
Confidence            34578999987641    356676543   445553


No 19 
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=61.96  E-value=9.3  Score=30.31  Aligned_cols=50  Identities=24%  Similarity=0.564  Sum_probs=36.0

Q ss_pred             ecCcCCCCccceEEEEeecCccccccccceeeeeeccCCCCcccccccccccccceeEEEEEeccccccceecc-eeee
Q psy6045          12 TFCKKCKIHKVHKVTQYKKSKERKACQGRRRYDRKQAGYGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQLPL-KRCK   89 (105)
Q Consensus        12 tyCp~C~kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~k~aK~TKKi~Lrl~C~eC~~~~~~~~-~R~K   89 (105)
                      -.|+.|+.-+...-|    |+-+..|||++                        =-+.|.|+|+.|.+.+..++ -|+.
T Consensus        18 k~C~~Cg~kr~f~cS----g~fRvNAq~K~------------------------LDvWlIYkC~~Cd~tWN~~IfeR~~   68 (203)
T COG4332          18 KRCNSCGVKRAFTCS----GKFRVNAQGKV------------------------LDVWLIYKCTHCDYTWNISIFERLN   68 (203)
T ss_pred             hhCcccCCcceeeec----CcEEEcCCCcE------------------------EEEEEEEEeeccCCccchhhhhccC
Confidence            469999887766543    66666666651                        13589999999999999877 3443


No 20 
>KOG2463|consensus
Probab=60.49  E-value=10  Score=32.50  Aligned_cols=59  Identities=20%  Similarity=0.367  Sum_probs=33.2

Q ss_pred             eecCcCCCCccceEEEEeecCccccccccceeeeeeccCCCCcccccccccccccceeEEE
Q psy6045          11 RTFCKKCKIHKVHKVTQYKKSKERKACQGRRRYDRKQAGYGGQTKPIFRKKAKTTKKIVLR   71 (105)
Q Consensus        11 ~tyCp~C~kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~k~aK~TKKi~Lr   71 (105)
                      +-|||.|+--|.|+|+--=......-+.=+-|+.+...|+- ..=|.| ++.|.++-..|+
T Consensus       257 k~FCp~CG~~TL~K~aVsv~~dG~~~~h~k~r~~~n~RG~~-YSlp~P-kGgk~~kN~~Lr  315 (376)
T KOG2463|consen  257 KDFCPSCGHKTLTKCAVSVDEDGNGQTHFKKRFQWNNRGLQ-YSLPKP-KGGKVAKNPILR  315 (376)
T ss_pred             hhcccccCCCeeeEEEEEecCCCceeEEeecccccccCcce-eecCCC-CCCccccCcccc
Confidence            67999999999999875432221222222223333444441 112555 357777777765


No 21 
>KOG3507|consensus
Probab=60.48  E-value=2.3  Score=28.11  Aligned_cols=21  Identities=43%  Similarity=0.781  Sum_probs=10.6

Q ss_pred             EEeccccccce--ecceeeeeeE
Q psy6045          72 MECTECKYRKQ--LPLKRCKHFE   92 (105)
Q Consensus        72 l~C~eC~~~~~--~~~~R~KkfE   92 (105)
                      ++|.|||+.++  ...+|...||
T Consensus        38 irCReCG~RIlyKkRtkrlvqfe   60 (62)
T KOG3507|consen   38 IRCRECGYRILYKKRTKRLVQFE   60 (62)
T ss_pred             EehhhcchHHHHHHHHhhhheee
Confidence            45556666555  2334444554


No 22 
>KOG1597|consensus
Probab=60.26  E-value=5.6  Score=33.33  Aligned_cols=22  Identities=23%  Similarity=0.374  Sum_probs=19.7

Q ss_pred             cCcCCCCccceEEEEeecCccc
Q psy6045          13 FCKKCKIHKVHKVTQYKKSKER   34 (105)
Q Consensus        13 yCp~C~kHt~HkV~qyKkGK~s   34 (105)
                      +|+.|+.|+++-|+.|..|-.-
T Consensus         2 ~c~~C~~~~~~~V~d~~~gdtv   23 (308)
T KOG1597|consen    2 TCPDCKRHPENLVEDHSAGDTV   23 (308)
T ss_pred             CCCCCCCCCCCeeeeccCCcee
Confidence            6999999999999999999543


No 23 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=58.19  E-value=5.5  Score=23.02  Aligned_cols=14  Identities=21%  Similarity=0.636  Sum_probs=6.1

Q ss_pred             cCcCCCCccceEEE
Q psy6045          13 FCKKCKIHKVHKVT   26 (105)
Q Consensus        13 yCp~C~kHt~HkV~   26 (105)
                      |||.|+...++.|-
T Consensus         2 fC~~CG~~l~~~ip   15 (34)
T PF14803_consen    2 FCPQCGGPLERRIP   15 (34)
T ss_dssp             B-TTT--B-EEE--
T ss_pred             ccccccChhhhhcC
Confidence            88888887766553


No 24 
>PF06107 DUF951:  Bacterial protein of unknown function (DUF951);  InterPro: IPR009296 This family consists of several short hypothetical bacterial proteins of unknown function.
Probab=51.04  E-value=12  Score=24.30  Aligned_cols=17  Identities=24%  Similarity=0.630  Sum_probs=14.9

Q ss_pred             EEEEEeccccccceecc
Q psy6045          69 VLRMECTECKYRKQLPL   85 (105)
Q Consensus        69 ~Lrl~C~eC~~~~~~~~   85 (105)
                      +++++|..||...|.+-
T Consensus        29 DikikC~gCg~~imlpR   45 (57)
T PF06107_consen   29 DIKIKCLGCGRQIMLPR   45 (57)
T ss_pred             cEEEEECCCCCEEEEeH
Confidence            89999999999988653


No 25 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=51.04  E-value=32  Score=26.43  Aligned_cols=57  Identities=21%  Similarity=0.355  Sum_probs=33.3

Q ss_pred             eecCcCCCCccceEEEEeecCccccccccceeeeeeccCCCCcccccccccccccceeEEEEEeccccccceec
Q psy6045          11 RTFCKKCKIHKVHKVTQYKKSKERKACQGRRRYDRKQAGYGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQLP   84 (105)
Q Consensus        11 ~tyCp~C~kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~k~aK~TKKi~Lrl~C~eC~~~~~~~   84 (105)
                      ..-||-|++.  .+++.++.|.-+..   ++-+|         +.|.+. ...|  =.-..-.|..||++-+-.
T Consensus         5 ~~~CPvC~~~--F~~~~vrs~~~r~~---~~d~D---------~~~~Y~-~vnP--~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    5 KITCPVCGKE--FKTKKVRSGKIRVI---RRDSD---------FCPRYK-GVNP--LFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             ceECCCCCCe--eeeeEEEcCCceEe---eecCC---------CccccC-CCCC--eeeeEEECCCCCCccccc
Confidence            4569999875  55667776665543   22222         333332 1222  124566899999997754


No 26 
>PF06353 DUF1062:  Protein of unknown function (DUF1062);  InterPro: IPR009412 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=50.26  E-value=11  Score=27.92  Aligned_cols=22  Identities=23%  Similarity=0.668  Sum_probs=18.0

Q ss_pred             eEEEEEeccccccceecc-eeee
Q psy6045          68 IVLRMECTECKYRKQLPL-KRCK   89 (105)
Q Consensus        68 i~Lrl~C~eC~~~~~~~~-~R~K   89 (105)
                      |.|.|+|+.|++.+..++ -|+.
T Consensus        10 VWLIYrC~~C~~TwN~ti~eR~~   32 (142)
T PF06353_consen   10 VWLIYRCEKCDYTWNMTIFERVN   32 (142)
T ss_pred             EEEEEEcccCcCccccceEeecC
Confidence            679999999999998877 4443


No 27 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=48.82  E-value=9.1  Score=20.15  Aligned_cols=9  Identities=22%  Similarity=0.914  Sum_probs=5.8

Q ss_pred             cCcCCCCcc
Q psy6045          13 FCKKCKIHK   21 (105)
Q Consensus        13 yCp~C~kHt   21 (105)
                      |||+|+..-
T Consensus         1 ~Cp~CG~~~    9 (23)
T PF13240_consen    1 YCPNCGAEI    9 (23)
T ss_pred             CCcccCCCC
Confidence            677777643


No 28 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=47.33  E-value=16  Score=22.03  Aligned_cols=22  Identities=32%  Similarity=0.581  Sum_probs=14.6

Q ss_pred             EEEecccccccee--cceeeeeeE
Q psy6045          71 RMECTECKYRKQL--PLKRCKHFE   92 (105)
Q Consensus        71 rl~C~eC~~~~~~--~~~R~KkfE   92 (105)
                      -.+|.+||+..+.  ...+.+.|+
T Consensus        19 ~irC~~CG~rIlyK~R~~~~~~~~   42 (44)
T smart00659       19 VVRCRECGYRILYKKRTKRLVEVK   42 (44)
T ss_pred             ceECCCCCceEEEEeCCCceEEEE
Confidence            4789999998773  234555554


No 29 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=46.37  E-value=7.1  Score=20.79  Aligned_cols=9  Identities=33%  Similarity=1.028  Sum_probs=6.7

Q ss_pred             eecCcCCCC
Q psy6045          11 RTFCKKCKI   19 (105)
Q Consensus        11 ~tyCp~C~k   19 (105)
                      -.|||+|+.
T Consensus        16 ~~fC~~CG~   24 (26)
T PF13248_consen   16 AKFCPNCGA   24 (26)
T ss_pred             cccChhhCC
Confidence            478888875


No 30 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=42.83  E-value=16  Score=26.46  Aligned_cols=14  Identities=29%  Similarity=0.501  Sum_probs=9.7

Q ss_pred             ecCcCCCCccceEE
Q psy6045          12 TFCKKCKIHKVHKV   25 (105)
Q Consensus        12 tyCp~C~kHt~HkV   25 (105)
                      ..||.|+.+..+-+
T Consensus       108 ~~CP~Cgs~~~~i~  121 (135)
T PRK03824        108 LKCPKCGSRDFEIV  121 (135)
T ss_pred             cCCcCCCCCCcEEe
Confidence            34999998765443


No 31 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=42.45  E-value=36  Score=22.15  Aligned_cols=15  Identities=27%  Similarity=0.709  Sum_probs=11.1

Q ss_pred             EEEEEecccccccee
Q psy6045          69 VLRMECTECKYRKQL   83 (105)
Q Consensus        69 ~Lrl~C~eC~~~~~~   83 (105)
                      -.-..|+.||+.-+-
T Consensus        34 f~~v~C~~CGYTE~Y   48 (64)
T PF09855_consen   34 FTTVSCTNCGYTEFY   48 (64)
T ss_pred             EEEEECCCCCCEEEE
Confidence            445689999998654


No 32 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=40.55  E-value=11  Score=20.70  Aligned_cols=12  Identities=25%  Similarity=0.761  Sum_probs=6.4

Q ss_pred             eecCcCCCCccc
Q psy6045          11 RTFCKKCKIHKV   22 (105)
Q Consensus        11 ~tyCp~C~kHt~   22 (105)
                      ..||+.|+..|.
T Consensus         3 ~rfC~~CG~~t~   14 (32)
T PF09297_consen    3 HRFCGRCGAPTK   14 (32)
T ss_dssp             TSB-TTT--BEE
T ss_pred             CcccCcCCcccc
Confidence            468999987654


No 33 
>PHA02998 RNA polymerase subunit; Provisional
Probab=40.18  E-value=50  Score=26.18  Aligned_cols=21  Identities=33%  Similarity=0.588  Sum_probs=17.5

Q ss_pred             EEEEEeccccccceecceeee
Q psy6045          69 VLRMECTECKYRKQLPLKRCK   89 (105)
Q Consensus        69 ~Lrl~C~eC~~~~~~~~~R~K   89 (105)
                      ++-|+|.+||..+..|-+|..
T Consensus       169 T~FYkC~~CG~~wkppkf~~~  189 (195)
T PHA02998        169 LVRHACRDCKKHFKPPKFRDK  189 (195)
T ss_pred             eEEEEcCCCCCccCCcccccc
Confidence            578999999999888877754


No 34 
>PHA02768 hypothetical protein; Provisional
Probab=38.88  E-value=9.6  Score=24.38  Aligned_cols=15  Identities=27%  Similarity=0.363  Sum_probs=11.6

Q ss_pred             EEEEEecccccccee
Q psy6045          69 VLRMECTECKYRKQL   83 (105)
Q Consensus        69 ~Lrl~C~eC~~~~~~   83 (105)
                      .|-|+|.+||+....
T Consensus         3 ~~~y~C~~CGK~Fs~   17 (55)
T PHA02768          3 LLGYECPICGEIYIK   17 (55)
T ss_pred             ccccCcchhCCeecc
Confidence            467899999987653


No 35 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=35.13  E-value=22  Score=17.35  Aligned_cols=11  Identities=18%  Similarity=0.452  Sum_probs=8.9

Q ss_pred             EEeccccccce
Q psy6045          72 MECTECKYRKQ   82 (105)
Q Consensus        72 l~C~eC~~~~~   82 (105)
                      |+|.+|++...
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            68999998754


No 36 
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=33.45  E-value=44  Score=21.19  Aligned_cols=25  Identities=24%  Similarity=0.534  Sum_probs=17.4

Q ss_pred             eeeecCcCCCCccceEEEEeecCccc
Q psy6045           9 QRRTFCKKCKIHKVHKVTQYKKSKER   34 (105)
Q Consensus         9 ~~~tyCp~C~kHt~HkV~qyKkGK~s   34 (105)
                      -...+||.|+....-.|+ ++.|...
T Consensus         5 p~~~~CP~C~~~~~T~v~-~~~g~~t   29 (73)
T PF10601_consen    5 PVRIYCPYCQQQVQTRVE-YKSGTMT   29 (73)
T ss_pred             ceeeECCCCCCEEEEEEE-EEeChHH
Confidence            456899999988776664 4456544


No 37 
>PF15494 SRCR_2:  Scavenger receptor cysteine-rich domain
Probab=32.78  E-value=28  Score=23.20  Aligned_cols=13  Identities=31%  Similarity=0.933  Sum_probs=10.7

Q ss_pred             eEEEEEecccccc
Q psy6045          68 IVLRMECTECKYR   80 (105)
Q Consensus        68 i~Lrl~C~eC~~~   80 (105)
                      -++-|+|++||..
T Consensus        85 ~vVsL~C~~CG~r   97 (98)
T PF15494_consen   85 SVVSLQCSDCGKR   97 (98)
T ss_pred             CEEEEECcccCCc
Confidence            3788999999975


No 38 
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=32.44  E-value=37  Score=29.74  Aligned_cols=14  Identities=21%  Similarity=0.555  Sum_probs=11.9

Q ss_pred             EEEEEeccccccce
Q psy6045          69 VLRMECTECKYRKQ   82 (105)
Q Consensus        69 ~Lrl~C~eC~~~~~   82 (105)
                      ..+|.|..||..+.
T Consensus       227 ~a~y~C~~Cg~~i~  240 (557)
T PF05876_consen  227 TARYVCPHCGCEIE  240 (557)
T ss_pred             ceEEECCCCcCCCC
Confidence            67999999998765


No 39 
>COG4481 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.23  E-value=32  Score=22.52  Aligned_cols=17  Identities=18%  Similarity=0.630  Sum_probs=15.0

Q ss_pred             EEEEEeccccccceecc
Q psy6045          69 VLRMECTECKYRKQLPL   85 (105)
Q Consensus        69 ~Lrl~C~eC~~~~~~~~   85 (105)
                      +++..|+.|+...|.+-
T Consensus        32 DIkikC~nC~h~vm~pR   48 (60)
T COG4481          32 DIKIKCENCGHSVMMPR   48 (60)
T ss_pred             cEEEEecCCCcEEEecH
Confidence            89999999999988763


No 40 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=31.59  E-value=20  Score=22.29  Aligned_cols=18  Identities=22%  Similarity=0.455  Sum_probs=12.0

Q ss_pred             CceeeecCcCCCCccceE
Q psy6045           7 PKQRRTFCKKCKIHKVHK   24 (105)
Q Consensus         7 PK~~~tyCp~C~kHt~Hk   24 (105)
                      +...+.||+.|+.+--..
T Consensus        44 ~~~~r~FC~~CGs~l~~~   61 (92)
T PF04828_consen   44 KGVERYFCPTCGSPLFSE   61 (92)
T ss_dssp             SSCEEEEETTT--EEEEE
T ss_pred             CcCcCcccCCCCCeeecc
Confidence            445679999999987654


No 41 
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones]
Probab=31.29  E-value=22  Score=31.46  Aligned_cols=18  Identities=28%  Similarity=0.719  Sum_probs=13.2

Q ss_pred             ccccCce------eeecCcCCCCc
Q psy6045           3 HVNVPKQ------RRTFCKKCKIH   20 (105)
Q Consensus         3 mm~iPK~------~~tyCp~C~kH   20 (105)
                      -||||-+      -.+|||+|+-.
T Consensus       327 n~nvPGE~e~rnKGVayCPHCDGP  350 (520)
T COG3634         327 NMNVPGEDEYRNKGVAYCPHCDGP  350 (520)
T ss_pred             cCCCCchHHHhhCCeeeCCCCCCc
Confidence            3788854      35899999864


No 42 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=31.09  E-value=23  Score=20.63  Aligned_cols=12  Identities=33%  Similarity=1.013  Sum_probs=8.9

Q ss_pred             EEEeccccccce
Q psy6045          71 RMECTECKYRKQ   82 (105)
Q Consensus        71 rl~C~eC~~~~~   82 (105)
                      ++.|..||+..-
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            678888887643


No 43 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=30.83  E-value=40  Score=19.48  Aligned_cols=13  Identities=31%  Similarity=0.514  Sum_probs=10.9

Q ss_pred             EEEEEeccccccc
Q psy6045          69 VLRMECTECKYRK   81 (105)
Q Consensus        69 ~Lrl~C~eC~~~~   81 (105)
                      .|-|.|.+||..+
T Consensus        26 T~fy~C~~C~~~w   38 (39)
T PF01096_consen   26 TLFYVCCNCGHRW   38 (39)
T ss_dssp             EEEEEESSSTEEE
T ss_pred             eEEEEeCCCCCee
Confidence            7889999999764


No 44 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=30.16  E-value=25  Score=22.48  Aligned_cols=11  Identities=27%  Similarity=0.990  Sum_probs=8.4

Q ss_pred             eeeecCcCCCC
Q psy6045           9 QRRTFCKKCKI   19 (105)
Q Consensus         9 ~~~tyCp~C~k   19 (105)
                      ..|.+||+|+-
T Consensus        17 rk~~~CPrCG~   27 (51)
T COG1998          17 RKNRFCPRCGP   27 (51)
T ss_pred             EccccCCCCCC
Confidence            45789999973


No 45 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=28.89  E-value=27  Score=21.53  Aligned_cols=10  Identities=30%  Similarity=1.075  Sum_probs=7.5

Q ss_pred             eeecCcCCCC
Q psy6045          10 RRTFCKKCKI   19 (105)
Q Consensus        10 ~~tyCp~C~k   19 (105)
                      .+.|||.|+.
T Consensus        19 ~~~fCP~Cg~   28 (50)
T PRK00432         19 KNKFCPRCGS   28 (50)
T ss_pred             ccCcCcCCCc
Confidence            3569999974


No 46 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=28.48  E-value=33  Score=17.90  Aligned_cols=10  Identities=20%  Similarity=0.491  Sum_probs=8.5

Q ss_pred             EEeccccccc
Q psy6045          72 MECTECKYRK   81 (105)
Q Consensus        72 l~C~eC~~~~   81 (105)
                      |+|..|++..
T Consensus        15 ~~C~~C~k~F   24 (26)
T PF13465_consen   15 YKCPYCGKSF   24 (26)
T ss_dssp             EEESSSSEEE
T ss_pred             CCCCCCcCee
Confidence            8999999864


No 47 
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=28.12  E-value=29  Score=25.40  Aligned_cols=13  Identities=31%  Similarity=0.381  Sum_probs=10.7

Q ss_pred             eecCcCCCCccce
Q psy6045          11 RTFCKKCKIHKVH   23 (105)
Q Consensus        11 ~tyCp~C~kHt~H   23 (105)
                      -|-||.|+.|.+-
T Consensus        49 ~t~CP~Cg~~~e~   61 (115)
T COG1885          49 STSCPKCGEPFES   61 (115)
T ss_pred             cccCCCCCCccce
Confidence            4789999999864


No 48 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=27.48  E-value=26  Score=20.04  Aligned_cols=8  Identities=38%  Similarity=1.240  Sum_probs=4.1

Q ss_pred             Eecccccc
Q psy6045          73 ECTECKYR   80 (105)
Q Consensus        73 ~C~eC~~~   80 (105)
                      .|..|++.
T Consensus        22 ~C~~C~Y~   29 (35)
T PF02150_consen   22 ACRTCGYE   29 (35)
T ss_dssp             EESSSS-E
T ss_pred             CCCCCCCc
Confidence            56666654


No 49 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=25.16  E-value=46  Score=20.35  Aligned_cols=13  Identities=23%  Similarity=0.682  Sum_probs=10.3

Q ss_pred             EEEecccccccee
Q psy6045          71 RMECTECKYRKQL   83 (105)
Q Consensus        71 rl~C~eC~~~~~~   83 (105)
                      ||+|+.|++...-
T Consensus         1 ky~C~~CgyvYd~   13 (47)
T PF00301_consen    1 KYQCPVCGYVYDP   13 (47)
T ss_dssp             EEEETTTSBEEET
T ss_pred             CcCCCCCCEEEcC
Confidence            6899999987653


No 50 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=25.02  E-value=56  Score=19.01  Aligned_cols=13  Identities=31%  Similarity=0.542  Sum_probs=10.8

Q ss_pred             EEEEEeccccccc
Q psy6045          69 VLRMECTECKYRK   81 (105)
Q Consensus        69 ~Lrl~C~eC~~~~   81 (105)
                      .|-|.|..|+...
T Consensus        26 T~fy~C~~C~~~w   38 (40)
T smart00440       26 TVFYVCTKCGHRW   38 (40)
T ss_pred             eEEEEeCCCCCEe
Confidence            6889999999754


No 51 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=24.48  E-value=43  Score=16.92  Aligned_cols=11  Identities=36%  Similarity=0.767  Sum_probs=8.9

Q ss_pred             EEeccccccce
Q psy6045          72 MECTECKYRKQ   82 (105)
Q Consensus        72 l~C~eC~~~~~   82 (105)
                      |+|.+|+....
T Consensus         2 ~~C~~C~~~F~   12 (27)
T PF13912_consen    2 FECDECGKTFS   12 (27)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCccCCccC
Confidence            78999998754


No 52 
>PF14353 CpXC:  CpXC protein
Probab=24.20  E-value=59  Score=22.45  Aligned_cols=48  Identities=19%  Similarity=0.322  Sum_probs=28.9

Q ss_pred             cCcCCCCccceEEEEeecCccccccccceeeeeeccCCCCcccccccccccccceeEEEEEecccccccee
Q psy6045          13 FCKKCKIHKVHKVTQYKKSKERKACQGRRRYDRKQAGYGGQTKPIFRKKAKTTKKIVLRMECTECKYRKQL   83 (105)
Q Consensus        13 yCp~C~kHt~HkV~qyKkGK~s~~aqG~Rry~Rkq~GygGq~kpv~~k~aK~TKKi~Lrl~C~eC~~~~~~   83 (105)
                      -||.|+.+..-+|...=.....+                     ..  +.+.-.--.+.++|..||.....
T Consensus         3 tCP~C~~~~~~~v~~~I~~~~~p---------------------~l--~e~il~g~l~~~~CP~Cg~~~~~   50 (128)
T PF14353_consen    3 TCPHCGHEFEFEVWTSINADEDP---------------------EL--KEKILDGSLFSFTCPSCGHKFRL   50 (128)
T ss_pred             CCCCCCCeeEEEEEeEEcCcCCH---------------------HH--HHHHHcCCcCEEECCCCCCceec
Confidence            49999998888776654332221                     11  00111112678999999998764


No 53 
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=23.55  E-value=45  Score=19.00  Aligned_cols=10  Identities=20%  Similarity=0.534  Sum_probs=8.2

Q ss_pred             ecCcCCCCcc
Q psy6045          12 TFCKKCKIHK   21 (105)
Q Consensus        12 tyCp~C~kHt   21 (105)
                      ..||.|+..+
T Consensus         3 ~~Cp~Cg~~~   12 (47)
T PF14690_consen    3 PRCPHCGSPS   12 (47)
T ss_pred             ccCCCcCCCc
Confidence            5799999666


No 54 
>smart00355 ZnF_C2H2 zinc finger.
Probab=21.84  E-value=26  Score=16.49  Aligned_cols=11  Identities=27%  Similarity=0.603  Sum_probs=8.2

Q ss_pred             EEeccccccce
Q psy6045          72 MECTECKYRKQ   82 (105)
Q Consensus        72 l~C~eC~~~~~   82 (105)
                      ++|..|++...
T Consensus         1 ~~C~~C~~~f~   11 (26)
T smart00355        1 YRCPECGKVFK   11 (26)
T ss_pred             CCCCCCcchhC
Confidence            47899987754


No 55 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=21.64  E-value=38  Score=24.76  Aligned_cols=11  Identities=18%  Similarity=0.573  Sum_probs=8.6

Q ss_pred             eecCcCCCCcc
Q psy6045          11 RTFCKKCKIHK   21 (105)
Q Consensus        11 ~tyCp~C~kHt   21 (105)
                      .--||.|+++|
T Consensus        69 ~V~CP~C~K~T   79 (114)
T PF11023_consen   69 QVECPNCGKQT   79 (114)
T ss_pred             eeECCCCCChH
Confidence            34599999887


No 56 
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=21.60  E-value=51  Score=24.02  Aligned_cols=20  Identities=20%  Similarity=0.416  Sum_probs=13.9

Q ss_pred             eeecCcCCCCccceEEEEeecC
Q psy6045          10 RRTFCKKCKIHKVHKVTQYKKS   31 (105)
Q Consensus        10 ~~tyCp~C~kHt~HkV~qyKkG   31 (105)
                      +--|||.|++  .|.|+-.-.|
T Consensus        73 rEyyCP~Cgt--~levE~~~Pg   92 (112)
T PF08882_consen   73 REYYCPGCGT--QLEVEAPPPG   92 (112)
T ss_pred             EEEECCCCcc--eeEEccCCCC
Confidence            3469999984  6777755544


No 57 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=21.50  E-value=80  Score=17.53  Aligned_cols=23  Identities=22%  Similarity=0.489  Sum_probs=16.2

Q ss_pred             eccccccceecceeeeeeEeccc
Q psy6045          74 CTECKYRKQLPLKRCKHFELGGD   96 (105)
Q Consensus        74 C~eC~~~~~~~~~R~KkfElg~~   96 (105)
                      |..|+...+....+.-.|++++.
T Consensus         1 C~~C~~~~~~~~~~~~~~~~~~~   23 (46)
T TIGR03831         1 CPICGGEELEGKTTTETYEYGGE   23 (46)
T ss_pred             CCCCCCceecceEEEEEEEeCCE
Confidence            67787776666666778888654


No 58 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=21.25  E-value=51  Score=15.40  Aligned_cols=11  Identities=18%  Similarity=0.561  Sum_probs=6.8

Q ss_pred             EEeccccccce
Q psy6045          72 MECTECKYRKQ   82 (105)
Q Consensus        72 l~C~eC~~~~~   82 (105)
                      +.|..|+....
T Consensus         1 ~~C~~C~~~~~   11 (24)
T PF13894_consen    1 FQCPICGKSFR   11 (24)
T ss_dssp             EE-SSTS-EES
T ss_pred             CCCcCCCCcCC
Confidence            57999998754


No 59 
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=21.09  E-value=57  Score=23.65  Aligned_cols=19  Identities=16%  Similarity=0.312  Sum_probs=13.4

Q ss_pred             CceeeecCcCCCCccceEE
Q psy6045           7 PKQRRTFCKKCKIHKVHKV   25 (105)
Q Consensus         7 PK~~~tyCp~C~kHt~HkV   25 (105)
                      |-...-+||.|+.+..+-+
T Consensus        82 ~e~~~~~CP~C~s~~~~i~  100 (115)
T COG0375          82 LEELDYRCPKCGSINLRII  100 (115)
T ss_pred             chhheeECCCCCCCceEEe
Confidence            3445667999998886544


No 60 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=21.01  E-value=45  Score=19.94  Aligned_cols=9  Identities=22%  Similarity=1.054  Sum_probs=4.4

Q ss_pred             eeeecCcCC
Q psy6045           9 QRRTFCKKC   17 (105)
Q Consensus         9 ~~~tyCp~C   17 (105)
                      .-+.||+.|
T Consensus        32 ~g~~~Cv~C   40 (41)
T PF06677_consen   32 DGKIYCVSC   40 (41)
T ss_pred             CCCEECCCC
Confidence            334555555


No 61 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=20.96  E-value=48  Score=17.11  Aligned_cols=9  Identities=22%  Similarity=0.822  Sum_probs=6.9

Q ss_pred             ecCcCCCCc
Q psy6045          12 TFCKKCKIH   20 (105)
Q Consensus        12 tyCp~C~kH   20 (105)
                      -||.-|+++
T Consensus         2 ~~C~~C~k~   10 (27)
T PF12171_consen    2 FYCDACDKY   10 (27)
T ss_dssp             CBBTTTTBB
T ss_pred             CCcccCCCC
Confidence            488888875


No 62 
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=20.32  E-value=52  Score=20.57  Aligned_cols=17  Identities=18%  Similarity=0.542  Sum_probs=13.1

Q ss_pred             cccCceeeecCcCCCCc
Q psy6045           4 VNVPKQRRTFCKKCKIH   20 (105)
Q Consensus         4 m~iPK~~~tyCp~C~kH   20 (105)
                      |+--+...-|||.|+..
T Consensus        45 ~~~~kd~~H~Cp~C~~~   61 (67)
T smart00714       45 LDSFKDVNHYCPNCGAF   61 (67)
T ss_pred             cccccCccEECCCCCCE
Confidence            45557788999999874


No 63 
>PF03716 WCCH:  WCCH motif ;  InterPro: IPR005159 The WCCH motif is found in a retrotransposons and Gemini viruses. A specific function has not been associated to this motif [].
Probab=20.30  E-value=49  Score=17.89  Aligned_cols=10  Identities=40%  Similarity=0.929  Sum_probs=8.1

Q ss_pred             ecCcCCCCcc
Q psy6045          12 TFCKKCKIHK   21 (105)
Q Consensus        12 tyCp~C~kHt   21 (105)
                      =+||+|-.|.
T Consensus         6 C~cphCprHk   15 (25)
T PF03716_consen    6 CCCPHCPRHK   15 (25)
T ss_pred             cCCCCCcccc
Confidence            4789999994


No 64 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=20.02  E-value=49  Score=19.65  Aligned_cols=14  Identities=29%  Similarity=0.458  Sum_probs=9.8

Q ss_pred             EEEEEecc--ccccce
Q psy6045          69 VLRMECTE--CKYRKQ   82 (105)
Q Consensus        69 ~Lrl~C~e--C~~~~~   82 (105)
                      .|-++|+.  ||....
T Consensus        23 ~~Y~qC~N~~Cg~tfv   38 (47)
T PF04606_consen   23 ELYCQCTNPECGHTFV   38 (47)
T ss_pred             EEEEEECCCcCCCEEE
Confidence            37778877  887654


Done!