Psyllid ID: psy6046


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MITDPMASHVGGNRARSSCSRKPEKTTKREVVQWKERNVSQGVVIVDEEQLLKLIKVEPIEKYYSLDPEPLLGLNPRPPVYQASATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGKSLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNPMERMTAKEALKHPWLMNKKQIMTRVGCSSCPSIIQNQQNKKNLRKYLSKSREALFEKVISASKLQQENLRKSALLKYNKTRRLCESQMSLVSKTREKSLGDMAISLGRSKEKLYGFKCLSKSQEVLNLYKSMKDINNICIDEIIKNINDNKGTWPSHWVDLKRNFMVSNV
ccccccccccccccccccccEEcEEEcHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEEEEccccccccHHHcccccccHHHHHHccccccccccccccccEEccccccccccEEEEccccEEEEcccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccHHHHHHHHHHccccccccccHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccHHHHHHHHHHHccccc
ccEEEEEEEcccccEEEEHHHHHHHcccHHHHHHHHHHHHHHHHHcccccEEEEEccEccccHEEEEEEEcccccHHHHHHcccccHHHHHHHHHHHcccEccccccHHEEEcccccccccEEEEcccEEEEccccEEEEccccHHHcccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHccccHHHHHHHHccccccHHHcccHHHHHHcHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHccccccccEEEEHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccc
mitdpmashvggnrarsscsrkpekttkREVVQWKERNVSQGVVIVDEEQLLKLIkvepiekyysldpepllglnprppvyqasattkagsvlfpplMDFIFFflqpqnlvmmgdfpncdikvcdFEISRVILDGIEIrellgtpdyvgksLGVTAYVLLTgfspfggetdseTFRNISKAqldfpdelfedisPEAKDFIAKILIKNPMERMTAKealkhpwlmnkkqimtrvgcsscpsiiQNQQNKKNLRKYLSKSREALFEKVISASKLQQENLRKSALLKYNKTRRLCESQMSLVSKTREKSLGDMAISLGrskeklygfkclSKSQEVLNLYKSMKDINNICIDEIIKNindnkgtwpshwvdlkrnfmvsnv
mitdpmashvggnrarsscsrkpekttkrevvqwkernvsqgvvivdeeqllKLIKVEPIEKYYSLDPEPLLGLNPRPPVYQASATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGKSLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNPMERMTAKEALKHPWLMNKKQIMTRVGCSSCPSIIQNQQNKKNLRKYLSKSREALFEKVIsasklqqenLRKSAllkynktrrlcesqmslvsktrekslGDMAISLGRSKEKLYGFKCLSKSQEVLNLYKSMKDINNICIDEIIKNIndnkgtwpshwvdlkrnfmvsnv
MITDPMASHVGGNRARSSCSRKPEKTTKREVVQWKERNVSQGVVIVDEEQLLKLIKVEPIEKYYSLDPEPLLGLNPRPPVYQASATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGKSLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNPMERMTAKEALKHPWLMNKKQIMTRVGCSSCPSIIQNQQNKKNLRKYLSKSREALFEKVISASKLQQENLRKSALLKYNKTRRLCESQMSLVSKTREKSLGDMAISLGRSKEKLYGFKCLSKSQEVLNLYKSMkdinnicideiiknindnkGTWPSHWVDLKRNFMVSNV
******************************VVQWKERNVSQGVVIVDEEQLLKLIKVEPIEKYYSLDPEPLLGLNPRPPVYQASATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGKSLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNPMERMTAKEALKHPWLMNKKQIMTRVGCSSCPSIIQ******************LF**V****************LKY****************************L**SKEKLYGFKCLSKSQEVLNLYKSMKDINNICIDEIIKNINDNKGTWPSHWVDLKRNFM****
***DP**SHVGGNRARSSCSRKP******************GVVIVDEEQLLKLIKVEPIEKYYSLDPEPLLGLNPRPPVYQASATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGKSLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNPMERMTAKEALKHPWLMNKKQ*********************NLRKYLSKSREALFEKV**************************************************SKEKLYGFKCLSKSQEVLNLYKSMKDINNICIDEIIKNINDNKGTWPSHWVDLKRNFMVS**
******************************VVQWKERNVSQGVVIVDEEQLLKLIKVEPIEKYYSLDPEPLLGLNPRPPVYQASATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGKSLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNPMERMTAKEALKHPWLMNKKQIMTRVGCSSCPSIIQNQQNKKNLRKYLSKSREALFEKVISASKLQQENLRKSALLKYNKTRRLCESQMSLVSKTREKSLGDMAISLGRSKEKLYGFKCLSKSQEVLNLYKSMKDINNICIDEIIKNINDNKGTWPSHWVDLKRNFMVSNV
MITDPMASHVGGNRARSSCSRKPEKTTKREVVQWKERNVSQGVVIVDEEQLLKLIKVEPIEKYYSLDPEPLLGLNPRPPVYQASATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGKSLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNPMERMTAKEALKHPWLMNKKQIMTRVGCSSCPSIIQNQQNKKNLRKYLSKSREALFEKVISASKLQQENLRKSALLKYNKTRRLCESQMSLVSKTREKSLGDMAISLGRSKEKLYGFKCLSKSQEVLNLYKSMKDINNICIDEIIKNINDNKGTWPSHWVDLKRNFMVSN*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITDPMASHVGGNRARSSCSRKPEKTTKREVVQWKERNVSQGVVIVDEEQLLKLIKVEPIEKYYSLDPEPLLGLNPRPPVYQASATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGKSLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNPMERMTAKEALKHPWLMNKKQIMTRVGCSSCPSIIQNQQNKKNLRKYLSKSREALFEKVISASKLQQENLRKSALLKYNKTRRLCESQMSLVSKTREKSLGDMAISLGRSKEKLYGFKCLSKSQEVLNLYKSMKDINNICIDEIIKNINDNKGTWPSHWVDLKRNFMVSNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query379 2.2.26 [Sep-21-2011]
Q0KHT7 784 Probable serine/threonine no N/A 0.316 0.153 0.481 1e-29
Q9GM70397 Serine/threonine-protein yes N/A 0.353 0.337 0.422 2e-28
Q9UEE5414 Serine/threonine-protein yes N/A 0.353 0.323 0.416 9e-27
Q9UIK4370 Death-associated protein no N/A 0.485 0.497 0.341 2e-25
Q8VDF3370 Death-associated protein yes N/A 0.485 0.497 0.336 3e-25
Q91XS8371 Serine/threonine-protein yes N/A 0.332 0.339 0.390 2e-24
Q8BG48372 Serine/threonine-protein no N/A 0.332 0.338 0.390 2e-24
O94768372 Serine/threonine-protein no N/A 0.332 0.338 0.390 8e-24
O43293454 Death-associated protein no N/A 0.522 0.436 0.320 1e-23
Q80YE7 1442 Death-associated protein no N/A 0.358 0.094 0.357 4e-22
>sp|Q0KHT7|Y2666_DROME Probable serine/threonine-protein kinase CG32666 OS=Drosophila melanogaster GN=CG32666 PE=1 SV=1 Back     alignment and function desciption
 Score =  130 bits (328), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 83/135 (61%), Gaps = 15/135 (11%)

Query: 105 LQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGK-------------- 150
           L+PQN+++ G+     +K+CDF ISRV+ +GI +RE+ GTPDYV                
Sbjct: 161 LKPQNILLAGERIEDGLKLCDFGISRVVCEGINVREMAGTPDYVAPEVLQYEPLSLLTDI 220

Query: 151 -SLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNP 209
            S+GV  YVLL+GFSPFGG+T  ETF NIS+  L FPD LF  +SP A DFI + L   P
Sbjct: 221 WSVGVLTYVLLSGFSPFGGDTKQETFLNISQCALTFPDNLFGGVSPVAIDFIRRALRIKP 280

Query: 210 MERMTAKEALKHPWL 224
            +RM A   L H WL
Sbjct: 281 NDRMNATGCLDHIWL 295





Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9GM70|ST17A_RABIT Serine/threonine-protein kinase 17A OS=Oryctolagus cuniculus GN=STK17A PE=2 SV=1 Back     alignment and function description
>sp|Q9UEE5|ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens GN=STK17A PE=1 SV=2 Back     alignment and function description
>sp|Q9UIK4|DAPK2_HUMAN Death-associated protein kinase 2 OS=Homo sapiens GN=DAPK2 PE=1 SV=1 Back     alignment and function description
>sp|Q8VDF3|DAPK2_MOUSE Death-associated protein kinase 2 OS=Mus musculus GN=Dapk2 PE=1 SV=1 Back     alignment and function description
>sp|Q91XS8|ST17B_RAT Serine/threonine-protein kinase 17B OS=Rattus norvegicus GN=Stk17b PE=1 SV=1 Back     alignment and function description
>sp|Q8BG48|ST17B_MOUSE Serine/threonine-protein kinase 17B OS=Mus musculus GN=Stk17b PE=2 SV=1 Back     alignment and function description
>sp|O94768|ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens GN=STK17B PE=1 SV=1 Back     alignment and function description
>sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 Back     alignment and function description
>sp|Q80YE7|DAPK1_MOUSE Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
328713083 654 PREDICTED: hypothetical protein LOC10016 0.625 0.362 0.466 1e-67
242005343 890 death associated protein kinase, putativ 0.633 0.269 0.468 1e-62
307190550 994 Serine/threonine-protein kinase 17A [Cam 0.451 0.172 0.540 2e-55
332025701 1224 Serine/threonine-protein kinase 17B [Acr 0.511 0.158 0.485 5e-54
156549437 1001 PREDICTED: hypothetical protein LOC10011 0.456 0.172 0.518 2e-53
350426312 1191 PREDICTED: hypothetical protein LOC10074 0.493 0.157 0.482 9e-53
340723642 1191 PREDICTED: hypothetical protein LOC10064 0.493 0.157 0.482 1e-52
383857725 1201 PREDICTED: uncharacterized protein LOC10 0.493 0.155 0.478 2e-52
380022614 1192 PREDICTED: uncharacterized protein LOC10 0.511 0.162 0.480 3e-52
328776543 1189 PREDICTED: hypothetical protein LOC72679 0.506 0.161 0.484 7e-52
>gi|328713083|ref|XP_001942546.2| PREDICTED: hypothetical protein LOC100163198, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  263 bits (671), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 139/298 (46%), Positives = 189/298 (63%), Gaps = 61/298 (20%)

Query: 105 LQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGK-------------- 150
           ++PQNLV+MG FP CD+K+CDFEISRVIL+G EIRE+LGTPDYV                
Sbjct: 119 IKPQNLVLMGVFPTCDVKLCDFEISRVILEGTEIREILGTPDYVAPEILHYEPITLAADM 178

Query: 151 -SLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNP 209
            SLGVT Y LLTGFSPFGG+TD ETF NIS A +DFPDELFED+S EA DFI K+L+K+P
Sbjct: 179 WSLGVTTYALLTGFSPFGGDTDQETFCNISNADIDFPDELFEDVSEEAVDFIRKLLVKDP 238

Query: 210 MERMTAKEALKHPWLMNKKQ----------------------------------IMTRVG 235
            ER+TAKE LKHPWL N ++                                  ++ R G
Sbjct: 239 KERLTAKECLKHPWLANLRKSSSGSSHSVQHHQHLQQNYHQHQQPHQQQHQQPSVVKRTG 298

Query: 236 CSSC----PSIIQNQQNKKNLRKYLSKSREALFEKVISASKLQQENLRKSALLKYNK--T 289
           C++C    PSI   +        YLSKSREALFE+++S   +++ ++++S++L  ++  +
Sbjct: 299 CNTCAGITPSISARRSGGGLQPSYLSKSREALFERIVS-KHMRESDMKRSSMLHESQYAS 357

Query: 290 RRLCESQMSLVSKTREKSLGDMAISLGRSKEKLYGFKCLSKSQEVLNLYKSMKDINNI 347
            R+CES  SLVS++R  +      +  +SKEKLYG K LS+SQ+VL++ KS+KD++ +
Sbjct: 358 SRMCESHTSLVSRSRNGTR-----TFSKSKEKLYGLKSLSRSQDVLDMCKSIKDLSEV 410




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242005343|ref|XP_002423529.1| death associated protein kinase, putative [Pediculus humanus corporis] gi|212506643|gb|EEB10791.1| death associated protein kinase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307190550|gb|EFN74537.1| Serine/threonine-protein kinase 17A [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332025701|gb|EGI65859.1| Serine/threonine-protein kinase 17B [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156549437|ref|XP_001603222.1| PREDICTED: hypothetical protein LOC100119444 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350426312|ref|XP_003494400.1| PREDICTED: hypothetical protein LOC100745800 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340723642|ref|XP_003400198.1| PREDICTED: hypothetical protein LOC100645687 [Bombus terrestris] Back     alignment and taxonomy information
>gi|383857725|ref|XP_003704354.1| PREDICTED: uncharacterized protein LOC100879681 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380022614|ref|XP_003695135.1| PREDICTED: uncharacterized protein LOC100870315 [Apis florea] Back     alignment and taxonomy information
>gi|328776543|ref|XP_001122511.2| PREDICTED: hypothetical protein LOC726790 [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
UNIPROTKB|Q9GM70397 STK17A "Serine/threonine-prote 0.332 0.317 0.432 1.4e-29
UNIPROTKB|F1PCL9367 STK17A "Uncharacterized protei 0.332 0.343 0.425 1.2e-28
UNIPROTKB|Q9UEE5414 STK17A "Serine/threonine-prote 0.332 0.304 0.425 6.6e-28
UNIPROTKB|F1NAF6406 STK17A "Uncharacterized protei 0.511 0.477 0.321 1.4e-27
UNIPROTKB|F1MHX3478 DAPK2 "Uncharacterized protein 0.414 0.328 0.367 2.4e-27
UNIPROTKB|G5E5A0281 STK17A "Uncharacterized protei 0.350 0.473 0.425 6.6e-26
FB|FBgn0052666 784 Drak "Death-associated protein 0.316 0.153 0.481 1.4e-25
UNIPROTKB|J9P4D3290 STK17A "Uncharacterized protei 0.332 0.434 0.425 1.4e-25
MGI|MGI:2138162372 Stk17b "serine/threonine kinas 0.316 0.322 0.407 2.1e-25
UNIPROTKB|F1LS59340 Dapk2 "Protein Dapk2" [Rattus 0.517 0.576 0.334 2.9e-25
UNIPROTKB|Q9GM70 STK17A "Serine/threonine-protein kinase 17A" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
 Score = 301 (111.0 bits), Expect = 1.4e-29, Sum P(2) = 1.4e-29
 Identities = 61/141 (43%), Positives = 88/141 (62%)

Query:    99 DFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGK-------- 150
             D +   L+PQN+++  + P  DIK+ DF +SR++ +  E+RE++GTP+YV          
Sbjct:   164 DVVHLDLKPQNILLTSESPLGDIKIVDFGLSRIVKNSEELREIMGTPEYVAPEILSYDPI 223

Query:   151 -------SLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAK 203
                    S+GV  YV+LTG SPF G+   ETF NIS+  L + +E F+ +S  A DFI K
Sbjct:   224 SMATDMWSIGVLTYVMLTGISPFLGDNKQETFLNISQMNLSYSEEEFDTVSESAVDFIKK 283

Query:   204 ILIKNPMERMTAKEALKHPWL 224
             +L+K P +R TA+E LKHPWL
Sbjct:   284 LLVKKPEDRATAEECLKHPWL 304


GO:0005524 "ATP binding" evidence=ISS
GO:0006917 "induction of apoptosis" evidence=IMP
GO:0007243 "intracellular protein kinase cascade" evidence=ISS;IDA
GO:0043065 "positive regulation of apoptotic process" evidence=ISS
GO:2000377 "regulation of reactive oxygen species metabolic process" evidence=ISS
UNIPROTKB|F1PCL9 STK17A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UEE5 STK17A "Serine/threonine-protein kinase 17A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAF6 STK17A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MHX3 DAPK2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G5E5A0 STK17A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0052666 Drak "Death-associated protein kinase related" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|J9P4D3 STK17A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2138162 Stk17b "serine/threonine kinase 17b (apoptosis-inducing)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LS59 Dapk2 "Protein Dapk2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!
3rd Layer2.7.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 2e-27
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-21
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-18
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 4e-18
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 4e-18
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 5e-14
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 6e-14
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 1e-13
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 2e-12
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 4e-11
cd05574316 cd05574, STKc_phototropin_like, Catalytic domain o 1e-10
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 1e-10
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 1e-10
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-10
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 3e-10
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 6e-10
cd07829282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 7e-10
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 1e-09
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 2e-09
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-09
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-09
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 7e-09
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 9e-09
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 1e-08
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 2e-08
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 2e-08
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 3e-08
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 5e-08
cd05613290 cd05613, STKc_MSK1_N, N-terminal catalytic domain 9e-08
cd05610669 cd05610, STKc_MASTL, Catalytic domain of the Prote 1e-07
cd05616323 cd05616, STKc_cPKC_beta, Catalytic domain of the P 1e-07
cd06622286 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of 1e-07
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 1e-07
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 1e-07
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 2e-07
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 4e-07
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 4e-07
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 4e-07
cd06605265 cd06605, PKc_MAPKK, Catalytic domain of the dual-s 4e-07
cd07852337 cd07852, STKc_MAPK15, Catalytic domain of the Seri 5e-07
cd07832286 cd07832, STKc_CCRK, Catalytic domain of the Serine 5e-07
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 9e-07
cd06626264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 9e-07
cd06618296 cd06618, PKc_MKK7, Catalytic domain of the dual-sp 9e-07
cd05629377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 9e-07
cd05118283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 1e-06
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 2e-06
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 2e-06
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-06
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 3e-06
cd07854342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 4e-06
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 4e-06
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 4e-06
cd06612256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 5e-06
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 6e-06
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 7e-06
cd07855334 cd07855, STKc_ERK5, Catalytic domain of the Serine 9e-06
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 9e-06
cd06615308 cd06615, PKc_MEK, Catalytic domain of the dual-spe 1e-05
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 1e-05
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 1e-05
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 1e-05
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 1e-05
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 3e-05
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 3e-05
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 4e-05
cd07837295 cd07837, STKc_CdkB_plant, Catalytic domain of the 5e-05
cd07858337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 5e-05
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 5e-05
cd07849336 cd07849, STKc_ERK1_2_like, Catalytic domain of Ext 7e-05
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 7e-05
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 7e-05
cd05623332 cd05623, STKc_MRCK_alpha, Catalytic domain of the 8e-05
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 1e-04
cd07856328 cd07856, STKc_Sty1_Hog1, Catalytic domain of the S 1e-04
cd07830283 cd07830, STKc_MAK_like, Catalytic domain of Male g 1e-04
cd07838287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 1e-04
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 2e-04
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 2e-04
cd07866311 cd07866, STKc_BUR1, Catalytic domain of the Serine 2e-04
cd05622371 cd05622, STKc_ROCK1, Catalytic domain of the Prote 2e-04
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 2e-04
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-04
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 3e-04
cd07851343 cd07851, STKc_p38, Catalytic domain of the Serine/ 3e-04
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 4e-04
cd07850353 cd07850, STKc_JNK, Catalytic domain of the Serine/ 4e-04
cd05630285 cd05630, STKc_GRK6, Catalytic domain of the Protei 4e-04
cd07841298 cd07841, STKc_CDK7, Catalytic domain of the Serine 4e-04
cd05605285 cd05605, STKc_GRK4_like, Catalytic domain of G pro 4e-04
cd06613262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 5e-04
PTZ00283496 PTZ00283, PTZ00283, serine/threonine protein kinas 5e-04
cd05632285 cd05632, STKc_GRK5, Catalytic domain of the Protei 5e-04
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 6e-04
cd07861285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 6e-04
cd07864302 cd07864, STKc_CDK12, Catalytic domain of the Serin 6e-04
cd07836284 cd07836, STKc_Pho85, Catalytic domain of the Serin 7e-04
cd06611280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 0.001
cd06621287 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of 0.001
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 0.001
cd07877345 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of 0.002
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 0.002
cd06640277 cd06640, STKc_MST4, Catalytic domain of the Protei 0.002
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 0.003
cd06620284 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of 0.003
cd06630268 cd06630, STKc_MEKK1, Catalytic domain of the Prote 0.003
cd06642277 cd06642, STKc_STK25-YSK1, Catalytic domain of the 0.004
cd07831282 cd07831, STKc_MOK, Catalytic domain of the Serine/ 0.004
cd07857332 cd07857, STKc_MPK1, Catalytic domain of the Serine 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score =  108 bits (273), Expect = 2e-27
 Identities = 54/136 (39%), Positives = 80/136 (58%), Gaps = 20/136 (14%)

Query: 105 LQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYV------GK-------- 150
           L+P+N+++  D     +K+ DF ++R +  G ++   +GTP+Y+      GK        
Sbjct: 123 LKPENILLDED---GHVKLADFGLARQLDPGEKLTTFVGTPEYMAPEVLLGKGYGKAVDI 179

Query: 151 -SLGVTAYVLLTGFSPF-GGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKN 208
            SLGV  Y LLTG  PF G +   E F+ I K +  FP     DISPEAKD I K+L+K+
Sbjct: 180 WSLGVILYELLTGKPPFPGDDQLLELFKKIGKPKPPFPPP-EWDISPEAKDLIRKLLVKD 238

Query: 209 PMERMTAKEALKHPWL 224
           P +R+TA+EAL+HP+ 
Sbjct: 239 PEKRLTAEEALQHPFF 254


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 379
KOG0615|consensus475 100.0
KOG0575|consensus 592 100.0
KOG0033|consensus355 100.0
KOG0598|consensus357 100.0
KOG0581|consensus364 100.0
KOG0593|consensus396 100.0
KOG0592|consensus 604 100.0
KOG0588|consensus 786 100.0
KOG0605|consensus550 100.0
KOG0599|consensus411 100.0
KOG0616|consensus355 100.0
KOG0660|consensus359 100.0
KOG0595|consensus429 100.0
KOG0032|consensus382 100.0
KOG0583|consensus370 100.0
KOG0597|consensus 808 100.0
KOG0585|consensus576 100.0
KOG0659|consensus318 100.0
KOG0604|consensus400 100.0
KOG0694|consensus694 100.0
KOG0600|consensus560 100.0
KOG0663|consensus419 100.0
KOG0661|consensus538 100.0
KOG0591|consensus375 100.0
KOG0658|consensus364 100.0
KOG0198|consensus313 100.0
KOG0580|consensus281 100.0
KOG4717|consensus 864 100.0
KOG0611|consensus 668 100.0
KOG0578|consensus550 100.0
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 100.0
KOG0607|consensus463 100.0
PTZ00036440 glycogen synthase kinase; Provisional 100.0
PTZ00263329 protein kinase A catalytic subunit; Provisional 100.0
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 100.0
KOG0690|consensus516 100.0
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 100.0
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 100.0
KOG0582|consensus516 100.0
KOG0594|consensus323 100.0
KOG0610|consensus459 100.0
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 100.0
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 100.0
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 100.0
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 100.0
KOG0586|consensus 596 100.0
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 100.0
KOG0201|consensus467 100.0
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 100.0
KOG4236|consensus888 100.0
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 100.0
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 100.0
KOG0192|consensus362 100.0
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 100.0
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 100.0
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 100.0
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 100.0
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 100.0
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 100.0
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 100.0
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 100.0
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 100.0
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 100.0
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 100.0
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 100.0
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 100.0
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 100.0
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 100.0
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 100.0
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 100.0
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 100.0
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 100.0
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 100.0
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 100.0
PLN00034353 mitogen-activated protein kinase kinase; Provision 100.0
KOG0667|consensus586 100.0
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 100.0
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 100.0
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 100.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 100.0
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 100.0
PHA03212391 serine/threonine kinase US3; Provisional 100.0
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 100.0
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 100.0
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 100.0
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 100.0
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 100.0
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 100.0
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 100.0
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 100.0
KOG0612|consensus 1317 100.0
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 100.0
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 100.0
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 100.0
KOG0577|consensus 948 100.0
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 100.0
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 100.0
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 100.0
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 100.0
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 100.0
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 100.0
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 100.0
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 100.0
KOG0589|consensus426 100.0
cd07867317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 100.0
PTZ00267478 NIMA-related protein kinase; Provisional 100.0
KOG0986|consensus591 100.0
PTZ00283496 serine/threonine protein kinase; Provisional 100.0
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 100.0
KOG0983|consensus391 100.0
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 100.0
PTZ00284467 protein kinase; Provisional 100.0
KOG0579|consensus 1187 100.0
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 100.0
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 100.0
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 100.0
KOG0574|consensus502 100.0
KOG0584|consensus 632 100.0
PHA03209357 serine/threonine kinase US3; Provisional 100.0
cd07861285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 100.0
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 100.0
cd06650333 PKc_MEK1 Catalytic domain of the dual-specificity 100.0
KOG0662|consensus292 100.0
KOG0669|consensus376 100.0
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 100.0
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 100.0
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 100.0
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 100.0
PF00069260 Pkinase: Protein kinase domain Protein kinase; unc 100.0
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 100.0
PHA03211461 serine/threonine kinase US3; Provisional 100.0
cd07839284 STKc_CDK5 Catalytic domain of the Serine/Threonine 100.0
PTZ00266 1021 NIMA-related protein kinase; Provisional 100.0
cd07849336 STKc_ERK1_2_like Catalytic domain of Extracellular 100.0
cd06619279 PKc_MKK5 Catalytic domain of the dual-specificity 100.0
cd07852337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 100.0
cd08529256 STKc_FA2-like Catalytic domain of the Protein Seri 100.0
cd07850353 STKc_JNK Catalytic domain of the Serine/Threonine 100.0
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 100.0
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 100.0
KOG4721|consensus 904 100.0
KOG0614|consensus732 100.0
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 100.0
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 100.0
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 100.0
cd07847286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 100.0
KOG4279|consensus 1226 100.0
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 100.0
cd07858337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 100.0
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 100.0
KOG0696|consensus683 100.0
PHA03207392 serine/threonine kinase US3; Provisional 100.0
PTZ00024335 cyclin-dependent protein kinase; Provisional 100.0
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 100.0
cd06645267 STKc_MAP4K3 Catalytic domain of the Protein Serine 100.0
cd06615308 PKc_MEK Catalytic domain of the dual-specificity P 100.0
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 100.0
PLN00009294 cyclin-dependent kinase A; Provisional 100.0
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 100.0
cd08220256 STKc_Nek8 Catalytic domain of the Protein Serine/T 100.0
cd07832286 STKc_CCRK Catalytic domain of the Serine/Threonine 100.0
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 100.0
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 100.0
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 100.0
KOG4645|consensus1509 100.0
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 100.0
cd07865310 STKc_CDK9 Catalytic domain of the Serine/Threonine 100.0
PHA02988283 hypothetical protein; Provisional 100.0
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 100.0
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 100.0
cd08217265 STKc_Nek2 Catalytic domain of the Protein Serine/T 100.0
cd07841298 STKc_CDK7 Catalytic domain of the Serine/Threonine 100.0
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 100.0
cd07837295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 100.0
cd07855334 STKc_ERK5 Catalytic domain of the Serine/Threonine 100.0
cd06617283 PKc_MKK3_6 Catalytic domain of the dual-specificit 100.0
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 100.0
cd07843293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 100.0
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 100.0
cd06632258 STKc_MEKK1_plant Catalytic domain of the Protein S 100.0
cd05579265 STKc_MAST_like Catalytic domain of Microtubule-ass 100.0
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 100.0
cd06629272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 100.0
KOG0197|consensus468 100.0
cd08221256 STKc_Nek9 Catalytic domain of the Protein Serine/T 100.0
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 100.0
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 100.0
cd06646267 STKc_MAP4K5 Catalytic domain of the Protein Serine 100.0
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 100.0
cd07844291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 100.0
cd07879342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 100.0
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 100.0
KOG1006|consensus361 100.0
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 100.0
cd07880343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 100.0
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 100.0
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 100.0
cd05578258 STKc_Yank1 Catalytic domain of the Protein Serine/ 100.0
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 100.0
cd05102338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 100.0
cd08225257 STKc_Nek5 Catalytic domain of the Protein Serine/T 100.0
cd06630268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 100.0
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 100.0
cd07870291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 100.0
cd07846286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 100.0
cd06652265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 100.0
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 100.0
cd07835283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 100.0
cd06640277 STKc_MST4 Catalytic domain of the Protein Serine/T 100.0
cd06642277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 100.0
cd07834330 STKc_MAPK Catalytic domain of the Serine/Threonine 100.0
PHA03210501 serine/threonine kinase US3; Provisional 100.0
cd07851343 STKc_p38 Catalytic domain of the Serine/Threonine 100.0
cd07877345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 99.98
cd06607307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.98
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.98
KOG4250|consensus 732 99.98
cd07836284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.98
KOG0596|consensus677 99.98
cd06641277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.98
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.98
cd06613262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.98
KOG0603|consensus612 99.98
cd07842316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.98
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.98
cd06657292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.98
cd07857332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.98
cd06917277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.98
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.98
cd06633313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.98
KOG0666|consensus438 99.98
KOG0608|consensus1034 99.98
cd06621287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.98
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.98
cd07866311 STKc_BUR1 Catalytic domain of the Serine/Threonine 99.98
cd08219255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.97
cd06620284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.97
cd07833288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.97
cd05075272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.97
KOG1035|consensus 1351 99.97
cd06605265 PKc_MAPKK Catalytic domain of the dual-specificity 99.97
cd05123250 STKc_AGC Catalytic domain of AGC family Protein Se 99.97
cd06626264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.97
cd05084252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.97
cd07864302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.97
cd08226328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.97
cd05118283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.97
cd05116257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.97
cd05052263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.97
cd06647293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.97
cd07856328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.97
cd05108316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.97
cd05061288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.97
cd08215258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.97
cd05064266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.97
cd05048283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.97
cd07840287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.97
cd06623264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.97
cd07838287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.97
cd05106374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.97
cd05122253 PKc_STE Catalytic domain of STE family Protein Kin 99.97
cd06635317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.97
KOG0193|consensus678 99.97
cd07830283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.97
cd08228267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.97
cd05035273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.97
cd05581280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.97
cd05114256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.97
cd06653264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.97
cd05104375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.97
cd06634308 STKc_TAO2 Catalytic domain of the Protein Serine/T 99.97
cd05049280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.97
cd06627254 STKc_Cdc7_like Catalytic domain of Cell division c 99.97
cd05096304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.97
cd05047270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.97
cd05613290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.97
cd05093288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.97
cd05090283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.97
cd07829282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.97
cd05036277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.97
cd05091283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.97
KOG1989|consensus 738 99.97
cd05088303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.97
cd05062277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.97
cd06606260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.97
cd08229267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.97
cd05115257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.97
cd06618296 PKc_MKK7 Catalytic domain of the dual-specificity 99.97
cd05072261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.97
cd05089297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.97
cd08530256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.97
cd05109279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.97
cd05069260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.97
cd00192262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.97
cd06614286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.97
cd05071262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.97
cd08222260 STKc_Nek11 Catalytic domain of the Protein Serine/ 99.97
cd05060257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.97
cd05111279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.97
cd05082256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.97
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.97
cd05033266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.97
cd08216314 PK_STRAD Pseudokinase domain of STE20-related kina 99.97
cd05085250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.97
cd05083254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.97
cd05070260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.97
cd05058262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.97
cd05059256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.97
cd05148261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.97
cd05113256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.97
cd05032277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.97
KOG1187|consensus361 99.97
cd05067260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.97
KOG0668|consensus338 99.97
PLN03225566 Serine/threonine-protein kinase SNT7; Provisional 99.97
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.97
cd05092280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.97
cd05054337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.97
smart00219258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.97
cd05045290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.97
cd08224267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.97
cd05039256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.97
cd05094291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.97
KOG0194|consensus474 99.97
cd05041251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.97
cd05107401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.97
cd05068261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.97
cd05056270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.97
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.97
cd05040257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.97
KOG2345|consensus302 99.97
cd05042269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.97
cd05110303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.97
cd05063268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.97
cd05105400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.97
cd05055302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.97
cd05051296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.97
KOG0665|consensus369 99.97
PF07714259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.97
cd05057279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.97
cd05066267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.97
cd05044269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.97
cd05087269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.97
cd05053293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.97
cd05078258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.96
KOG0671|consensus415 99.96
cd05065269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.96
cd05101304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.96
cd05043280 PTK_Ryk Pseudokinase domain of Ryk (Receptor relat 99.96
PHA02882294 putative serine/threonine kinase; Provisional 99.96
KOG1026|consensus774 99.96
cd05034261 PTKc_Src_like Catalytic domain of Src kinase-like 99.96
KOG0587|consensus 953 99.96
cd05103343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.96
cd05076274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05046275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.96
cd05086268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.96
cd05077262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.96
cd05099314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.96
cd05097295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.96
cd05073260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.96
cd05112256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.96
cd05050288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.96
cd05080283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.96
cd05098307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.96
cd05037259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.96
cd05100334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.96
cd05576237 STKc_RPK118_like Catalytic domain of the Protein S 99.96
cd08528269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.96
cd05074273 PTKc_Tyro3 Catalytic domain of the Protein Tyrosin 99.96
cd05081284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.96
cd05095296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.96
KOG1027|consensus903 99.96
cd05079284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.96
KOG4257|consensus 974 99.96
KOG0664|consensus449 99.96
KOG1095|consensus1025 99.96
cd05038284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.95
KOG1151|consensus775 99.95
smart00220244 S_TKc Serine/Threonine protein kinases, catalytic 99.95
PLN03224507 probable serine/threonine protein kinase; Provisio 99.95
KOG0670|consensus752 99.95
KOG0695|consensus593 99.95
KOG0196|consensus996 99.95
KOG0199|consensus 1039 99.95
KOG0576|consensus 829 99.94
KOG4278|consensus 1157 99.94
PLN00113968 leucine-rich repeat receptor-like protein kinase; 99.93
KOG3653|consensus534 99.93
KOG2052|consensus513 99.93
KOG0984|consensus282 99.92
KOG1094|consensus807 99.92
KOG1167|consensus418 99.91
KOG1025|consensus1177 99.9
KOG1290|consensus 590 99.89
KOG0200|consensus609 99.89
cd00180215 PKc Catalytic domain of Protein Kinases. Protein K 99.88
KOG1152|consensus772 99.88
KOG1345|consensus378 99.86
PRK09188365 serine/threonine protein kinase; Provisional 99.86
PLN00181 793 protein SPA1-RELATED; Provisional 99.86
KOG1165|consensus449 99.85
smart00221225 STYKc Protein kinase; unclassified specificity. Ph 99.84
KOG1163|consensus341 99.84
KOG0590|consensus601 99.83
KOG0603|consensus 612 99.81
KOG0606|consensus 1205 99.81
KOG1164|consensus322 99.8
KOG1024|consensus563 99.79
PRK12274218 serine/threonine protein kinase; Provisional 99.78
KOG1023|consensus 484 99.77
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.73
COG0515384 SPS1 Serine/threonine protein kinase [General func 99.72
PRK10345210 hypothetical protein; Provisional 99.72
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.72
cd05145190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 99.71
PF14531288 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ 99.69
KOG1240|consensus 1431 99.64
smart00090237 RIO RIO-like kinase. 99.57
PRK14879211 serine/threonine protein kinase; Provisional 99.55
cd05144198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 99.53
PRK10359232 lipopolysaccharide core biosynthesis protein; Prov 99.53
PRK09605535 bifunctional UGMP family protein/serine/threonine 99.52
KOG0590|consensus 601 99.52
TIGR03724199 arch_bud32 Kae1-associated kinase Bud32. Members o 99.51
KOG4158|consensus598 99.48
KOG1166|consensus974 99.44
cd05119187 RIO RIO kinase family, catalytic domain. The RIO k 99.42
KOG0195|consensus448 99.32
PRK01723239 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed 99.32
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 99.3
TIGR01982437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 99.26
KOG1033|consensus516 99.16
PRK04750537 ubiB putative ubiquinone biosynthesis protein UbiB 99.12
KOG0601|consensus524 99.11
KOG0606|consensus1205 99.06
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 99.01
COG3642204 Mn2+-dependent serine/threonine protein kinase [Si 98.88
KOG3087|consensus229 98.77
cd05146197 RIO3_euk RIO kinase family; eukaryotic RIO3, catal 98.76
KOG1243|consensus 690 98.65
KOG3741|consensus655 98.45
KOG0601|consensus524 98.39
KOG1266|consensus458 98.24
cd05154223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 98.23
KOG2137|consensus 700 98.19
COG2112201 Predicted Ser/Thr protein kinase [Signal transduct 98.11
PF01163188 RIO1: RIO1 family; InterPro: IPR018934 Protein pho 98.06
COG0478304 RIO-like serine/threonine protein kinase fused to 97.97
COG0661517 AarF Predicted unusual protein kinase [General fun 97.82
PRK15123268 lipopolysaccharide core heptose(I) kinase RfaP; Pr 97.71
COG4248 637 Uncharacterized protein with protein kinase and he 97.65
KOG0576|consensus 829 97.6
PRK09550401 mtnK methylthioribose kinase; Reviewed 97.6
KOG1235|consensus538 97.57
PF10707199 YrbL-PhoP_reg: PhoP regulatory network protein Yrb 97.49
PF06293206 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; 97.37
TIGR02172226 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou 97.32
PF06176229 WaaY: Lipopolysaccharide core biosynthesis protein 97.31
TIGR01767370 MTRK 5-methylthioribose kinase. This enzyme is inv 97.06
PRK09902216 hypothetical protein; Provisional 97.05
PRK12396409 5-methylribose kinase; Reviewed 96.86
cd05150244 APH Aminoglycoside 3'-phosphotransferase (APH). Th 96.86
PF01636239 APH: Phosphotransferase enzyme family This family 96.78
TIGR02721256 ycfN_thiK thiamine kinase. Members of this family 96.76
COG1718268 RIO1 Serine/threonine protein kinase involved in c 96.75
PLN02876 822 acyl-CoA dehydrogenase 96.72
PRK05231319 homoserine kinase; Provisional 96.42
cd05153296 HomoserineK_II Homoserine Kinase, type II. Homoser 96.32
cd05155235 APH_ChoK_like_1 Uncharacterized bacterial proteins 96.29
TIGR00938307 thrB_alt homoserine kinase, Neisseria type. Homose 96.15
PF13095207 FTA2: Kinetochore Sim4 complex subunit FTA2 96.07
cd05157235 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. 96.03
PLN02756418 S-methyl-5-thioribose kinase 95.43
KOG1035|consensus 1351 95.34
cd05152276 MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH 94.18
KOG1826|consensus 2724 93.93
PF12260188 PIP49_C: Protein-kinase domain of FAM69; InterPro: 93.81
PRK10593297 hypothetical protein; Provisional 93.23
KOG2268|consensus465 92.86
PF03881288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 92.76
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 91.36
KOG1033|consensus516 91.02
KOG2270|consensus520 90.69
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 89.4
PRK10271188 thiK thiamine kinase; Provisional 88.68
cd05156302 ChoK_euk Choline Kinase (ChoK) in eukaryotes. The 88.57
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 87.81
TIGR02906313 spore_CotS spore coat protein, CotS family. Member 87.74
PLN02236344 choline kinase 87.6
smart00587196 CHK ZnF_C4 abd HLH domain containing kinases domai 87.17
KOG1093|consensus 725 86.7
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 85.86
PF01633211 Choline_kinase: Choline/ethanolamine kinase; Inter 85.16
cd0005267 EH Eps15 homology domain; found in proteins implic 85.0
COG2334331 Putative homoserine kinase type II (protein kinase 84.39
COG4857408 Predicted kinase [General function prediction only 84.34
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 84.33
>KOG0615|consensus Back     alignment and domain information
Probab=100.00  E-value=8.9e-52  Score=379.76  Aligned_cols=222  Identities=27%  Similarity=0.386  Sum_probs=194.2

Q ss_pred             cCccCcCCCCceEEEEEEEcCCCcEEEEEEecccc----------cchHHHHHHHHHHhCCCCCcceeeeecCc---ceE
Q psy6046           6 MASHVGGNRARSSCSRKPEKTTKREVVQWKERNVS----------QGVVIVDEEQLLKLIKVEPIEKYYSLDPE---PLL   72 (379)
Q Consensus         6 ~~~~~lG~G~fG~V~~a~~~~tg~~~a~~k~~~~~----------~~~~~~~E~~il~~l~hpnIv~~~~~~~~---~~~   72 (379)
                      +..+.||+|+||.|-+|.++.||+.|| +|+++..          ....+.+|++||++|+|||||++++++..   .|+
T Consensus       175 ii~~~LGsGafg~Vkla~e~~tgk~vA-iKIi~krk~~~~s~~~~~~~~v~~EieILkkL~HP~IV~~~d~f~~~ds~Ym  253 (475)
T KOG0615|consen  175 IISKTLGSGAFGLVKLAYEKKTGKQVA-IKIINKRKSTGCSRAIAKTRDVQNEIEILKKLSHPNIVRIKDFFEVPDSSYM  253 (475)
T ss_pred             EeeeeecCCceeEEEEEEEcccCcEEE-eeeeehhhcccccccccchhhhHHHHHHHHhcCCCCEEEEeeeeecCCceEE
Confidence            556689999999999999999999999 5655431          11236799999999999999999999875   699


Q ss_pred             EeeC--CchhhHH--------------HHHHHHhcccCCCCCCeEeCCCCCCcEEEeecCCCCcEEEeecccceeeccCc
Q psy6046          73 GLNP--RPPVYQA--------------SATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGI  136 (379)
Q Consensus        73 v~e~--~g~l~~~--------------~al~~lh~~~~~h~~~ivHrDlkp~Nill~~~~~~~~ikl~DFG~a~~~~~~~  136 (379)
                      |+||  +|+||+.              .+-+.|+.+.++|++||+||||||+|||+..+.....+||+|||+|+.....+
T Consensus       254 VlE~v~GGeLfd~vv~nk~l~ed~~K~~f~Qll~avkYLH~~GI~HRDiKPeNILl~~~~e~~llKItDFGlAK~~g~~s  333 (475)
T KOG0615|consen  254 VLEYVEGGELFDKVVANKYLREDLGKLLFKQLLTAVKYLHSQGIIHRDIKPENILLSNDAEDCLLKITDFGLAKVSGEGS  333 (475)
T ss_pred             EEEEecCccHHHHHHhccccccchhHHHHHHHHHHHHHHHHcCcccccCCcceEEeccCCcceEEEecccchhhccccce
Confidence            9999  9999998              22344444444444999999999999999987556889999999999988888


Q ss_pred             cccccccCCCCcch------------------HHHHHHHHHhhCCCCCCCCChH-HHHHHHHhCCCCCCcccccCCCHHH
Q psy6046         137 EIRELLGTPDYVGK------------------SLGVTAYVLLTGFSPFGGETDS-ETFRNISKAQLDFPDELFEDISPEA  197 (379)
Q Consensus       137 ~~~~~~gt~~y~aP------------------SlGvil~~lltg~~Pf~~~~~~-~~~~~i~~~~~~~~~~~~~~~s~~~  197 (379)
                      .+.+.||||.|.||                  |+||++|.+|+|.+||.+.... .+.++|.+|.+.+-+..|..+|+++
T Consensus       334 fm~TlCGTpsYvAPEVl~~kg~~~~~~kVDiWSlGcvLfvcLsG~pPFS~~~~~~sl~eQI~~G~y~f~p~~w~~Iseea  413 (475)
T KOG0615|consen  334 FMKTLCGTPSYVAPEVLASKGVEYYPSKVDIWSLGCVLFVCLSGYPPFSEEYTDPSLKEQILKGRYAFGPLQWDRISEEA  413 (475)
T ss_pred             ehhhhcCCccccChhheecCCeecccchheeeeccceEEEEeccCCCcccccCCccHHHHHhcCcccccChhhhhhhHHH
Confidence            99999999999999                  9999999999999999876544 4889999999999999999999999


Q ss_pred             HHHHHHhcccCCCCCCCHHHHhcCccccCCc
Q psy6046         198 KDFIAKILIKNPMERMTAKEALKHPWLMNKK  228 (379)
Q Consensus       198 ~~li~~~L~~dP~~Rpt~~e~l~hp~~~~~~  228 (379)
                      .+||..||.+||++|||++|+|+||||+...
T Consensus       414 ~dlI~~mL~VdP~~R~s~~eaL~hpW~~~~~  444 (475)
T KOG0615|consen  414 LDLINWMLVVDPENRPSADEALNHPWFKDAP  444 (475)
T ss_pred             HHHHHHhhEeCcccCcCHHHHhcChhhhccc
Confidence            9999999999999999999999999998654



>KOG0575|consensus Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>KOG0669|consensus Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG1006|consensus Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>PHA03210 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>KOG0668|consensus Back     alignment and domain information
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>KOG0665|consensus Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) Back     alignment and domain information
>PHA02882 putative serine/threonine kinase; Provisional Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>KOG1027|consensus Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>KOG4257|consensus Back     alignment and domain information
>KOG0664|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>PLN03224 probable serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0670|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information
>KOG2052|consensus Back     alignment and domain information
>KOG0984|consensus Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>KOG1167|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>KOG0200|consensus Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG1345|consensus Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG1165|consensus Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG1164|consensus Back     alignment and domain information
>KOG1024|consensus Back     alignment and domain information
>PRK12274 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG1023|consensus Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional Back     alignment and domain information
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32 Back     alignment and domain information
>KOG4158|consensus Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG3087|consensus Back     alignment and domain information
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG3741|consensus Back     alignment and domain information
>KOG0601|consensus Back     alignment and domain information
>KOG1266|consensus Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] Back     alignment and domain information
>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional Back     alignment and domain information
>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>PRK09550 mtnK methylthioribose kinase; Reviewed Back     alignment and domain information
>KOG1235|consensus Back     alignment and domain information
>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP Back     alignment and domain information
>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 Back     alignment and domain information
>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) Back     alignment and domain information
>TIGR01767 MTRK 5-methylthioribose kinase Back     alignment and domain information
>PRK09902 hypothetical protein; Provisional Back     alignment and domain information
>PRK12396 5-methylribose kinase; Reviewed Back     alignment and domain information
>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) Back     alignment and domain information
>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily Back     alignment and domain information
>TIGR02721 ycfN_thiK thiamine kinase Back     alignment and domain information
>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] Back     alignment and domain information
>PLN02876 acyl-CoA dehydrogenase Back     alignment and domain information
>PRK05231 homoserine kinase; Provisional Back     alignment and domain information
>cd05153 HomoserineK_II Homoserine Kinase, type II Back     alignment and domain information
>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members Back     alignment and domain information
>TIGR00938 thrB_alt homoserine kinase, Neisseria type Back     alignment and domain information
>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 Back     alignment and domain information
>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes Back     alignment and domain information
>PLN02756 S-methyl-5-thioribose kinase Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') Back     alignment and domain information
>KOG1826|consensus Back     alignment and domain information
>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>KOG2268|consensus Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>KOG1033|consensus Back     alignment and domain information
>KOG2270|consensus Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PRK10271 thiK thiamine kinase; Provisional Back     alignment and domain information
>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>TIGR02906 spore_CotS spore coat protein, CotS family Back     alignment and domain information
>PLN02236 choline kinase Back     alignment and domain information
>smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain Back     alignment and domain information
>KOG1093|consensus Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] Back     alignment and domain information
>COG4857 Predicted kinase [General function prediction only] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
2ya9_A361 Crystal Structure Of The Autoinhibited Form Of Mous 2e-26
1z9x_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-25
2a27_A321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 3e-25
3lm0_A327 Crystal Structure Of Human SerineTHREONINE KINASE 1 4e-25
2a2a_A321 High-resolution Crystallographic Analysis Of The Au 7e-25
1wmk_A321 Human Death-Associated Kinase Drp-1, Mutant S308d D 1e-24
1zws_A288 Crystal Structure Of The Catalytic Domain Of Human 1e-24
2x0g_A334 X-ray Structure Of A Dap-kinase Calmodulin Complex 2e-23
3bhy_A283 Crystal Structure Of Human Death Associated Protein 2e-23
2xzs_A312 Death Associated Protein Kinase 1 Residues 1-312 Le 3e-23
2w4k_A302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 3e-23
2y0a_A326 Structure Of Dapk1 Construct Residues 1-304 Length 4e-23
2xuu_A334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 5e-23
3dfc_B295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 5e-23
3gu4_A295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 5e-23
3f5u_A295 Crystal Structure Of The Death Associated Protein K 5e-23
3gu8_A295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 5e-23
1p4f_A293 Death Associated Protein Kinase Catalytic Domain Wi 5e-23
1ig1_A294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 5e-23
2yak_A285 Structure Of Death-Associated Protein Kinase 1 (Dap 6e-23
1wvw_A278 Crystal Structures Of Kinase Domain Of Dap Kinase I 6e-23
2w4j_A277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 7e-23
2j90_A304 Crystal Structure Of Human Zip Kinase In Complex Wi 1e-22
1yrp_A278 Catalytic Domain Of Human Zip Kinase Phosphorylated 1e-22
2x4f_A373 The Crystal Structure Of The Human Myosin Light Cha 5e-21
2jc6_A334 Crystal Structure Of Human Calmodulin-Dependent Pro 4e-20
2jam_B304 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-19
1koa_A491 Twitchin Kinase Fragment (C.Elegans), Autoregulated 3e-19
3uto_A573 Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- 4e-19
1tki_A321 Autoinhibited Serine Kinase Domain Of The Giant Mus 1e-18
4fg8_A315 Crystal Structure Of Human Calcium/calmodulin-depen 1e-18
1kob_A387 Twitchin Kinase Fragment (Aplysia), Autoregulated P 1e-18
4fg9_A320 Crystal Structure Of Human Calcium/calmodulin-depen 1e-18
1a06_A332 Calmodulin-Dependent Protein Kinase From Rat Length 1e-18
3soa_A444 Full-Length Human Camkii Length = 444 4e-18
2vz6_A313 Structure Of Human Calcium Calmodulin Dependent Pro 5e-18
4fg7_A293 Crystal Structure Of Human Calcium/calmodulin-depen 5e-18
2wel_A327 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 7e-18
2vn9_A301 Crystal Structure Of Human Calcium Calmodulin Depen 7e-18
3bhh_A295 Crystal Structure Of Human Calcium/calmodulin-depen 8e-18
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 1e-17
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 3e-17
3dxn_A287 Crystal Structure Of The Calcium-dependent Kinase F 3e-17
2qg5_A294 Cryptosporidium Parvum Calcium Dependent Protein Ki 4e-17
3f3z_A277 Crystal Structure Of Cryptosporidium Parvum Calcium 4e-17
2v7o_A336 Crystal Structure Of Human Calcium-Calmodulin-Depen 5e-17
2w4o_A349 Crystal Structure Of Human Camk4 In Complex With 4- 1e-16
2bdw_A362 Crystal Structure Of The Auto-Inhibited Kinase Doma 5e-16
3kk9_A282 Camkii Substrate Complex B Length = 282 5e-16
3kk8_A284 Camkii Substrate Complex A Length = 284 5e-16
2ycf_A322 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-15
3kl8_A269 Camkiintide Inhibitor Complex Length = 269 3e-15
2xk9_A322 Structural Analysis Of Checkpoint Kinase 2 (Chk2) I 3e-15
2ycr_A323 Crystal Structure Of Checkpoint Kinase 2 In Complex 3e-15
2w0j_A323 Crystal Structure Of Chk2 In Complex With Nsc 10955 3e-15
2cn5_A329 Crystal Structure Of Human Chk2 In Complex With Adp 3e-15
3i6w_A443 Structure And Activation Mechanism Of The Chk2 Dna- 4e-15
3i6u_A419 Structure And Activation Mechanism Of The Chk2 Dna- 5e-15
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 7e-15
2wei_A287 Crystal Structure Of The Kinase Domain Of Cryptospo 9e-15
3dfa_A286 Crystal Structure Of Kinase Domain Of Calcium-depen 1e-14
3q5i_A504 Crystal Structure Of Pbanka_031420 Length = 504 6e-13
2ac3_A316 Structure Of Human Mnk2 Kinase Domain Length = 316 7e-13
3d14_A272 Crystal Structure Of Mouse Aurora A (Asn186->gly, L 1e-12
2ac5_A316 Structure Of Human Mnk2 Kinase Domain Mutant D228g 2e-12
3daj_A272 Crystal Structure Of Aurora A Complexed With An Inh 2e-12
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-12
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-12
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-12
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 3e-12
2xru_A280 Aurora-A T288e Complexed With Pha-828300 Length = 2 4e-12
3ma6_A298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 5e-12
2hw6_A307 Crystal Structure Of Mnk1 Catalytic Domain Length = 6e-12
3ka0_A320 Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 7e-12
2c6e_A283 Aurora A Kinase Activated Mutant (T287d) In Complex 9e-12
2bmc_A306 Aurora-2 T287d T288d Complexed With Pha-680632 Leng 9e-12
3fdn_A279 Structure-Based Drug Design Of Novel Aurora Kinase 9e-12
2wtv_A285 Aurora-A Inhibitor Structure Length = 285 1e-11
2c6d_A275 Aurora A Kinase Activated Mutant (T287d) In Complex 1e-11
3lau_A287 Crystal Structure Of Aurora2 Kinase In Complex With 1e-11
2j4z_A306 Structure Of Aurora-2 In Complex With Pha-680626 Le 1e-11
1ol5_A282 Structure Of Aurora-A 122-403, Phosphorylated On Th 1e-11
1muo_A297 Crystal Structure Of Aurora-2, An Oncogenic Serine- 1e-11
2xng_A283 Structure Of Aurora-A Bound To A Selective Imidazop 1e-11
2qr8_A342 2.0a X-ray Structure Of C-terminal Kinase Domain Of 1e-11
2dwb_A285 Aurora-A Kinase Complexed With Amppnp Length = 285 1e-11
2wtw_A285 Aurora-A Inhibitor Structure (2nd Crystal Form) Len 2e-11
2x6d_A285 Aurora-A Bound To An Inhibitor Length = 285 2e-11
3nrm_A283 Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito 2e-11
2j50_A280 Structure Of Aurora-2 In Complex With Pha-739358 Le 2e-11
3unz_A279 Aurora A In Complex With Rpm1679 Length = 279 2e-11
3h4j_B336 Crystal Structure Of Pombe Ampk Kdaid Fragment Leng 3e-11
2jbo_A326 Protein Kinase Mk2 In Complex With An Inhibitor (Cr 3e-11
3fpm_A325 Crystal Structure Of A Squarate Inhibitor Bound To 3e-11
2onl_C406 Crystal Structure Of The P38a-Mapkap Kinase 2 Heter 3e-11
2pzy_A324 Structure Of Mk2 Complexed With Compound 76 Length 3e-11
3r2b_A318 Mk2 Kinase Bound To Compound 5b Length = 318 3e-11
2oza_A356 Structure Of P38alpha Complex Length = 356 3e-11
1kwp_A400 Crystal Structure Of Mapkap2 Length = 400 3e-11
3r2y_A319 Mk2 Kinase Bound To Compound 1 Length = 319 3e-11
3gok_A334 Binding Site Mapping Of Protein Ligands Length = 33 3e-11
2p3g_X327 Crystal Structure Of A Pyrrolopyridine Inhibitor Bo 3e-11
2qr7_A342 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of 5e-11
1ol6_A282 Structure Of Unphosphorylated D274n Mutant Of Auror 5e-11
3r21_A271 Design, Synthesis, And Biological Evaluation Of Pyr 7e-11
3rny_A346 Crystal Structure Of Human Rsk1 C-Terminal Kinase D 7e-11
3ha6_A268 Crystal Structure Of Aurora A In Complex With Tpx2 8e-11
3qbn_A281 Structure Of Human Aurora A In Complex With A Diami 8e-11
3h0y_A268 Aurora A In Complex With A Bisanilinopyrimidine Len 8e-11
1phk_A298 Two Structures Of The Catalytic Domain Of Phosphory 8e-11
2w1c_A275 Structure Determination Of Aurora Kinase In Complex 8e-11
2w1d_A275 Structure Determination Of Aurora Kinase In Complex 9e-11
3o50_A267 Crystal Structure Of Benzamide 9 Bound To Auroraa L 9e-11
3e5a_A268 Crystal Structure Of Aurora A In Complex With Vx-68 9e-11
2wnt_A330 Crystal Structure Of The Human Ribosomal Protein S6 9e-11
2phk_A277 The Crystal Structure Of A Phosphorylase Kinase Pep 9e-11
1mq4_A272 Crystal Structure Of Aurora-A Protein Kinase Length 1e-10
2wqe_A262 Structure Of S155r Aurora-A Somatic Mutant Length = 1e-10
3ujg_A361 Crystal Structure Of Snrk2.6 In Complex With Hab1 L 2e-10
2y7j_A365 Structure Of Human Phosphorylase Kinase, Gamma 2 Le 2e-10
3coh_A268 Crystal Structure Of Aurora-A In Complex With A Pen 2e-10
2xne_A272 Structure Of Aurora-A Bound To An Imidazopyrazine I 3e-10
1ql6_A298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 3e-10
1nxk_A400 Crystal Structure Of Staurosporine Bound To Map Kap 6e-10
3mfr_A351 Cask-4m Cam Kinase Domain, Native Length = 351 7e-10
3uc4_A362 The Crystal Structure Of Snf1-Related Kinase 2.6 Le 9e-10
2bfy_A284 Complex Of Aurora-B With Incenp And Hesperidin. Len 1e-09
2bfx_B284 Mechanism Of Aurora-B Activation By Incenp And Inhi 1e-09
2vrx_A285 Structure Of Aurora B Kinase In Complex With Zm4474 1e-09
3kga_A299 Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe 1e-09
3dae_A283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 1e-09
3hyh_A275 Crystal Structure Of The Protein Kinase Domain Of Y 1e-09
3mn3_A271 An Inhibited Conformation For The Protein Kinase Do 1e-09
2fh9_A274 Structure And Dimerization Of The Kinase Domain Fro 2e-09
1fot_A318 Structure Of The Unliganded Camp-Dependent Protein 2e-09
3udb_A317 Crystal Structure Of Snrk2.6 Length = 317 5e-09
3tac_A361 Crystal Structure Of The Liprin-AlphaCASK COMPLEX L 5e-09
3zuu_A362 The Structure Of Ost1 (D160a, S175d) Kinase In Comp 5e-09
3c0g_A351 Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len 5e-09
3zut_A362 The Structure Of Ost1 (D160a) Kinase Length = 362 8e-09
3r1n_A317 Mk3 Kinase Bound To Compound 5b Length = 317 1e-08
3fhr_A336 High Resolution Crystal Structure Of Mitogen-Activa 1e-08
3hko_A345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 1e-08
4af3_A292 Human Aurora B Kinase In Complex With Incenp And Vx 2e-08
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 3e-08
3cok_A278 Crystal Structure Of Plk4 Kinase Length = 278 5e-08
3uc3_A361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 6e-08
3is5_A285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 2e-07
3kn5_A325 Crystal Structure Of The C-Terminal Kinase Domain O 3e-07
3pfq_A674 Crystal Structure And Allosteric Activation Of Prot 4e-07
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 4e-07
2zv2_A298 Crystal Structure Of Human CalciumCALMODULIN-Depend 4e-07
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 5e-07
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 5e-07
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 5e-07
3zgw_A347 Crystal Structure Of Maternal Embryonic Leucine Zip 5e-07
1gzk_A315 Molecular Mechanism For The Regulation Of Protein K 5e-07
1o6l_A337 Crystal Structure Of An Activated Akt/protein Kinas 6e-07
2jdo_A342 Structure Of Pkb-Beta (Akt2) Complexed With Isoquin 7e-07
2jed_A352 The Crystal Structure Of The Kinase Domain Of The P 7e-07
2i0e_A353 Structure Of Catalytic Domain Of Human Protein Kina 9e-07
3a62_A327 Crystal Structure Of Phosphorylated P70s6k1 Length 9e-07
3a60_A327 Crystal Structure Of Unphosphorylated P70s6k1 (Form 1e-06
2wzj_A327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 1e-06
4ejn_A446 Crystal Structure Of Autoinhibited Form Of Akt1 In 5e-06
3o96_A446 Crystal Structure Of Human Akt1 With An Allosteric 5e-06
2y94_A476 Structure Of An Active Form Of Mammalian Ampk Lengt 5e-06
2yza_A276 Crystal Structure Of Kinase Domain Of Human 5'-Amp- 6e-06
1zmu_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-06
4gv1_A340 Pkb Alpha In Complex With Azd5363 Length = 340 6e-06
1zmv_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 6e-06
2r0i_A327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 7e-06
3ocb_A341 Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor 7e-06
3iec_A319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 7e-06
3cqu_A342 Crystal Structure Of Akt-1 Complexed With Substrate 7e-06
1zmw_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 8e-06
1uu9_A286 Structure Of Human Pdk1 Kinase Domain In Complex Wi 9e-06
3nus_A286 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra 9e-06
1z5m_A286 Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr 1e-05
2qnj_A328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 1e-05
1h1w_A289 High Resolution Crystal Structure Of The Human Pdk1 1e-05
3nax_A311 Pdk1 In Complex With Inhibitor Mp7 Length = 311 1e-05
3fe3_A328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 1e-05
3nun_A292 Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea 1e-05
3nay_A311 Pdk1 In Complex With Inhibitor Mp6 Length = 311 1e-05
2r7b_A312 Crystal Structure Of The Phosphoinositide-Dependent 1e-05
2h6d_A276 Protein Kinase Domain Of The Human 5'-Amp-Activated 1e-05
3pwy_A311 Crystal Structure Of An Extender (Spd28345)-Modifie 1e-05
2xch_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 1e-05
2yac_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-05
2biy_A310 Structure Of Pdk1-S241a Mutant Kinase Domain Length 1e-05
1uu3_A310 Structure Of Human Pdk1 Kinase Domain In Complex Wi 1e-05
2xck_A309 Crystal Structure Of Pdk1 In Complex With A Pyrazol 1e-05
3kb7_A311 Crystal Structure Of Polo-Like Kinase 1 In Complex 1e-05
2v5q_A315 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-05
3rwp_A311 Discovery Of A Novel, Potent And Selective Inhibito 1e-05
3nyn_A576 Crystal Structure Of G Protein-Coupled Receptor Kin 1e-05
2pml_X348 Crystal Structure Of Pfpk7 In Complex With An Atp A 1e-05
3h9o_A311 Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) 1e-05
3sc1_A311 Novel Isoquinolone Pdk1 Inhibitors Discovered Throu 1e-05
3iop_A312 Pdk-1 In Complex With The Inhibitor Compound-8i Len 1e-05
3orx_A316 Pdk1 Mutant Bound To Allosteric Disulfide Fragment 1e-05
2acx_A576 Crystal Structure Of G Protein Coupled Receptor Kin 1e-05
3hrc_A311 Crystal Structure Of A Mutant Of Human Pdk1 Kinase 2e-05
4a07_A311 Human Pdk1 Kinase Domain In Complex With Allosteric 2e-05
2ou7_A335 Structure Of The Catalytic Domain Of Human Polo-Lik 2e-05
3thb_A333 Structure Of Plk1 Kinase Domain In Complex With A B 2e-05
3d5v_A317 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-05
3txo_A353 Pkc Eta Kinase In Complex With A Naphthyridine Leng 2e-05
3db6_A301 Crystal Structure Of An Activated (Thr->asp) Polo-L 2e-05
2rku_A294 Structure Of Plk1 In Complex With Bi2536 Length = 2 2e-05
3d5u_A317 Crystal Structure Of A Wildtype Polo-Like Kinase 1 3e-05
3d5w_A317 Crystal Structure Of A Phosphorylated Polo-Like Kin 3e-05
3qc4_A314 Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 4e-05
2wtk_C305 Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 4e-05
4el9_A305 Structure Of N-Terminal Kinase Domain Of Rsk2 With 6e-05
3ubd_A304 Structure Of N-Terminal Domain Of Rsk2 Kinase In Co 6e-05
3g51_A325 Structural Diversity Of The Active Conformation Of 7e-05
3aln_A327 Crystal Structure Of Human Non-Phosphorylated Mkk4 9e-05
1y8g_A327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 9e-05
2q0n_A301 Structure Of Human P21 Activating Kinase 4 (Pak4) I 1e-04
4fif_A346 Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid 1e-04
4fie_A423 Full-Length Human Pak4 Length = 423 1e-04
2cdz_A303 Crystal Structure Of The Human P21-Activated Kinase 1e-04
1vzo_A355 The Structure Of The N-Terminal Kinase Domain Of Ms 1e-04
2c30_A321 Crystal Structure Of The Human P21-Activated Kinase 1e-04
2bva_A292 Crystal Structure Of The Human P21-Activated Kinase 1e-04
2x4z_A296 Crystal Structure Of The Human P21-Activated Kinase 1e-04
2i6l_A320 Crystal Structure Of Human Mitogen Activated Protei 1e-04
4aw2_A437 Crystal Structure Of Cdc42 Binding Protein Kinase A 2e-04
1jwh_A337 Crystal Structure Of Human Protein Kinase Ck2 Holoe 3e-04
3f61_A311 Crystal Structure Of M. Tuberculosis Pknb Leu33aspV 9e-04
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure

Iteration: 1

Score = 116 bits (290), Expect = 2e-26, Method: Compositional matrix adjust. Identities = 71/211 (33%), Positives = 113/211 (53%), Gaps = 27/211 (12%) Query: 103 FFLQPQNLVMMG-DFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGK----------- 150 F L+P+N++++ + P IK+ DF ++ I DG+E + + GTP++V Sbjct: 139 FDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLE 198 Query: 151 ----SLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILI 206 S+GV Y+LL+G SPF G+T ET NI+ DF +E F S AKDFI K+L+ Sbjct: 199 ADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLV 258 Query: 207 KNPMERMTAKEALKHPWL--MNKKQIMTRVGCSSCPSIIQNQQNKKNLRKYLSKSREALF 264 K +R+T +EAL+HPW+ ++ +Q M R S++ N +N +K + R L Sbjct: 259 KETRKRLTIQEALRHPWITPVDTQQAMVR-----RESVV----NLENFKKQYVRRRWKLS 309 Query: 265 EKVISASKLQQENLRKSALLKYNKTRRLCES 295 ++S +L K L+ ++ R CES Sbjct: 310 FSIVSLCNHLTRSLMKKVHLRTSEDLRNCES 340
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 Back     alignment and structure
>pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 Back     alignment and structure
>pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 Back     alignment and structure
>pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 Back     alignment and structure
>pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 Back     alignment and structure
>pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 Back     alignment and structure
>pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 Back     alignment and structure
>pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 Back     alignment and structure
>pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 Back     alignment and structure
>pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 Back     alignment and structure
>pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 Back     alignment and structure
>pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 Back     alignment and structure
>pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 Back     alignment and structure
>pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 Back     alignment and structure
>pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 Back     alignment and structure
>pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 Back     alignment and structure
>pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 Back     alignment and structure
>pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 Back     alignment and structure
>pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 Back     alignment and structure
>pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 Back     alignment and structure
>pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 Back     alignment and structure
>pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 Back     alignment and structure
>pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 Back     alignment and structure
>pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 Back     alignment and structure
>pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 Back     alignment and structure
>pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 Back     alignment and structure
>pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 Back     alignment and structure
>pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 Back     alignment and structure
>pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 Back     alignment and structure
>pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 Back     alignment and structure
>pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 Back     alignment and structure
>pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 Back     alignment and structure
>pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 Back     alignment and structure
>pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 Back     alignment and structure
>pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 Back     alignment and structure
>pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 Back     alignment and structure
>pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 Back     alignment and structure
>pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 Back     alignment and structure
>pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 Back     alignment and structure
>pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 Back     alignment and structure
>pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 Back     alignment and structure
>pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 Back     alignment and structure
>pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 Back     alignment and structure
>pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 Back     alignment and structure
>pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 Back     alignment and structure
>pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 Back     alignment and structure
>pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 Back     alignment and structure
>pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 Back     alignment and structure
>pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 Back     alignment and structure
>pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 Back     alignment and structure
>pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 Back     alignment and structure
>pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 Back     alignment and structure
>pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 Back     alignment and structure
>pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 Back     alignment and structure
>pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 Back     alignment and structure
>pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 Back     alignment and structure
>pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 Back     alignment and structure
>pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 Back     alignment and structure
>pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 Back     alignment and structure
>pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 Back     alignment and structure
>pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 Back     alignment and structure
>pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 Back     alignment and structure
>pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 Back     alignment and structure
>pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 Back     alignment and structure
>pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 Back     alignment and structure
>pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 Back     alignment and structure
>pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 Back     alignment and structure
>pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 Back     alignment and structure
>pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 Back     alignment and structure
>pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 Back     alignment and structure
>pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 Back     alignment and structure
>pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 Back     alignment and structure
>pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 Back     alignment and structure
>pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 Back     alignment and structure
>pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 Back     alignment and structure
>pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 Back     alignment and structure
>pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 Back     alignment and structure
>pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 Back     alignment and structure
>pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 Back     alignment and structure
>pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 Back     alignment and structure
>pdb|3PFQ|A Chain A, Crystal Structure And Allosteric Activation Of Protein Kinase C Beta Ii Length = 674 Back     alignment and structure
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure
>pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 Back     alignment and structure
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|1GZK|A Chain A, Molecular Mechanism For The Regulation Of Protein Kinase B Akt By Hydrophobic Motif Phosphorylation Length = 315 Back     alignment and structure
>pdb|1O6L|A Chain A, Crystal Structure Of An Activated Akt/protein Kinase B (pkb-pif Chimera) Ternary Complex With Amp-pnp And Gsk3 Peptide Length = 337 Back     alignment and structure
>pdb|2JDO|A Chain A, Structure Of Pkb-Beta (Akt2) Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 342 Back     alignment and structure
>pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 Back     alignment and structure
>pdb|2I0E|A Chain A, Structure Of Catalytic Domain Of Human Protein Kinase C Beta Ii Complexed With A Bisindolylmaleimide Inhibitor Length = 353 Back     alignment and structure
>pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 Back     alignment and structure
>pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 Back     alignment and structure
>pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 Back     alignment and structure
>pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 Back     alignment and structure
>pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 Back     alignment and structure
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure
>pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 Back     alignment and structure
>pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 Back     alignment and structure
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 Back     alignment and structure
>pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 Back     alignment and structure
>pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 Back     alignment and structure
>pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 Back     alignment and structure
>pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 Back     alignment and structure
>pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 Back     alignment and structure
>pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 Back     alignment and structure
>pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 Back     alignment and structure
>pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 Back     alignment and structure
>pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 Back     alignment and structure
>pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 Back     alignment and structure
>pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 Back     alignment and structure
>pdb|3NYN|A Chain A, Crystal Structure Of G Protein-Coupled Receptor Kinase 6 In Complex With Sangivamycin Length = 576 Back     alignment and structure
>pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 Back     alignment and structure
>pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 Back     alignment and structure
>pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 Back     alignment and structure
>pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 Back     alignment and structure
>pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 Back     alignment and structure
>pdb|2ACX|A Chain A, Crystal Structure Of G Protein Coupled Receptor Kinase 6 Bound To Amppnp Length = 576 Back     alignment and structure
>pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 Back     alignment and structure
>pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 Back     alignment and structure
>pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 Back     alignment and structure
>pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 Back     alignment and structure
>pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 Back     alignment and structure
>pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 Back     alignment and structure
>pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 Back     alignment and structure
>pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 Back     alignment and structure
>pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 Back     alignment and structure
>pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 Back     alignment and structure
>pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 Back     alignment and structure
>pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 Back     alignment and structure
>pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 Back     alignment and structure
>pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 Back     alignment and structure
>pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 Back     alignment and structure
>pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 Back     alignment and structure
>pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 Back     alignment and structure
>pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 Back     alignment and structure
>pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 Back     alignment and structure
>pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 Back     alignment and structure
>pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 Back     alignment and structure
>pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 Back     alignment and structure
>pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 Back     alignment and structure
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 Back     alignment and structure
>pdb|4AW2|A Chain A, Crystal Structure Of Cdc42 Binding Protein Kinase Alpha (Mrck Alpha) Length = 437 Back     alignment and structure
>pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 Back     alignment and structure
>pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 3e-51
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 8e-51
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 1e-49
3bhy_A283 Death-associated protein kinase 3; death associate 9e-49
2y0a_A326 Death-associated protein kinase 1; transferase, ca 4e-48
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 3e-46
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 3e-46
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 6e-46
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 8e-44
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 3e-41
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 8e-41
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-40
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 3e-40
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 3e-40
3lij_A494 Calcium/calmodulin dependent protein kinase with A 5e-40
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 5e-40
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 1e-39
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 2e-39
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 2e-39
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 3e-39
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 2e-38
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 3e-38
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 6e-38
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-36
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 9e-36
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 3e-35
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 2e-34
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 2e-33
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 2e-33
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-33
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 5e-33
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 4e-30
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 8e-29
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 5e-27
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 1e-26
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 7e-25
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 3e-24
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 4e-24
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 5e-24
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 8e-24
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-23
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-23
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 3e-23
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 4e-22
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 4e-22
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 5e-22
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 6e-22
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 7e-22
2eue_A275 Carbon catabolite derepressing protein kinase; kin 1e-21
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 2e-21
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 3e-21
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 3e-21
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 4e-21
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 6e-21
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 6e-21
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 1e-20
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 2e-20
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 3e-20
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 3e-20
3dls_A335 PAS domain-containing serine/threonine-protein KI; 2e-18
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 6e-18
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 9e-18
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 1e-17
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 2e-17
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 7e-17
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 1e-16
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 1e-16
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 6e-16
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 6e-16
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 8e-16
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 1e-15
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 2e-15
2a19_B284 Interferon-induced, double-stranded RNA-activated 5e-15
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-14
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 1e-14
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 2e-14
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 3e-14
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-14
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 5e-14
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 5e-14
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 6e-14
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 6e-14
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 7e-14
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 8e-14
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 1e-13
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 1e-13
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-13
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 6e-13
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 1e-12
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 1e-12
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 1e-12
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-12
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-12
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 2e-12
3an0_A340 Dual specificity mitogen-activated protein kinase; 3e-12
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 6e-12
3fme_A290 Dual specificity mitogen-activated protein kinase; 8e-12
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 1e-11
3aln_A327 Dual specificity mitogen-activated protein kinase; 1e-11
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 2e-11
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-11
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 4e-11
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 6e-11
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 9e-11
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 1e-10
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 1e-10
2fst_X367 Mitogen-activated protein kinase 14; active mutant 2e-10
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 4e-10
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 2e-09
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 2e-09
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 2e-09
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-09
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 4e-09
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 8e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
3ork_A311 Serine/threonine protein kinase; structural genomi 1e-08
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 1e-08
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-08
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 1e-08
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 2e-08
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 2e-08
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 2e-08
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 2e-08
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 3e-08
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 3e-08
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 3e-08
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 3e-08
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 4e-08
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 6e-08
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 7e-08
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 8e-08
3niz_A311 Rhodanese family protein; structural genomics, str 1e-07
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 1e-07
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 1e-07
3eqc_A360 Dual specificity mitogen-activated protein kinase; 2e-07
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 3e-07
3o0g_A292 Cell division protein kinase 5; kinase activator c 5e-07
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 7e-07
3rp9_A458 Mitogen-activated protein kinase; structural genom 8e-07
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 8e-07
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 8e-07
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 1e-06
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 1e-06
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 2e-06
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 5e-06
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 5e-06
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 5e-06
3uqc_A286 Probable conserved transmembrane protein; structur 6e-06
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 6e-06
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 6e-06
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 7e-06
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 9e-06
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 9e-06
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 1e-05
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 1e-05
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 1e-05
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 9e-05
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 4e-04
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 4e-04
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
 Score =  172 bits (439), Expect = 3e-51
 Identities = 59/166 (35%), Positives = 91/166 (54%), Gaps = 16/166 (9%)

Query: 105 LQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYV----------GK---- 150
           L+PQN+++   +P  DIK+ DF +SR I    E+RE++GTP+Y+                
Sbjct: 157 LKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDM 216

Query: 151 -SLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAKILIKNP 209
            ++G+ AY+LLT  SPF GE + ET+ NIS+  +D+ +E F  +S  A DFI  +L+KNP
Sbjct: 217 WNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNP 276

Query: 210 MERMTAKEALKHPWLMNKKQI-MTRVGCSSCPSIIQNQQNKKNLRK 254
            +R TA+  L H WL       +     +S  S  Q+   + +  K
Sbjct: 277 EKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDK 322


>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 100.0
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 100.0
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 100.0
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 100.0
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 100.0
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 100.0
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 100.0
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 100.0
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 100.0
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 100.0
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 100.0
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 100.0
3lij_A494 Calcium/calmodulin dependent protein kinase with A 100.0
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 100.0
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 100.0
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 100.0
4aoj_A329 High affinity nerve growth factor receptor; transf 100.0
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 100.0
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 100.0
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 100.0
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 100.0
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 100.0
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 100.0
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 100.0
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 100.0
4ase_A353 Vascular endothelial growth factor receptor 2; tra 100.0
2y0a_A326 Death-associated protein kinase 1; transferase, ca 100.0
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 100.0
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 100.0
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 100.0
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 100.0
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 100.0
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 100.0
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 100.0
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 100.0
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 100.0
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 100.0
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 100.0
3rp9_A458 Mitogen-activated protein kinase; structural genom 100.0
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 100.0
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 100.0
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 100.0
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 100.0
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 100.0
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 100.0
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 100.0
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 100.0
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 100.0
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 100.0
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 100.0
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 100.0
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 100.0
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 100.0
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 100.0
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 100.0
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 100.0
2eue_A275 Carbon catabolite derepressing protein kinase; kin 100.0
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 100.0
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 100.0
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 100.0
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 100.0
3niz_A311 Rhodanese family protein; structural genomics, str 100.0
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 100.0
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 100.0
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 100.0
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 100.0
3o0g_A292 Cell division protein kinase 5; kinase activator c 100.0
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 100.0
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 100.0
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 100.0
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 100.0
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 100.0
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 100.0
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 100.0
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 100.0
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 100.0
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 100.0
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 100.0
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 100.0
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 100.0
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 100.0
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 100.0
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 100.0
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 100.0
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 100.0
2fst_X367 Mitogen-activated protein kinase 14; active mutant 100.0
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 100.0
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 100.0
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 100.0
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 100.0
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 100.0
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 100.0
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 100.0
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 100.0
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 100.0
3bhy_A283 Death-associated protein kinase 3; death associate 100.0
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 100.0
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 100.0
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 100.0
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 100.0
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 100.0
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 100.0
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 100.0
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 100.0
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 100.0
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 100.0
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 100.0
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 100.0
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 100.0
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 100.0
3dls_A335 PAS domain-containing serine/threonine-protein KI; 100.0
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 100.0
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 100.0
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 100.0
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 100.0
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 100.0
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 100.0
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 100.0
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 100.0
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 100.0
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 100.0
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 100.0
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 100.0
3fme_A290 Dual specificity mitogen-activated protein kinase; 100.0
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 100.0
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 100.0
3ork_A311 Serine/threonine protein kinase; structural genomi 100.0
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 100.0
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 100.0
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 100.0
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 100.0
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 100.0
3eqc_A360 Dual specificity mitogen-activated protein kinase; 100.0
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 100.0
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 100.0
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 100.0
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 100.0
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 100.0
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 100.0
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 100.0
3an0_A340 Dual specificity mitogen-activated protein kinase; 100.0
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 100.0
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 100.0
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 100.0
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 100.0
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 100.0
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 100.0
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 100.0
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 100.0
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 100.0
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 100.0
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 100.0
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 100.0
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 100.0
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 100.0
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 100.0
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 100.0
3aln_A327 Dual specificity mitogen-activated protein kinase; 100.0
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 100.0
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 100.0
2dyl_A318 Dual specificity mitogen-activated protein kinase 100.0
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 100.0
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 100.0
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 100.0
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 100.0
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 100.0
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 100.0
3poz_A327 Epidermal growth factor receptor; kinase domain, a 100.0
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 100.0
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 100.0
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 100.0
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 100.0
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 100.0
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 100.0
3lzb_A327 Epidermal growth factor receptor; epidermal growth 100.0
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 100.0
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 100.0
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 100.0
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 100.0
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 100.0
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 100.0
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 100.0
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 100.0
2a19_B284 Interferon-induced, double-stranded RNA-activated 100.0
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 100.0
3soc_A322 Activin receptor type-2A; structural genomics cons 100.0
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 100.0
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 100.0
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 100.0
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 100.0
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 100.0
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 100.0
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 100.0
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 100.0
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 100.0
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 100.0
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 100.0
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 100.0
3q4u_A301 Activin receptor type-1; structural genomics conso 100.0
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 100.0
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 100.0
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 100.0
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 100.0
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 100.0
3pls_A298 Macrophage-stimulating protein receptor; protein k 100.0
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 100.0
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 100.0
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 100.0
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 100.0
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 100.0
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 100.0
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 100.0
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 100.0
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 100.0
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 100.0
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 100.0
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 100.0
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 100.0
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 100.0
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 100.0
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 100.0
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 100.0
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 100.0
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 100.0
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 100.0
2xir_A316 Vascular endothelial growth factor receptor 2; ang 100.0
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 100.0
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 100.0
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 100.0
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 100.0
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 100.0
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 100.0
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 100.0
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.98
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.98
2vuw_A336 Serine/threonine-protein kinase haspin; cell cycle 99.98
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.98
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.98
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.97
3gxj_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.97
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.97
3uqc_A286 Probable conserved transmembrane protein; structur 99.97
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.97
4azs_A569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.9
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.85
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.79
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.7
4gyi_A397 RIO2 kinase; protein kinase, ADP complex, phosphoa 99.44
1nd4_A264 Aminoglycoside 3'-phosphotransferase; protein kina 98.7
3tm0_A263 Aminoglycoside 3'-phosphotransferase; protein kina 98.65
3dxp_A359 Putative acyl-COA dehydrogenase; protein kinase-li 98.37
3sg8_A304 APH(2'')-ID; antibiotic resistance enzyme, transfe 97.92
4gkh_A272 Aminoglycoside 3'-phosphotransferase APHA1-IAB; py 97.76
3r70_A320 Aminoglycoside phosphotransferase; structural geno 97.73
3d1u_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 97.68
2olc_A397 MTR kinase, methylthioribose kinase; kinase ADP-2H 97.56
3tdw_A306 Gentamicin resistance protein; kinase, phosphoryl 97.08
3ovc_A362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 96.99
2q83_A346 YTAA protein; 2635576, structural genomics, joint 96.73
3f7w_A288 Putative fructosamine-3-kinase; YP_290396.1, struc 96.26
2lv7_A100 Calcium-binding protein 7; metal binding protein; 96.2
3ats_A357 Putative uncharacterized protein; hypothetical pro 96.04
3jr1_A312 Putative fructosamine-3-kinase; YP_719053.1, struc 95.65
2ppq_A322 HSK, HK, homoserine kinase; structural genomics, M 95.54
1ij5_A 323 Plasmodial specific LAV1-2 protein; fourty kDa cal 94.96
1nw1_A429 Choline kinase (49.2 KD); phospholipid synthesis, 94.37
3feg_A379 Choline/ethanolamine kinase; non-protein kinase, c 94.04
3dxq_A301 Choline/ethanolamine kinase family protein; NP_106 94.02
2qg7_A458 Ethanolamine kinase PV091845; malaria, SGC, struct 93.77
1c07_A95 Protein (epidermal growth factor receptor pathway 93.03
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 92.82
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 92.74
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 92.59
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 92.39
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 92.08
1avs_A90 Troponin C; muscle contraction, calcium-activated, 92.08
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 91.79
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 91.57
2pyw_A420 Uncharacterized protein; 5-methylthioribose kinase 91.53
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 91.28
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 90.96
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 90.9
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 90.76
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 90.36
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 89.99
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 89.99
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 89.69
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 89.49
1qjt_A99 EH1, epidermal growth factor receptor substrate su 89.46
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 89.39
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 89.28
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 89.25
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 89.16
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 89.15
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 89.11
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 88.65
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 88.16
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 88.05
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 87.75
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 87.66
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 87.56
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 87.53
3li6_A66 Calcium-binding protein; calcium signaling protein 87.25
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 87.16
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 87.03
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 86.93
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 86.89
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 86.59
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 86.41
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 85.9
1exr_A148 Calmodulin; high resolution, disorder, metal trans 85.68
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 85.66
3csv_A333 Aminoglycoside phosphotransferase; YP_614837.1, ph 85.45
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 85.43
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 85.39
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 85.33
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 85.29
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 85.13
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 84.9
3c5i_A369 Choline kinase; choline, kinase, malaria, transfer 84.39
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 84.35
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 84.03
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 83.95
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 83.88
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 83.65
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 83.46
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 83.25
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 83.16
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 83.03
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 82.58
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 82.32
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 82.29
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 81.95
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 81.88
3i1a_A339 Spectinomycin phosphotransferase; protein kinase, 81.84
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 81.8
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 81.72
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 81.59
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 81.53
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 81.49
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 80.96
1zyl_A328 Hypothetical protein YIHE; putative protein kinase 80.91
3fwb_A161 Cell division control protein 31; gene gating, com 80.53
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 80.49
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 80.4
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 80.22
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=100.00  E-value=3.5e-52  Score=388.81  Aligned_cols=212  Identities=23%  Similarity=0.359  Sum_probs=188.7

Q ss_pred             CccCcCCCCceEEEEEEEcCCCcEEEEEEeccc------ccchHHHHHHHHHHhCCCCCcceeeeecCc---ceEEeeC-
Q psy6046           7 ASHVGGNRARSSCSRKPEKTTKREVVQWKERNV------SQGVVIVDEEQLLKLIKVEPIEKYYSLDPE---PLLGLNP-   76 (379)
Q Consensus         7 ~~~~lG~G~fG~V~~a~~~~tg~~~a~~k~~~~------~~~~~~~~E~~il~~l~hpnIv~~~~~~~~---~~~v~e~-   76 (379)
                      ..++||+|+||+||+|+++.||+.||+ |++..      ...+.+.+|+++|+.|+|||||++++++++   +|++||| 
T Consensus        36 i~~~lG~G~fg~V~~a~~~~~~~~~Ai-K~i~k~~~~~~~~~~~~~~E~~il~~l~HpnIv~l~~~~~~~~~~yivmEy~  114 (311)
T 4aw0_A           36 FGKILGEGSFSTVVLARELATSREYAI-KILEKRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYA  114 (311)
T ss_dssp             EEEEEEEETTEEEEEEEETTTCCEEEE-EEEEHHHHHHTTCHHHHHHHHHHHTTCCCTTBCCEEEEEECSSEEEEEECCC
T ss_pred             EEEEEecccCeEEEEEEECCCCCEEEE-EEEEHHHCCCHHHHHHHHHHHHHHHhCCCCCCCeEEEEEEeCCEEEEEEecC
Confidence            345899999999999999999999994 55432      334679999999999999999999999876   8999999 


Q ss_pred             -CchhhHH--------------------HHHHHHhcccCCCCCCeEeCCCCCCcEEEeecCCCCcEEEeecccceeeccC
Q psy6046          77 -RPPVYQA--------------------SATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDG  135 (379)
Q Consensus        77 -~g~l~~~--------------------~al~~lh~~~~~h~~~ivHrDlkp~Nill~~~~~~~~ikl~DFG~a~~~~~~  135 (379)
                       +|+|++.                    .|+.|||+      +||+||||||+|||++.+   +.+||+|||+|+.+...
T Consensus       115 ~gG~L~~~i~~~~~l~e~~~~~~~~qi~~al~ylH~------~~IiHRDlKPeNILl~~~---g~vKl~DFGla~~~~~~  185 (311)
T 4aw0_A          115 KNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHG------KGIIHRDLKPENILLNED---MHIQITDFGTAKVLSPE  185 (311)
T ss_dssp             TTEEHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHH------TTEECSCCSGGGEEECTT---SCEEECCCTTCEECCTT
T ss_pred             CCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHH------CCCccCCCCHHHeEEcCC---CCEEEEEcCCceecCCC
Confidence             8899887                    67888888      999999999999999875   89999999999987533


Q ss_pred             ---ccccccccCCCCcch---------------HHHHHHHHHhhCCCCCCCCChHHHHHHHHhCCCCCCcccccCCCHHH
Q psy6046         136 ---IEIRELLGTPDYVGK---------------SLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEA  197 (379)
Q Consensus       136 ---~~~~~~~gt~~y~aP---------------SlGvil~~lltg~~Pf~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~~  197 (379)
                         ....+.|||+.||||               |+||++|+|++|++||.+.+..+++.+|.++.+.+|.    .+|+++
T Consensus       186 ~~~~~~~~~~GTp~YmAPEvl~~~~y~~~~DiWSlGvilyeml~G~~PF~~~~~~~~~~~i~~~~~~~p~----~~s~~~  261 (311)
T 4aw0_A          186 SKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEGLIFAKIIKLEYDFPE----KFFPKA  261 (311)
T ss_dssp             TTCCCBCCCCSCGGGCCHHHHHHSCBCHHHHHHHHHHHHHHHHHSSCSSCCSSHHHHHHHHHHTCCCCCT----TCCHHH
T ss_pred             CCcccccCcccCcccCCHHHHcCCCCCcHHHHHHHHHHHHHHHhCCCCCCCCCHHHHHHHHHcCCCCCCc----ccCHHH
Confidence               245678999999999               9999999999999999999999999999999888775    589999


Q ss_pred             HHHHHHhcccCCCCCCCHHH------HhcCccccCCccccc
Q psy6046         198 KDFIAKILIKNPMERMTAKE------ALKHPWLMNKKQIMT  232 (379)
Q Consensus       198 ~~li~~~L~~dP~~Rpt~~e------~l~hp~~~~~~~~~~  232 (379)
                      ++||.+||..||++|||++|      +++||||++.+|...
T Consensus       262 ~dli~~lL~~dp~~R~t~~e~~~~~~i~~Hp~F~~idw~~l  302 (311)
T 4aw0_A          262 RDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENL  302 (311)
T ss_dssp             HHHHHHHSCSSGGGSTTSGGGTCHHHHHTSGGGTTCCCTTG
T ss_pred             HHHHHHHccCCHhHCcChHHHcCCHHHHCCCCcCCCCHHHh
Confidence            99999999999999999987      589999999887654



>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* Back     alignment and structure
>3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} Back     alignment and structure
>3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A Back     alignment and structure
>4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* Back     alignment and structure
>2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 Back     alignment and structure
>3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* Back     alignment and structure
>3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} Back     alignment and structure
>2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 379
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 2e-30
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 3e-29
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-26
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-26
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 1e-25
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 3e-25
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 5e-24
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 2e-22
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-21
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 2e-21
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 4e-21
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 4e-21
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 2e-20
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 5e-20
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 9e-20
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-19
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 6e-19
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 8e-19
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-17
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 2e-17
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-17
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 2e-17
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 8e-17
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-16
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 1e-15
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 1e-15
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-15
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 3e-15
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 5e-15
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 6e-15
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 7e-15
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 7e-15
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 1e-14
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 3e-14
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 4e-14
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 4e-14
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 5e-13
d1fvra_309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 6e-12
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 3e-11
d1xbba_277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 6e-11
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 9e-11
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 9e-11
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 1e-10
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 1e-10
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 2e-10
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 2e-10
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 3e-10
d1mp8a_273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-10
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 4e-10
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 8e-10
d1jpaa_299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 1e-09
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 2e-09
d1ywna1299 d.144.1.7 (A:818-1166) Vascular endothelial growth 3e-09
d1opja_287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 5e-09
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 6e-09
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 2e-08
d1mqba_283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-08
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-08
d1t46a_311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 5e-08
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 8e-08
d1p4oa_308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-07
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 0.001
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Titin, kinase domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  116 bits (292), Expect = 2e-30
 Identities = 56/180 (31%), Positives = 88/180 (48%), Gaps = 19/180 (10%)

Query: 98  MDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEIRELLGTPDYVGK------- 150
            +   F ++P+N++      +  IK+ +F  +R +  G   R L   P+Y          
Sbjct: 121 HNIGHFDIRPENIIYQTR-RSSTIKIIEFGQARQLKPGDNFRLLFTAPEYYAPEVHQHDV 179

Query: 151 --------SLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIA 202
                   SLG   YVLL+G +PF  ET+ +   NI  A+  F +E F++IS EA DF+ 
Sbjct: 180 VSTATDMWSLGTLVYVLLSGINPFLAETNQQIIENIMNAEYTFDEEAFKEISIEAMDFVD 239

Query: 203 KILIKNPMERMTAKEALKHPWLMNKKQIMTRVGCSSCPSIIQNQQNKKNLRKYLSKSREA 262
           ++L+K    RMTA EAL+HPWL   KQ + RV      ++   +     ++K L+    A
Sbjct: 240 RLLVKERKSRMTASEALQHPWL---KQKIERVSTKVIRTLKHRRYYHTLIKKDLNMVVSA 296


>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 100.0
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 100.0
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 100.0
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 100.0
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 100.0
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 100.0
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 100.0
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 100.0
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 100.0
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 100.0
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 100.0
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 100.0
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 100.0
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 100.0
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 100.0
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 100.0
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 100.0
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 100.0
d1s9ja_322 Dual specificity mitogen-activated protein kinase 100.0
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 100.0
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 100.0
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 100.0
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 100.0
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 100.0
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 100.0
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 100.0
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 100.0
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 100.0
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 100.0
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 100.0
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 100.0
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 100.0
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 100.0
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 100.0
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 100.0
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 100.0
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 100.0
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 100.0
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 100.0
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 100.0
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 100.0
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 100.0
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 100.0
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 100.0
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 100.0
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 100.0
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 100.0
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 100.0
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 100.0
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 100.0
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 100.0
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 100.0
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 100.0
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 100.0
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 100.0
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 100.0
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 100.0
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 100.0
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 100.0
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.8
d1nd4a_255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 97.37
d2pula1392 Methylthioribose kinase MtnK {Bacillus subtilis [T 97.25
d1j7la_263 Type IIIa 3',5"-aminoglycoside phosphotransferase 97.23
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 96.08
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.66
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 95.23
d2ppqa1316 Homoserine kinase ThrB {Agrobacterium tumefaciens 95.19
d1zyla1325 RdoA {Escherichia coli [TaxId: 562]} 94.96
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 94.9
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 94.65
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.45
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.21
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 93.93
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 93.78
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 93.42
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 93.3
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 93.2
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 92.52
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 92.08
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 91.65
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 90.4
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 89.28
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 88.99
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 88.44
d1nw1a_395 Choline kinase {Caenorhabditis elegans [TaxId: 623 87.9
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 87.82
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 87.78
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 87.35
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 86.34
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 86.08
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 86.0
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 84.56
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 84.33
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 84.12
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 83.44
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 82.65
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 82.06
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 81.83
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 81.05
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 80.19
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Calmodulin-dependent protein kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=2e-49  Score=369.83  Aligned_cols=214  Identities=29%  Similarity=0.441  Sum_probs=173.2

Q ss_pred             ccCcCCCCceEEEEEEEcCCCcEEEEEEeccc----ccchHHHHHHHHHHhCCCCCcceeeeecCc---ceEEeeC--Cc
Q psy6046           8 SHVGGNRARSSCSRKPEKTTKREVVQWKERNV----SQGVVIVDEEQLLKLIKVEPIEKYYSLDPE---PLLGLNP--RP   78 (379)
Q Consensus         8 ~~~lG~G~fG~V~~a~~~~tg~~~a~~k~~~~----~~~~~~~~E~~il~~l~hpnIv~~~~~~~~---~~~v~e~--~g   78 (379)
                      .++||+|+||+||+|+++.||+.||+ |....    .....+.+|+.+|+.++|||||++++++.+   +|++|||  +|
T Consensus        14 ~~~lG~G~fg~Vy~~~~~~~~~~vAv-K~i~~~~~~~~~~~~~~Ei~il~~l~HpnIv~l~~~~~~~~~~~lvmE~~~gg   92 (307)
T d1a06a_          14 RDVLGTGAFSEVILAEDKRTQKLVAI-KCIAKKALEGKEGSMENEIAVLHKIKHPNIVALDDIYESGGHLYLIMQLVSGG   92 (307)
T ss_dssp             EEESBSGGGGGEEEEEETTTCCEEEE-EEEEC----------CHHHHHHHTCCCTTBCCEEEEEECSSEEEEEECCCCSC
T ss_pred             EEEEeeccCeEEEEEEECCCCCEEEE-EEEchHHhhhHHHHHHHHHHHHHhCCCCCCCcEEEEEEECCEEEEEEeccCCC
Confidence            45899999999999999999999884 54432    223567899999999999999999998775   8999999  78


Q ss_pred             hhhHH--------------------HHHHHHhcccCCCCCCeEeCCCCCCcEEEeecCCCCcEEEeecccceeeccCccc
Q psy6046          79 PVYQA--------------------SATTKAGSVLFPPLMDFIFFFLQPQNLVMMGDFPNCDIKVCDFEISRVILDGIEI  138 (379)
Q Consensus        79 ~l~~~--------------------~al~~lh~~~~~h~~~ivHrDlkp~Nill~~~~~~~~ikl~DFG~a~~~~~~~~~  138 (379)
                      +|++.                    .|+.|||+      +||+||||||+||++.....++.+||+|||+|+........
T Consensus        93 ~L~~~l~~~~~l~e~~~~~~~~qi~~al~ylH~------~~iiHrDiKp~Nil~~~~~~~~~vkl~DFG~a~~~~~~~~~  166 (307)
T d1a06a_          93 ELFDRIVEKGFYTERDASRLIFQVLDAVKYLHD------LGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSVL  166 (307)
T ss_dssp             BHHHHHHTCSCCCHHHHHHHHHHHHHHHHHHHH------TTCCCSCCCGGGEEESSSSTTCCEEECCC------------
T ss_pred             cHHHhhhcccCCCHHHHHHHHHHHHHHHHhhhh------ceeeeEEecccceeecccCCCceEEEeccceeEEccCCCee
Confidence            88887                    77888888      99999999999999976544689999999999887666667


Q ss_pred             cccccCCCCcch---------------HHHHHHHHHhhCCCCCCCCChHHHHHHHHhCCCCCCcccccCCCHHHHHHHHH
Q psy6046         139 RELLGTPDYVGK---------------SLGVTAYVLLTGFSPFGGETDSETFRNISKAQLDFPDELFEDISPEAKDFIAK  203 (379)
Q Consensus       139 ~~~~gt~~y~aP---------------SlGvil~~lltg~~Pf~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~~~~li~~  203 (379)
                      .+.+||+.|+||               |+||++|+|++|++||.+.+..+....+..+...++.+.++.+|+++++||.+
T Consensus       167 ~~~~GT~~y~APE~~~~~~~~~~~DiwSlGvilyell~g~~Pf~~~~~~~~~~~i~~~~~~~~~~~~~~~s~~~~~li~~  246 (307)
T d1a06a_         167 STACGTPGYVAPEVLAQKPYSKAVDCWSIGVIAYILLCGYPPFYDENDAKLFEQILKAEYEFDSPYWDDISDSAKDFIRH  246 (307)
T ss_dssp             ------CTTSCHHHHTTCCCCTHHHHHHHHHHHHHHHHSSCSCCCSSHHHHHHHHHTTCCCCCTTTTTTSCHHHHHHHHH
T ss_pred             eeeeeCccccCcHHHcCCCCCcHHHhhhhhHHHHHHHhCCCCCCCCCHHHHHHHHhccCCCCCCccccCCCHHHHHHHHH
Confidence            778999999999               99999999999999999999999999999998888887788999999999999


Q ss_pred             hcccCCCCCCCHHHHhcCccccCCc
Q psy6046         204 ILIKNPMERMTAKEALKHPWLMNKK  228 (379)
Q Consensus       204 ~L~~dP~~Rpt~~e~l~hp~~~~~~  228 (379)
                      ||..||++|||++|+++||||++..
T Consensus       247 ~L~~dP~~R~s~~eil~hp~~~~~~  271 (307)
T d1a06a_         247 LMEKDPEKRFTCEQALQHPWIAGDT  271 (307)
T ss_dssp             HSCSSGGGSCCHHHHHHSTTTTSSC
T ss_pred             HccCCHhHCcCHHHHhcCHhhCCCC
Confidence            9999999999999999999998643



>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure