Diaphorina citri psyllid: psy606

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210

MPAPMLIQLEREIDREIAADKKKLGFSDNEYYDADLEDDLSDSDDEAQYGPLPQIVTNDLKSLDEMVARRGAKLGMPAPMLIQLEREIDREIAADKKKLGFSDNEYYDADLEDDLSDSDDEAQYGPLPQIVTNDLKSLDEMVRDLVARCTCPTQFPMIRVSEGKYRIGDTKVLIFVRVLRSHVMVRVGGGWDTLSHYLDKHDPCRCKTYI

ccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccEEEEccccEEEccccEEEEEEEcccEEEEEEcccHHHHHHHHHccccccccccc

**APMLIQLEREIDREIAADKKK*G***********************************KSLDEMVARRGAKLGMPAPMLIQLER*******************************************IVTNDLKSLDEMVRDLVARCTCPTQFPMIRVSEGKYRIGDTKVLIFVRVLRSHVMVRVGGGWDTLSHYLDKHDPCRCKTY*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0007050 [BP]	cell cycle arrest	probable	GO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0009267 [BP]	cellular response to starvation	probable	GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0005874 [CC]	microtubule	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0001725 [CC]	stress fiber	probable	GO:0032432, GO:0005856, GO:0043228, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043226, GO:0044422, GO:0042641
GO:0046966 [MF]	thyroid hormone receptor binding	probable	GO:0008134, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0010629 [BP]	negative regulation of gene expression	probable	GO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0008093 [MF]	cytoskeletal adaptor activity	probable	GO:0030674, GO:0008092, GO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0097067 [BP]	cellular response to thyroid hormone stimulus	probable	GO:0071495, GO:0009719, GO:0051716, GO:0097066, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0008150, GO:0032870, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0045647 [BP]	negative regulation of erythrocyte differentiation	probable	GO:0051093, GO:0050793, GO:0045646, GO:0045595, GO:0032844, GO:0050789, GO:0045596, GO:0045638, GO:0065007, GO:0002682, GO:0008150, GO:0051239, GO:0048519, GO:2000026, GO:0050794, GO:0045637, GO:0048523
GO:0008017 [MF]	microtubule binding	probable	GO:0015631, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0030308 [BP]	negative regulation of cell growth	probable	GO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V5R, chain A
Confidence level:very confident
Coverage over the Query: 132-209
View the alignment between query and template
View the model in PyMOL