Query         psy6104
Match_columns 118
No_of_seqs    41 out of 43
Neff          3.3 
Searched_HMMs 46136
Date          Fri Aug 16 17:41:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6104.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6104hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1420|consensus              100.0 5.7E-35 1.2E-39  262.5   6.3  113    5-118    17-133 (1103)
  2 PF07204 Orthoreo_P10:  Orthore  76.3     2.1 4.5E-05   31.5   2.1   28   33-66     41-69  (98)
  3 PRK04960 universal stress prot  72.9     7.2 0.00016   29.2   4.2   17   24-42     80-96  (111)
  4 PF12606 RELT:  Tumour necrosis  63.6     9.6 0.00021   24.7   2.9   23   35-58      3-25  (50)
  5 PF14898 DUF4491:  Domain of un  59.5     9.1  0.0002   27.9   2.5   22   29-50     31-52  (94)
  6 MTH00180 ND4L NADH dehydrogena  59.0      13 0.00029   26.0   3.2   24   32-55      1-24  (99)
  7 PF11947 DUF3464:  Protein of u  54.4      13 0.00028   28.8   2.7   18   34-51     97-114 (153)
  8 PF11151 DUF2929:  Protein of u  54.2      13 0.00028   24.2   2.3   18   32-49      7-24  (57)
  9 MTH00015 ND6 NADH dehydrogenas  42.1      34 0.00074   25.5   3.3   23   33-57     48-70  (155)
 10 PF10779 XhlA:  Haemolysin XhlA  38.1      42 0.00092   22.0   2.9   21   30-50     50-70  (71)
 11 MTH00001 ND4L NADH dehydrogena  37.3      49  0.0011   23.1   3.3   23   33-55      2-24  (99)
 12 PF11255 DUF3054:  Protein of u  36.8      38 0.00082   24.6   2.7   22   34-58     90-111 (112)
 13 COG1786 Swiveling domain assoc  36.7      18 0.00039   27.8   1.0   13  104-116    44-56  (131)
 14 TIGR03715 KxYKxGKxW KxYKxGKxW   35.7      42 0.00092   18.8   2.3   17   32-48     11-27  (29)
 15 MTH00166 ND6 NADH dehydrogenas  35.6      50  0.0011   24.6   3.3   22   33-56     47-68  (160)
 16 PF06678 DUF1179:  Protein of u  34.0      84  0.0018   23.3   4.1   27   35-65      5-31  (103)
 17 KOG1278|consensus               32.2      11 0.00024   35.2  -0.9   31   28-58    260-292 (628)
 18 PF13962 PGG:  Domain of unknow  30.6      72  0.0016   22.2   3.2   24   32-55     51-74  (113)
 19 PF03729 DUF308:  Short repeat   30.5      61  0.0013   19.6   2.6   22   30-51     50-71  (72)
 20 PF04120 Iron_permease:  Low af  29.5      61  0.0013   24.5   2.9   26   33-58      7-32  (132)
 21 KOG3188|consensus               29.3      51  0.0011   27.6   2.6   24   31-54     11-34  (246)
 22 PF01989 DUF126:  Protein of un  28.3      31 0.00067   24.1   1.0   13  104-116    22-34  (82)
 23 PF07243 Phlebovirus_G1:  Phleb  28.0      90   0.002   28.8   4.1   26   34-59    421-446 (526)
 24 MTH00212 ND6 NADH dehydrogenas  27.8      80  0.0017   23.9   3.3   23   33-57     48-70  (160)
 25 KOG4482|consensus               27.4 1.1E+02  0.0024   27.7   4.5   31   39-69    296-328 (449)
 26 MTH00152 ND6 NADH dehydrogenas  25.8      91   0.002   23.4   3.3   22   33-56     48-69  (163)
 27 PF15159 PIG-Y:  Phosphatidylin  25.7   1E+02  0.0022   21.1   3.2   21   34-54      4-24  (72)
 28 PF11188 DUF2975:  Protein of u  25.5 1.2E+02  0.0027   20.6   3.7   25   34-58     99-123 (136)
 29 PF11807 DUF3328:  Domain of un  24.5 1.4E+02   0.003   21.4   3.9   28   31-58      8-35  (217)
 30 cd01356 AcnX_swivel Putative A  22.9      44 0.00096   25.0   1.1   13  104-116    37-49  (123)
 31 PF05510 Sarcoglycan_2:  Sarcog  22.7      88  0.0019   27.6   3.0   29   39-67    284-314 (386)
 32 TIGR03017 EpsF chain length de  22.6 1.2E+02  0.0026   25.3   3.6   22   31-52     12-33  (444)
 33 PF07589 VPEP:  PEP-CTERM motif  22.2 1.4E+02   0.003   16.5   2.7   15   39-53      6-20  (25)
 34 PF12729 4HB_MCP_1:  Four helix  22.2 2.5E+02  0.0055   18.8   4.9   31   28-58      4-34  (181)
 35 PF13334 DUF4094:  Domain of un  22.1      98  0.0021   21.9   2.6   11   40-50      9-19  (95)
 36 PF05151 PsbM:  Photosystem II   21.7 1.9E+02  0.0041   17.3   3.4   21   34-54      6-26  (31)
 37 KOG1500|consensus               21.5      47   0.001   30.1   1.1   12  105-116   423-434 (517)
 38 TIGR02848 spore_III_AC stage I  21.5   1E+02  0.0022   21.1   2.5   15   42-56     34-48  (64)
 39 PTZ00443 Thioredoxin domain-co  21.2 2.1E+02  0.0047   22.8   4.7   23   34-56    177-199 (224)
 40 PF10805 DUF2730:  Protein of u  21.1 1.3E+02  0.0028   21.3   3.1   27   30-57      5-31  (106)
 41 PF09301 DUF1970:  Domain of un  20.3      88  0.0019   23.2   2.2   14   45-58     11-24  (117)
 42 PF04689 S1FA:  DNA binding pro  20.3 1.3E+02  0.0028   21.0   2.8   17   37-53     20-36  (69)
 43 PF05767 Pox_A14:  Poxvirus vir  20.3 2.1E+02  0.0046   20.8   4.1   26   39-64     47-74  (92)
 44 PF00858 ASC:  Amiloride-sensit  20.2 1.7E+02  0.0037   23.4   3.9   30   29-58     21-50  (439)

No 1  
>KOG1420|consensus
Probab=100.00  E-value=5.7e-35  Score=262.47  Aligned_cols=113  Identities=39%  Similarity=0.584  Sum_probs=96.5

Q ss_pred             cccccccccc-eeeeccCCc---hhhHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhccCCCCCCCCchhhhHHH
Q psy6104           5 CCVLCKPTES-ILISTATSD---IDICLQERKWWCFLLSSIFTFILGLVIVLLWRLFAFICCRKEPELSPNDPKQKEQKA   80 (118)
Q Consensus         5 ~~~~~~~~~~-~~~~~~~~~---~~~C~~~R~~waFLlSSivTF~gGLliIliwR~i~~~cc~k~~~~~~~~~~~~~~~~   80 (118)
                      -+++|+.+.+ ....+++++   ...|++.|||||||+||+|||||||||||+||.++|+||++.+...++.++|+.++.
T Consensus        17 ~~s~~~~ss~~s~~~ep~~~~~~~~~~m~vr~~w~fl~ss~~tf~~gl~iillwr~~~~~~~~~~~~~g~~~~~qk~~~~   96 (1103)
T KOG1420|consen   17 SSSSSSSSSSSSSVHEPKMDALIIPVTMEVRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQKINNG   96 (1103)
T ss_pred             CCCCCCcccccccccCCccCcccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHheeeeccCCCCCcHhhhhhcc
Confidence            3556655432 233444444   679999999999999999999999999999999999999999988888888888877


Q ss_pred             HhccccceeeeehhhhhhHHHhHhhhccccceEEEEeC
Q psy6104          81 IRQGKQEFEGTFMTEAKDWAGELISGQTTTGRILVPNV  118 (118)
Q Consensus        81 ~~~~~~~~evgwmt~~KDwag~LISaQT~tGRILVVLV  118 (118)
                      +.|.. +.|+||||++|||||+||||||+|||||||||
T Consensus        97 s~~~~-~~e~~~mt~akdwagelisgqtltgr~lvvlv  133 (1103)
T KOG1420|consen   97 SSQAD-AAEVGWMTSAKDWAGELISGQTLTGRVLVVLV  133 (1103)
T ss_pred             cchhh-hhhheeeEEehhhhcceeecccccceeeehhH
Confidence            76654 69999999999999999999999999999997


No 2  
>PF07204 Orthoreo_P10:  Orthoreovirus membrane fusion protein p10;  InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction [].
Probab=76.32  E-value=2.1  Score=31.48  Aligned_cols=28  Identities=32%  Similarity=0.878  Sum_probs=19.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHhhhhc-cCC
Q psy6104          33 WWCFLLSSIFTFILGLVIVLLWRLFAFICCR-KEP   66 (118)
Q Consensus        33 ~waFLlSSivTF~gGLliIliwR~i~~~cc~-k~~   66 (118)
                      ||.+|+.-     ||+++|+|. +.-..||+ |+|
T Consensus        41 yWpyLA~G-----GG~iLilIi-i~Lv~CC~~K~K   69 (98)
T PF07204_consen   41 YWPYLAAG-----GGLILILII-IALVCCCRAKHK   69 (98)
T ss_pred             hhHHhhcc-----chhhhHHHH-HHHHHHhhhhhh
Confidence            79998876     888888888 44445555 554


No 3  
>PRK04960 universal stress protein UspB; Provisional
Probab=72.87  E-value=7.2  Score=29.24  Aligned_cols=17  Identities=35%  Similarity=0.647  Sum_probs=14.1

Q ss_pred             hhhHHhHHHHHHHHHHHHH
Q psy6104          24 IDICLQERKWWCFLLSSIF   42 (118)
Q Consensus        24 ~~~C~~~R~~waFLlSSiv   42 (118)
                      .++|+..|++  |+|||-.
T Consensus        80 i~kCervR~~--FiL~s~L   96 (111)
T PRK04960         80 IRRCERVRRQ--FILTSAL   96 (111)
T ss_pred             HHHHHHHHHH--HHHHHHH
Confidence            7899888886  8888865


No 4  
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=63.59  E-value=9.6  Score=24.65  Aligned_cols=23  Identities=30%  Similarity=0.622  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          35 CFLLSSIFTFILGLVIVLLWRLFA   58 (118)
Q Consensus        35 aFLlSSivTF~gGLliIliwR~i~   58 (118)
                      +|++=|++ |..|++.++++-+.+
T Consensus         3 ~~~iV~i~-iv~~lLg~~I~~~~K   25 (50)
T PF12606_consen    3 AFLIVSIF-IVMGLLGLSICTTLK   25 (50)
T ss_pred             ehHHHHHH-HHHHHHHHHHHHHhh
Confidence            45665554 778899999998874


No 5  
>PF14898 DUF4491:  Domain of unknown function (DUF4491)
Probab=59.54  E-value=9.1  Score=27.88  Aligned_cols=22  Identities=36%  Similarity=0.587  Sum_probs=18.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHH
Q psy6104          29 QERKWWCFLLSSIFTFILGLVI   50 (118)
Q Consensus        29 ~~R~~waFLlSSivTF~gGLli   50 (118)
                      ++|.||.||+..++.-.++|++
T Consensus        31 g~~~W~~FL~~Gi~~~~~Sl~~   52 (94)
T PF14898_consen   31 GTRIWPIFLLAGIACIIASLFV   52 (94)
T ss_pred             CCCcHHHHHHHHHHHHHHHHHH
Confidence            6799999999999887777765


No 6  
>MTH00180 ND4L NADH dehydrogenase subunit 4L; Provisional
Probab=59.03  E-value=13  Score=25.97  Aligned_cols=24  Identities=33%  Similarity=0.631  Sum_probs=21.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          32 KWWCFLLSSIFTFILGLVIVLLWR   55 (118)
Q Consensus        32 ~~waFLlSSivTF~gGLliIliwR   55 (118)
                      +|+.|+.-+...|+.|++-++..|
T Consensus         1 ~~~~~l~~~~~lf~~gl~~~~~~r   24 (99)
T MTH00180          1 MYYEYLTVGIILFILGVLGIVLNR   24 (99)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHH
Confidence            478899999999999999998855


No 7  
>PF11947 DUF3464:  Protein of unknown function (DUF3464);  InterPro: IPR021855  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 137 to 196 amino acids in length. 
Probab=54.40  E-value=13  Score=28.84  Aligned_cols=18  Identities=44%  Similarity=0.781  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q psy6104          34 WCFLLSSIFTFILGLVIV   51 (118)
Q Consensus        34 waFLlSSivTF~gGLliI   51 (118)
                      |+.++.|+++|..||+=|
T Consensus        97 ~~~~~~S~~~Fg~gllGi  114 (153)
T PF11947_consen   97 WAVLLVSLVFFGLGLLGI  114 (153)
T ss_pred             hHHHHHHHHHHHHHHHhh
Confidence            889999999999998753


No 8  
>PF11151 DUF2929:  Protein of unknown function (DUF2929);  InterPro: IPR021324  This family of proteins with unknown function appears to be restricted to Firmicutes. 
Probab=54.18  E-value=13  Score=24.19  Aligned_cols=18  Identities=22%  Similarity=0.665  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q psy6104          32 KWWCFLLSSIFTFILGLV   49 (118)
Q Consensus        32 ~~waFLlSSivTF~gGLl   49 (118)
                      .-|+||++-++.|.+|=+
T Consensus         7 ~fWs~il~~vvgyI~ssL   24 (57)
T PF11151_consen    7 FFWSFILGEVVGYIGSSL   24 (57)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            359999999999988743


No 9  
>MTH00015 ND6 NADH dehydrogenase subunit 6; Validated
Probab=42.07  E-value=34  Score=25.53  Aligned_cols=23  Identities=22%  Similarity=0.775  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          33 WWCFLLSSIFTFILGLVIVLLWRLF   57 (118)
Q Consensus        33 ~waFLlSSivTF~gGLliIliwR~i   57 (118)
                      |+.|++  +..|.|||++++++=.-
T Consensus        48 W~syil--fLI~iGGmLVlF~Y~~s   70 (155)
T MTH00015         48 WFAFLT--FLIYVGGMLVMFAYFLA   70 (155)
T ss_pred             HHHHHH--HHHHHhHHHHHHHHHHH
Confidence            888887  68899999999886443


No 10 
>PF10779 XhlA:  Haemolysin XhlA;  InterPro: IPR019715 Haemolysin XhlA is a cell-surface associated haemolysin that lyses the two most prevalent types of insect immune cells (granulocytes and plasmatocytes) as well as rabbit and horse erythrocytes []. 
Probab=38.06  E-value=42  Score=22.02  Aligned_cols=21  Identities=29%  Similarity=0.529  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q psy6104          30 ERKWWCFLLSSIFTFILGLVI   50 (118)
Q Consensus        30 ~R~~waFLlSSivTF~gGLli   50 (118)
                      +.-.|-++.+.+++|++++++
T Consensus        50 ~kW~~r~iiGaiI~~i~~~i~   70 (71)
T PF10779_consen   50 TKWIWRTIIGAIITAIIYLII   70 (71)
T ss_pred             HHHHHHHHHHHHHHHHHHHHh
Confidence            444578999999999988874


No 11 
>MTH00001 ND4L NADH dehydrogenase subunit 4L; Provisional
Probab=37.33  E-value=49  Score=23.13  Aligned_cols=23  Identities=26%  Similarity=0.639  Sum_probs=18.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          33 WWCFLLSSIFTFILGLVIVLLWR   55 (118)
Q Consensus        33 ~waFLlSSivTF~gGLliIliwR   55 (118)
                      |+.|+.-+++-|+.|++-++..|
T Consensus         2 ~~~~l~~~~~lf~~gl~g~~~~r   24 (99)
T MTH00001          2 YYKYLILVVILFLLGIWGIILNR   24 (99)
T ss_pred             cHHHHHHHHHHHHHHHHHHHHHH
Confidence            56777778889999999888865


No 12 
>PF11255 DUF3054:  Protein of unknown function (DUF3054);  InterPro: IPR021414  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=36.75  E-value=38  Score=24.63  Aligned_cols=22  Identities=32%  Similarity=0.862  Sum_probs=18.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          34 WCFLLSSIFTFILGLVIVLLWRLFA   58 (118)
Q Consensus        34 waFLlSSivTF~gGLliIliwR~i~   58 (118)
                      |.|++   |++..++++++-||.+.
T Consensus        90 ~~Fii---Va~~~~~vlL~gWR~~~  111 (112)
T PF11255_consen   90 WSFII---VALVFLAVLLLGWRAVA  111 (112)
T ss_pred             cchHH---HHHHHHHHHHHHHHHHh
Confidence            66776   99999999999999874


No 13 
>COG1786 Swiveling domain associated with predicted aconitase [Energy    production and conversion]
Probab=36.75  E-value=18  Score=27.82  Aligned_cols=13  Identities=46%  Similarity=0.782  Sum_probs=11.6

Q ss_pred             hhhccccceEEEE
Q psy6104         104 ISGQTTTGRILVP  116 (118)
Q Consensus       104 ISaQT~tGRILVV  116 (118)
                      +.||.++|||||.
T Consensus        44 l~G~~l~Gkilv~   56 (131)
T COG1786          44 LHGESLTGKILVF   56 (131)
T ss_pred             cccccccceEEEe
Confidence            6799999999985


No 14 
>TIGR03715 KxYKxGKxW KxYKxGKxW signal peptide. This model describes a novel form of signal peptide that occurs as an N-terminal domain with a recognizable motif, reminiscent of the YSIRK and PEP-CTERM forms of signal peptide. This domain tends to occur on long, low-complexity (usually Serine-rich and heavily glycosylated) proteins of the Firmicutes, and (as with YSIRK) the majority of these proteins have the LPXTG cell wall-anchoring motif at the C-terminus.
Probab=35.69  E-value=42  Score=18.79  Aligned_cols=17  Identities=24%  Similarity=0.456  Sum_probs=13.6

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy6104          32 KWWCFLLSSIFTFILGL   48 (118)
Q Consensus        32 ~~waFLlSSivTF~gGL   48 (118)
                      |.|+|...+.++++++.
T Consensus        11 K~Wv~a~~~~~~l~~~~   27 (29)
T TIGR03715        11 KQWVFAAITTLALAGGA   27 (29)
T ss_pred             cHHHHHHHHHHHHHHhc
Confidence            67999988888877764


No 15 
>MTH00166 ND6 NADH dehydrogenase subunit 6; Provisional
Probab=35.63  E-value=50  Score=24.60  Aligned_cols=22  Identities=18%  Similarity=0.892  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          33 WWCFLLSSIFTFILGLVIVLLWRL   56 (118)
Q Consensus        33 ~waFLlSSivTF~gGLliIliwR~   56 (118)
                      |+.|++  +..|.||+++++++=.
T Consensus        47 W~syiL--fLI~iGGmlVlF~Y~~   68 (160)
T MTH00166         47 WFSYIL--FLIFLGGMLVLFIYIT   68 (160)
T ss_pred             HHHHHH--HHHHHhHHHHHHHHHH
Confidence            666665  6789999999887543


No 16 
>PF06678 DUF1179:  Protein of unknown function (DUF1179);  InterPro: IPR009564 This family consists of several hypothetical Caenorhabditis elegans proteins of around 106 residues in length. The function of the family is unknown.
Probab=33.97  E-value=84  Score=23.32  Aligned_cols=27  Identities=33%  Similarity=0.668  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhhccC
Q psy6104          35 CFLLSSIFTFILGLVIVLLWRLFAFICCRKE   65 (118)
Q Consensus        35 aFLlSSivTF~gGLliIliwR~i~~~cc~k~   65 (118)
                      .||+.+|+-  .|++++|+.-++  .|.+|.
T Consensus         5 ~~i~~~i~l--~g~~lll~~~iv--~C~sKK   31 (103)
T PF06678_consen    5 WFILKSIFL--FGPFLLLIVSIV--QCQSKK   31 (103)
T ss_pred             HHHHHHHHH--hhHHHHHHHHHH--Hhhhcc
Confidence            588888765  788888888887  566653


No 17 
>KOG1278|consensus
Probab=32.17  E-value=11  Score=35.20  Aligned_cols=31  Identities=23%  Similarity=0.499  Sum_probs=26.4

Q ss_pred             HhHHHHHHHHHHH--HHHHHHHHHHHHHHHHHH
Q psy6104          28 LQERKWWCFLLSS--IFTFILGLVIVLLWRLFA   58 (118)
Q Consensus        28 ~~~R~~waFLlSS--ivTF~gGLliIliwR~i~   58 (118)
                      .+..++|-.|+-|  +|+|+.|++.+.+.|.++
T Consensus       260 ~~~qIhWfSIiNSlvIVlfLSgiv~mI~lRtl~  292 (628)
T KOG1278|consen  260 EDVQIHWFSIINSLVIVLFLSGIVAMIMLRTLY  292 (628)
T ss_pred             CCCceEEEehhhhHHHHHHHHHHHHHHHHHHHH
Confidence            3567889999877  578999999999999996


No 18 
>PF13962 PGG:  Domain of unknown function
Probab=30.62  E-value=72  Score=22.16  Aligned_cols=24  Identities=25%  Similarity=0.469  Sum_probs=21.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          32 KWWCFLLSSIFTFILGLVIVLLWR   55 (118)
Q Consensus        32 ~~waFLlSSivTF~gGLliIliwR   55 (118)
                      .+++|+.+.-+.|+.++..+++.-
T Consensus        51 ~f~~F~~~nt~af~~S~~~i~~l~   74 (113)
T PF13962_consen   51 AFKAFLISNTIAFFSSLAAIFLLI   74 (113)
T ss_pred             hhhhHHHHHHHHHHHHHHHHHHHH
Confidence            789999999999999999888765


No 19 
>PF03729 DUF308:  Short repeat of unknown function (DUF308);  InterPro: IPR005325 This represents a group of short repeats that occurs in a limited number of membrane proteins. It may divide further in short repeats of around 7-10 residues of the pattern G-#-X(2)-#(2)-X (#=hydrophobic).
Probab=30.54  E-value=61  Score=19.63  Aligned_cols=22  Identities=36%  Similarity=1.055  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q psy6104          30 ERKWWCFLLSSIFTFILGLVIV   51 (118)
Q Consensus        30 ~R~~waFLlSSivTF~gGLliI   51 (118)
                      .+.||-.++++++....|.+++
T Consensus        50 ~~~~~~~l~~gi~~i~~Gi~~l   71 (72)
T PF03729_consen   50 SKGWWWSLLSGILSIVLGIILL   71 (72)
T ss_pred             chhhHHHHHHHHHHHHHHHHHH
Confidence            4577888999999999998875


No 20 
>PF04120 Iron_permease:  Low affinity iron permease ;  InterPro: IPR007251  Although originally identified as a low-affinity iron(II) permease [, ], Fet4 has since been shown to import several other transition metal ions, including copper [, ] and zinc []. Copper, cobalt, and cadmium inhibit Fet4 [, ]. Fet4 is an integral protein of the plasma membrane [, ]. FET4 is not essential, not even in fet3 fet4 double mutants []. Over expression of FET4 improves growth under alkaline conditions [].   Transcription of FET4 is induced by Aft1 in response to low levels of iron [, , ] or by Zap1 in response to low zinc [, ], but not in response to low copper []. When the high-affinity iron permease component Fet3 is deleted, FET4 is induced by the addition of copper, zinc, cobalt, or manganese []. It is also induced under anaerobic conditions [, , ] and repressed by Rox1 in aerobic conditions [, ]. Rox1 attenuates the activation of FET4 by Aft1 or Zap1 []. ; GO: 0055085 transmembrane transport
Probab=29.51  E-value=61  Score=24.50  Aligned_cols=26  Identities=15%  Similarity=0.680  Sum_probs=21.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          33 WWCFLLSSIFTFILGLVIVLLWRLFA   58 (118)
Q Consensus        33 ~waFLlSSivTF~gGLliIliwR~i~   58 (118)
                      +.+=.+||..+|..++++|+.|=+..
T Consensus         7 ~is~~~gs~~~f~~~~~~Ii~W~i~G   32 (132)
T PF04120_consen    7 WISDVAGSPWAFVIAVAVIIVWAISG   32 (132)
T ss_pred             HHHHHHCCHHHHHHHHHHHHHHHHHh
Confidence            34567799999999999999998874


No 21 
>KOG3188|consensus
Probab=29.26  E-value=51  Score=27.64  Aligned_cols=24  Identities=21%  Similarity=0.568  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          31 RKWWCFLLSSIFTFILGLVIVLLW   54 (118)
Q Consensus        31 R~~waFLlSSivTF~gGLliIliw   54 (118)
                      =++|.||=-|+|||+.|.+==.+-
T Consensus        11 iR~WVlLPI~ivm~liGilRhyvs   34 (246)
T KOG3188|consen   11 IRYWVLLPIVIVMFLIGILRHYVS   34 (246)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHHHH
Confidence            357999999999999998744433


No 22 
>PF01989 DUF126:  Protein of unknown function DUF126;  InterPro: IPR002840 These archaebacterial proteins have no known function.; PDB: 2HI6_A.
Probab=28.30  E-value=31  Score=24.09  Aligned_cols=13  Identities=46%  Similarity=0.787  Sum_probs=9.4

Q ss_pred             hhhccccceEEEE
Q psy6104         104 ISGQTTTGRILVP  116 (118)
Q Consensus       104 ISaQT~tGRILVV  116 (118)
                      +.||...|||||.
T Consensus        22 l~G~si~gkILv~   34 (82)
T PF01989_consen   22 LEGQSIAGKILVF   34 (82)
T ss_dssp             STT-B-TTSEEEE
T ss_pred             cCCCcccCeEEEe
Confidence            4799999999985


No 23 
>PF07243 Phlebovirus_G1:  Phlebovirus glycoprotein G1;  InterPro: IPR010826 This domain is found in several Phlebovirus glycoprotein G1 sequences. Members of the Bunyaviridae family acquire an envelope by budding through the lipid bilayer of the Golgi complex. The budding compartment is thought to be determined by the accumulation of the two heterodimeric membrane glycoproteins G1 and G2 in the Golgi [].; GO: 0016021 integral to membrane, 0019012 virion
Probab=27.99  E-value=90  Score=28.78  Aligned_cols=26  Identities=15%  Similarity=0.440  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHh
Q psy6104          34 WCFLLSSIFTFILGLVIVLLWRLFAF   59 (118)
Q Consensus        34 waFLlSSivTF~gGLliIliwR~i~~   59 (118)
                      =||++|.++.-+.=|++.+|+|++.+
T Consensus       421 SAlvVStliss~iylil~IL~K~L~~  446 (526)
T PF07243_consen  421 SALVVSTLISSLIYLILSILSKVLYF  446 (526)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35666666666666667777777743


No 24 
>MTH00212 ND6 NADH dehydrogenase subunit 6; Provisional
Probab=27.83  E-value=80  Score=23.90  Aligned_cols=23  Identities=22%  Similarity=0.755  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          33 WWCFLLSSIFTFILGLVIVLLWRLF   57 (118)
Q Consensus        33 ~waFLlSSivTF~gGLliIliwR~i   57 (118)
                      |+.|++  +..|.||+++++++=.-
T Consensus        48 w~s~il--fli~iGGmlVlF~Y~~s   70 (160)
T MTH00212         48 WYGYIL--FLIYIGGLLVLFGYMVA   70 (160)
T ss_pred             HHHHHH--HHHHHhHHHHHHHHHHH
Confidence            666666  67899999999876443


No 25 
>KOG4482|consensus
Probab=27.41  E-value=1.1e+02  Score=27.72  Aligned_cols=31  Identities=35%  Similarity=0.697  Sum_probs=16.0

Q ss_pred             HHHHHHHHHH-HHHHHHHHHHh-hhhccCCCCC
Q psy6104          39 SSIFTFILGL-VIVLLWRLFAF-ICCRKEPELS   69 (118)
Q Consensus        39 SSivTF~gGL-liIliwR~i~~-~cc~k~~~~~   69 (118)
                      =+.+||..=+ +.+|+.-++.| +||++|...+
T Consensus       296 df~~tfaIpl~Valll~~~La~imc~rrEg~~~  328 (449)
T KOG4482|consen  296 DFLHTFAIPLGVALLLVLALAYIMCCRREGQKK  328 (449)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhhhhcccc
Confidence            3445665422 22333334455 5999876544


No 26 
>MTH00152 ND6 NADH dehydrogenase subunit 6; Provisional
Probab=25.84  E-value=91  Score=23.44  Aligned_cols=22  Identities=23%  Similarity=0.878  Sum_probs=17.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          33 WWCFLLSSIFTFILGLVIVLLWRL   56 (118)
Q Consensus        33 ~waFLlSSivTF~gGLliIliwR~   56 (118)
                      |+.|++  +..|.||+++++++=.
T Consensus        48 w~s~il--fli~iGGmlVlF~Y~~   69 (163)
T MTH00152         48 WYGYLL--FLVYVGGLLVMFAYVV   69 (163)
T ss_pred             HHHHHH--HHHHHhHHHHHHHHHH
Confidence            777765  6789999999987543


No 27 
>PF15159 PIG-Y:  Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y
Probab=25.72  E-value=1e+02  Score=21.13  Aligned_cols=21  Identities=14%  Similarity=0.352  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q psy6104          34 WCFLLSSIFTFILGLVIVLLW   54 (118)
Q Consensus        34 waFLlSSivTF~gGLliIliw   54 (118)
                      |++++.+.++|.+++..++.-
T Consensus         4 ~~~il~~~v~fv~~~y~~v~s   24 (72)
T PF15159_consen    4 WLLILFTLVFFVGFFYAAVFS   24 (72)
T ss_pred             hHHHHHHHHHHHHHHHHHHHc
Confidence            788999999999988877543


No 28 
>PF11188 DUF2975:  Protein of unknown function (DUF2975);  InterPro: IPR021354  This family of proteins have no known function. Some members are annotated as membrane proteins however this cannot be confirmed. 
Probab=25.50  E-value=1.2e+02  Score=20.60  Aligned_cols=25  Identities=28%  Similarity=0.502  Sum_probs=20.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          34 WCFLLSSIFTFILGLVIVLLWRLFA   58 (118)
Q Consensus        34 waFLlSSivTF~gGLliIliwR~i~   58 (118)
                      ..+...++..++.|++++++-++++
T Consensus        99 ~~~~~~~~~~~~~gl~~~vla~if~  123 (136)
T PF11188_consen   99 IFFSGFDFLLLIIGLIILVLAEIFK  123 (136)
T ss_pred             HhhhHHHHHHHHHHHHHHHHHHHHH
Confidence            5566677788888899999999886


No 29 
>PF11807 DUF3328:  Domain of unknown function (DUF3328);  InterPro: IPR021765  This family of proteins are functionally uncharacterised. This family is only found in eukaryotes. 
Probab=24.48  E-value=1.4e+02  Score=21.42  Aligned_cols=28  Identities=32%  Similarity=0.629  Sum_probs=17.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          31 RKWWCFLLSSIFTFILGLVIVLLWRLFA   58 (118)
Q Consensus        31 R~~waFLlSSivTF~gGLliIliwR~i~   58 (118)
                      |.|.-.++.+++.++.+++++++++.+.
T Consensus         8 ~~w~~~~~~~~~~l~~~l~~~~~~~~~~   35 (217)
T PF11807_consen    8 RRWRRLLLLFLLLLILSLLLLVLAVLLR   35 (217)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3444445666666666777777776663


No 30 
>cd01356 AcnX_swivel Putative Aconitase X swivel domain. It is predicted by comparative genomic analysis. The proteins are mainly found in archaea and proteobacteria. They are distantly related to Aconitase family of proteins by sequence similarity and seconary structure prediction. The functions have not yet been experimentally characterized. Thus, the prediction should be treated with caution.
Probab=22.90  E-value=44  Score=24.96  Aligned_cols=13  Identities=31%  Similarity=0.723  Sum_probs=11.7

Q ss_pred             hhhccccceEEEE
Q psy6104         104 ISGQTTTGRILVP  116 (118)
Q Consensus       104 ISaQT~tGRILVV  116 (118)
                      +.||+..|||||.
T Consensus        37 l~G~si~gkILv~   49 (123)
T cd01356          37 LYGESIAGKVLVL   49 (123)
T ss_pred             cCCCcccceEEEe
Confidence            6899999999985


No 31 
>PF05510 Sarcoglycan_2:  Sarcoglycan alpha/epsilon;  InterPro: IPR008908 Sarcoglycans are a subcomplex of transmembrane proteins which are part of the dystrophin-glycoprotein complex. They are expressed in the skeletal, cardiac and smooth muscle. Although numerous studies have been conducted on the sarcoglycan subcomplex in skeletal and cardiac muscle, the manner of the distribution and localisation of these proteins along the nonjunctional sarcolemma is not clear []. This family contains alpha and epsilon members.; GO: 0016012 sarcoglycan complex
Probab=22.73  E-value=88  Score=27.62  Aligned_cols=29  Identities=34%  Similarity=0.789  Sum_probs=15.9

Q ss_pred             HHHHHHHHHHHH-HHHHHHHHh-hhhccCCC
Q psy6104          39 SSIFTFILGLVI-VLLWRLFAF-ICCRKEPE   67 (118)
Q Consensus        39 SSivTF~gGLli-IliwR~i~~-~cc~k~~~   67 (118)
                      -.++||+.=++| +++.=++.| +|||+|..
T Consensus       284 d~~vtl~iPl~i~llL~llLs~Imc~rREG~  314 (386)
T PF05510_consen  284 DFLVTLAIPLIIALLLLLLLSYIMCCRREGV  314 (386)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHheechHHh
Confidence            345555543333 444445566 59998654


No 32 
>TIGR03017 EpsF chain length determinant protein EpsF. Sequences in this family of proteins are members of the chain length determinant family (pfam02706) which includes the wzc protein from E.coli. This family of proteins are homologous to the EpsF protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.
Probab=22.62  E-value=1.2e+02  Score=25.26  Aligned_cols=22  Identities=23%  Similarity=0.554  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q psy6104          31 RKWWCFLLSSIFTFILGLVIVL   52 (118)
Q Consensus        31 R~~waFLlSSivTF~gGLliIl   52 (118)
                      |.||.+++..+++|.+|++..+
T Consensus        12 rr~~lil~v~~~~~~~~~~~~~   33 (444)
T TIGR03017        12 ARYWIVLFTLLITVTTTAVVSL   33 (444)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            5566677777777777766554


No 33 
>PF07589 VPEP:  PEP-CTERM motif;  InterPro: IPR013424  This entry describes a 25-residue region including an invariant Pro-Glu-Pro (PEP) motif, a thirteen residue strongly hydrophobic sequence likely to span the membrane, and a five-residue strongly basic motif that often contains four Arg residues. In most cases, this motif is found within nine residues of the C-terminal end of the protein. Proteins containing this motif typically have signal sequences at the N terminus [].
Probab=22.21  E-value=1.4e+02  Score=16.47  Aligned_cols=15  Identities=27%  Similarity=0.332  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHHH
Q psy6104          39 SSIFTFILGLVIVLL   53 (118)
Q Consensus        39 SSivTF~gGLliIli   53 (118)
                      ||+.-|..|++.+..
T Consensus         6 st~~l~~~gl~~l~~   20 (25)
T PF07589_consen    6 STLALLGLGLLGLAF   20 (25)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            566777777666665


No 34 
>PF12729 4HB_MCP_1:  Four helix bundle sensory module for signal transduction;  InterPro: IPR024478 This entry represents a four-helix bundle that operates as a ubiquitous sensory module in prokaryotic signal-transduction, which is known as four-helix bundles methyl-accepting chemotaxis protein (4HB_MCP) domain. The 4HB_MCP is always found between two predicted transmembrane helices indicating that it detects only extracellular signals. In many cases the domain is associated with a cytoplasmic HAMP domain suggesting that most proteins carrying the bundle might share the mechanism of transmembrane signalling which is well-characterised in E coli chemoreceptors [].
Probab=22.20  E-value=2.5e+02  Score=18.78  Aligned_cols=31  Identities=16%  Similarity=0.225  Sum_probs=24.4

Q ss_pred             HhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          28 LQERKWWCFLLSSIFTFILGLVIVLLWRLFA   58 (118)
Q Consensus        28 ~~~R~~waFLlSSivTF~gGLliIliwR~i~   58 (118)
                      .+.|...+|.+..++..+.|.+-+.-.+-+.
T Consensus         4 I~~KL~~~f~~~~~l~~~~~~~~~~~l~~~~   34 (181)
T PF12729_consen    4 IRTKLILGFGLIILLLLIVGIVGLYSLSQIN   34 (181)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3678899999999888888887777766653


No 35 
>PF13334 DUF4094:  Domain of unknown function (DUF4094)
Probab=22.05  E-value=98  Score=21.93  Aligned_cols=11  Identities=27%  Similarity=0.612  Sum_probs=9.0

Q ss_pred             HHHHHHHHHHH
Q psy6104          40 SIFTFILGLVI   50 (118)
Q Consensus        40 SivTF~gGLli   50 (118)
                      +++-||+|+++
T Consensus         9 c~~SF~~G~lf   19 (95)
T PF13334_consen    9 CIASFCAGMLF   19 (95)
T ss_pred             HHHHHHHHHHH
Confidence            58889999874


No 36 
>PF05151 PsbM:  Photosystem II reaction centre M protein (PsbM);  InterPro: IPR007826 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbM found in PSII. PsbM is one of the most hydrophobic proteins in the thylakoid membrane. The function of this protein is unknown.; GO: 0015979 photosynthesis, 0019684 photosynthesis, light reaction, 0009523 photosystem II, 0016021 integral to membrane; PDB: 3A0H_m 3ARC_m 3A0B_M 3PRR_M 3PRQ_M 1S5L_M 4FBY_e 3BZ2_M 3BZ1_M 2AXT_M ....
Probab=21.70  E-value=1.9e+02  Score=17.28  Aligned_cols=21  Identities=19%  Similarity=0.611  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q psy6104          34 WCFLLSSIFTFILGLVIVLLW   54 (118)
Q Consensus        34 waFLlSSivTF~gGLliIliw   54 (118)
                      .+|+++-+++++--.|++.+|
T Consensus         6 l~fiAtaLfi~iPt~FLiily   26 (31)
T PF05151_consen    6 LAFIATALFILIPTAFLIILY   26 (31)
T ss_dssp             THHHHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHHHHhheE
Confidence            478888888887777766654


No 37 
>KOG1500|consensus
Probab=21.51  E-value=47  Score=30.12  Aligned_cols=12  Identities=58%  Similarity=0.872  Sum_probs=8.9

Q ss_pred             hhccccceEEEE
Q psy6104         105 SGQTTTGRILVP  116 (118)
Q Consensus       105 SaQT~tGRILVV  116 (118)
                      -|||+|||+|.|
T Consensus       423 aGq~ltGr~~Li  434 (517)
T KOG1500|consen  423 AGQTLTGRLLLI  434 (517)
T ss_pred             cCCeeeeeEEEE
Confidence            478888887765


No 38 
>TIGR02848 spore_III_AC stage III sporulation protein AC. Members of this protein family are designated SpoIIIAC, part of the spoIIIA operon of sporulation genes whose mutant phenotype is linked to sporulation stage III. Members of this family are encoded by the genome of a species if and only if that species is capable of endospore formation, as in Bacillus subtilis. The molecular function of this small, probable integral membrane protein is unknown.
Probab=21.46  E-value=1e+02  Score=21.07  Aligned_cols=15  Identities=27%  Similarity=0.580  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHH
Q psy6104          42 FTFILGLVIVLLWRL   56 (118)
Q Consensus        42 vTF~gGLliIliwR~   56 (118)
                      .|.++|++++|.|=+
T Consensus        34 ~~tLaG~iiVL~~Vi   48 (64)
T TIGR02848        34 MVTLAGIVVVLFMVI   48 (64)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            466899999998743


No 39 
>PTZ00443 Thioredoxin domain-containing protein; Provisional
Probab=21.19  E-value=2.1e+02  Score=22.77  Aligned_cols=23  Identities=30%  Similarity=0.564  Sum_probs=15.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          34 WCFLLSSIFTFILGLVIVLLWRL   56 (118)
Q Consensus        34 waFLlSSivTF~gGLliIliwR~   56 (118)
                      ..|-.=|.++|++|+|+-++.-.
T Consensus       177 ~~~~~~~~~~~~~g~~~~~~~~~  199 (224)
T PTZ00443        177 AGFFTISSFAFLFGILMGLMIAL  199 (224)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHH
Confidence            34556677789999887766543


No 40 
>PF10805 DUF2730:  Protein of unknown function (DUF2730);  InterPro: IPR020269 This entry represents a family of various hypothetical proteins. The proteins, which include HI1498 and Gp25, from phage Mu, are currently uncharacterised.
Probab=21.10  E-value=1.3e+02  Score=21.26  Aligned_cols=27  Identities=22%  Similarity=0.501  Sum_probs=17.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          30 ERKWWCFLLSSIFTFILGLVIVLLWRLF   57 (118)
Q Consensus        30 ~R~~waFLlSSivTF~gGLliIliwR~i   57 (118)
                      -++||..+. ++++.++|++...+-|.+
T Consensus         5 ~~~~w~ii~-a~~~~~~~~~~~~l~~~~   31 (106)
T PF10805_consen    5 IKKNWGIIW-AVFGIAGGIFWLWLRRTY   31 (106)
T ss_pred             HHhCcHHHH-HHHHHHHHHHHHHHHHhh
Confidence            478999854 455666666666665543


No 41 
>PF09301 DUF1970:  Domain of unknown function (DUF1970);  InterPro: IPR015380 This entry is represented by Bacteriophage PRD1, P16; it is a family of uncharacterised viral proteins.; PDB: 1W8X_P.
Probab=20.30  E-value=88  Score=23.23  Aligned_cols=14  Identities=43%  Similarity=0.845  Sum_probs=11.7

Q ss_pred             HHHHHHHHHHHHHH
Q psy6104          45 ILGLVIVLLWRLFA   58 (118)
Q Consensus        45 ~gGLliIliwR~i~   58 (118)
                      -|||++||||--|+
T Consensus        11 ggglvliliwlwfr   24 (117)
T PF09301_consen   11 GGGLVLILIWLWFR   24 (117)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             cCchhhHHHHHHHc
Confidence            48999999997775


No 42 
>PF04689 S1FA:  DNA binding protein S1FA;  InterPro: IPR006779  S1FA is an unusual small plant peptide of only 70 amino acids with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. S1FA is highly conserved between dicotyledonous and monocotyledonous plants and may be a DNA-binding protein that specifically recognises the negative promoter element S1F [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=20.30  E-value=1.3e+02  Score=20.95  Aligned_cols=17  Identities=12%  Similarity=0.481  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q psy6104          37 LLSSIFTFILGLVIVLL   53 (118)
Q Consensus        37 LlSSivTF~gGLliIli   53 (118)
                      +..++++|+.|.+++..
T Consensus        20 V~g~ll~flvGnyvlY~   36 (69)
T PF04689_consen   20 VAGLLLVFLVGNYVLYV   36 (69)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45677888888877754


No 43 
>PF05767 Pox_A14:  Poxvirus virion envelope protein A14;  InterPro: IPR008785 This family consists of several Poxvirus virion envelope protein A14-like sequences. A14 is a component of the virion membrane and has been found to be an H1 phosphatase substrate in vivo and in vitro. A14 is hyperphosphorylated on serine residues in the absence of H1 expression [].; GO: 0019031 viral envelope
Probab=20.29  E-value=2.1e+02  Score=20.84  Aligned_cols=26  Identities=38%  Similarity=0.588  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHHHHHHHHHH--Hhhhhcc
Q psy6104          39 SSIFTFILGLVIVLLWRLF--AFICCRK   64 (118)
Q Consensus        39 SSivTF~gGLliIliwR~i--~~~cc~k   64 (118)
                      -|++.|..|++++|--=++  +++-|+-
T Consensus        47 lSii~FI~giil~lG~~i~s~ygr~C~~   74 (92)
T PF05767_consen   47 LSIICFILGIILTLGIVIFSMYGRYCRP   74 (92)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhcCC
Confidence            5899999999888766555  2367753


No 44 
>PF00858 ASC:  Amiloride-sensitive sodium channel;  InterPro: IPR001873 The apical membrane of many tight epithelia contains sodium channels that are primarily characterised by their high affinity to the diuretic blocker amiloride [, , , ]. These channels mediate the first step of active sodium reabsorption essential for the maintenance of body salt and water homeostasis []. In vertebrates, the channels control reabsorption of sodium in kidney, colon, lung and sweat glands; they also play a role in taste perception. Members of the epithelial Na+ channel (ENaC) family fall into four subfamilies, termed alpha, beta, gamma and delta []. The proteins exhibit the same apparent topology, each with two transmembrane (TM) spanning segments, separated by a large extracellular loop. In most ENaC proteins studied to date, the extracellular domains are highly conserved and contain numerous cysteine residues, with flanking C-terminal amphipathic TM regions, postulated to contribute to the formation of the hydrophilic pores of the oligomeric channel protein complexes. It is thought that the well-conserved extracellular domains serve as receptors to control the activities of the channels. Vertebrate ENaC proteins are similar to degenerins of Caenorhabditis elegans []: deg-1, del-1, mec-4, mec-10 and unc-8. These proteins can be mutated to cause neuronal degradation, and are also thought to form sodium channels. Structurally, the proteins that belong to this family consist of about 510 to 920 amino acid residues. They are made of an intracellular N terminus region followed by a transmembrane domain, a large extracellular loop, a second transmembrane segment and a C-terminal intracellular tail [].; GO: 0005272 sodium channel activity, 0006814 sodium ion transport, 0016020 membrane; PDB: 2QTS_B 3S3W_C 3IJ4_A 3S3X_A 3HGC_A 2K2B_A.
Probab=20.16  E-value=1.7e+02  Score=23.41  Aligned_cols=30  Identities=20%  Similarity=0.476  Sum_probs=18.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy6104          29 QERKWWCFLLSSIFTFILGLVIVLLWRLFA   58 (118)
Q Consensus        29 ~~R~~waFLlSSivTF~gGLliIliwR~i~   58 (118)
                      -+|..|++++.+.+.++.-.+..++-|...
T Consensus        21 ~~R~~W~~~~~~~~~~~~~~~~~~~~~y~~   50 (439)
T PF00858_consen   21 FERLFWLLVVVVSFILFIYQIYLLIERYLS   50 (439)
T ss_dssp             HCHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            357788877766666655555555555443


Done!