Diaphorina citri psyllid: psy6124

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MFTLTGLGPAFYFQDSQMGGVAIALGHGSVLFECAKHELHATTALRRPNRLHPTRISLVFYQHRNLNRPKHGWDEWEEKMRQRKNGTAASTGTSTTTTTTTSTNVHTSDIQHLLPVVKEVGTGGTRQIAKIPTHSTTTWTTLFPMHPCIVTGPYQESSNSTAPPAPPANPT
cccccccccccccccccccEEEEEcccccEEEEcccccccccccccccccccccEEEEEEEEccccccccccHHHHHHHHHHHHHcHHHccccccccccccccccccccccccccccccccccccccccccccCEEcEEEEEccccccEEccccccccccccccccccccc
*FTLTGLGPAFYFQDSQMGGVAIALGHGSVLFECAKHELHATTALRRPNRLHPTRISLVFYQHRNLNRPKHGWDEWE*****************************************************IPTHSTTTWTTLFPMHPCIVTGPYQ****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTLTGLGPAFYFQDSQMGGVAIALGHGSVLFECAKHELHATTALRRPNRLHPTRISLVFYQHRNLNRPKHGWDEWEEKMRQRKNGTAASTGTSTTTTTTTSTNVHTSDIQHLLPVVKEVGTGGTRQIAKIPTHSTTTWTTLFPMHPCIVTGPYQESSNSTAPPAPPANPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0080182 [BP]histone H3-K4 trimethylationprobableGO:0006479, GO:0018023, GO:0018022, GO:0008213, GO:0016043, GO:0051568, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018193, GO:0071704, GO:0034968, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044763, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0016568, GO:0016569
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0080111 [BP]DNA demethylationprobableGO:0019222, GO:0035510, GO:0090304, GO:0034641, GO:0006807, GO:0050789, GO:1901360, GO:0006139, GO:0044710, GO:0006304, GO:0044260, GO:0040029, GO:0071704, GO:0065007, GO:0010468, GO:0060255, GO:0009987, GO:0006725, GO:0043412, GO:0044728, GO:0008150, GO:0008152, GO:0046483, GO:0070988, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted