Psyllid ID: psy612


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000-----
MPETQISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDFKNSYIKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSKLNSIIYKKLKKFNNKAIYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVYAKYLNNKNIYKKYTNKLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQDKIQYLVLSGELEKLNQIINNIAPKVSENKKINNFNIEKFIENDIKNHICNILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFIKNHNNTMIKFYRNKYPLKTESKNISILYDNKINENYENVSKKSNFILNKNTDINSEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKEKILHTNYLKGIVSHKFTSNKIIDSYINKLFYY
ccccEEEEEEEcccccccHHHHHHHHHHHHccccccEEEEEEccEEEEEEEEEEcccccccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHHHHccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHcccccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHccccHHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHHHcHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccHHHHccccccccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccccEEEccEEEEEcHHHHHHHHHccccccccccccccccccccccccEEEEEEEEcHHHHHHccccEEEEEEEcccccccccccccccccHHHHHHHHHHHHHcccccccccEEEccccccccccHHHHHHHHHHHcccccccccEEEccccccHHHHHHHHcHHHHHHHHHHHccccccccccccccccccccccccEEEcccccccccccccccEEEEcccccccccEEEEEEcccccccccccccccccccccEEEEEccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccEEEEEEccHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHccc
cccccccEEcccccccHHHHHHHHHHHHHHcccccccHEEEcccccEccHHHcccccccccccccccccEEEEEcccHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHcccEEEEEEEccccHHHHHHHHHcccccccccEEEEEEcccccccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHccHHcccccccEEEEEEcHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHcccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHccccHHHHHHcccHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHccccccccccccccccccccccccccHHHHcHcccHcHcccccccccccccccccEEEEEEEEcccccccHHHHHHHHHcccccccccccccccHHHHccccccccccEEEEcccccccHHcccHHHccccHHHHHHccHHHHHHHHHHHHHHHHccccHHHccccccEEEEEEcccccccccccEEEEEcccHHHHcccEEEEEcccccEEEEccccHHHHHHHHHHHHHHHcccccEEEEccEEEEccHHHHHHHHHHccccccccccccEcccccEcEEcEEEEEEEEEHHHHHHccccccEEEEEEEEEEccccccccccccHHHHHHHHHHHHHHcccHHHccEEEccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEcHccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEccccccccccccccEEEEEEccccccccEEEEEcccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHHcccccccccccccccEEEEEcccccccccHHHHHcc
MPETQISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDfknsyikqggtylitggtgrlgMLFSDYLINKYSTNLILSGRSKLNSIIYKKLKKFNNKAIYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALENTILKLQKNKLDFvcyfssssailgdfgscdyamgNRFQTVYAKYLNNKNIYKKYTNKLItinwplwnnskfkignneqtdfyfksskqkvlhendgLKLFEQLLIQDKIQYLVLSGELEKLNQIINNIapkvsenkkinnFNIEKFIENDIKNHICNILntkkseiyknknladygfdsiSLAEFSRILSKFysldimpsifFSYSTLERLITYFIKNHNNTMIKFyrnkyplkteskNISILYDNKINENYENVSKKSNFilnkntdinSEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLyyenpikssnkinskwygsipgidefdplffeispleaermdprQRHLLQESWLALedagygpnqianqKIGMFVGveegsnyqdrldqvnltSTHNAILSARLAYFmdlkgpvmAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTsagmlspdgkcyvfderanglvpsEAVVAVVLKRLSralsdgdpihaiirgsginydgktngitapngisqTELIKSVYkksnlnpedinyiithgtgtklgdpveiNALHdvfknktynqkfcaitsnksnightFAASGLVSLINLVQSIkykiipaslhcekennyiilknspfyinksnkkWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYISTnfkniknntfissnpyHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKEKILHTNYLKgivshkftsnkIIDSYINKLFYY
MPETQISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDFKNSYIKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSKLNSIIYKklkkfnnkaiYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVYAKYLNNKNIYKKYTNKLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQDKIQYLVLSGELEKLNQIINniapkvsenkkiNNFNIEKFIENDIKNHICNILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFIKNHNNTMIKFYRNKYPLKTESKNISILYDNKINENYENVSKKSNFILNKNTDINSEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSralsdgdpihaiirgsginydgkTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKEKILHTNYLkgivshkftsnkiidsyinklfyy
MPETQISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDFKNSYIKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSKLNSIIYKKLKKFNNKAIYIQVDVSDKLKMiseinsiinniGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVyakylnnkniykkytnkLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQDKIQYLVLSGELEKLNQIINNIAPKVSenkkinnfniekfienDIKNHICNILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFIKNHNNTMIKFYRNKYPLKTESKNISILYDNKINENYENVSKKSNFILNKNTDINSEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAiiissieevvkiiNDTLNSKEKILHTNYLKGIVSHKFTSNKIIDSYINKLFYY
*****ISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDFKNSYIKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSKLNSIIYKKLKKFNNKAIYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVYAKYLNNKNIYKKYTNKLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQDKIQYLVLSGELEKLNQIINNIAPKVSENKKINNFNIEKFIENDIKNHICNILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFIKNHNNTMIKFYRNKYPLKTESKNISILYDNKINENYENVSKKSNFILNKNTDINSEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEISPLE********RHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKEKILHTNYLKGIVSHKFTSNKIIDSYINKLFY*
MPETQISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNI************IKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSKLNSI*YKKLKKFNNKAIYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVYAKYLNNKNIYKKYTNKLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQDKIQYLVLSGELEK**************************IENDIKNHICNILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFIKNHNNTM***********************************************SEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQE********************HMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKE**********IVSHKFTSNKIIDSYINKLFYY
MPETQISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDFKNSYIKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSKLNSIIYKKLKKFNNKAIYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVYAKYLNNKNIYKKYTNKLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQDKIQYLVLSGELEKLNQIINNIAPKVSENKKINNFNIEKFIENDIKNHICNILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFIKNHNNTMIKFYRNKYPLKTESKNISILYDNKINENYENVSKKSNFILNKNTDINSEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKEKILHTNYLKGIVSHKFTSNKIIDSYINKLFYY
MPETQISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDFKNSYIKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSKLNSIIYKKLKKFNNKAIYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVYAKYLNNKNIYKKYTNKLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQDKIQYLVLSGELEKLNQIINNIAPKVSENKKINNFNIEKFIENDIKNHICNILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFIKNHNN*************************************************SEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYIS**************NPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSK**********GIVSHKFTSNKIIDSYINKLFYY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPETQISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDFKNSYIKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSKLNSIIYKKLKKFNNKAIYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVYAKYLNNKNIYKKYTNKLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQDKIQYLVLSGELEKLNQIINNIAPKVSENKKINNFNIEKFIENDIKNHICNILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFIKNHNNTMIKFYRNKYPLKTESKNISILYDNKINENYENVSKKSNFILNKNTDINSEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKEKILHTNYLKGIVSHKFTSNKIIDSYINKLFYY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1005 2.2.26 [Sep-21-2011]
P40872 4262 Polyketide synthase PksM yes N/A 0.948 0.223 0.418 0.0
O31782 5488 Polyketide synthase PksN no N/A 0.894 0.163 0.329 1e-152
Q05470 4538 Polyketide synthase PksL no N/A 0.878 0.194 0.328 1e-135
P40806 5043 Polyketide synthase PksJ no N/A 0.668 0.133 0.350 1e-123
O31784 2543 Polyketide synthase PksR no N/A 0.617 0.244 0.312 8e-99
Q9R9J1 3971 Mycosubtilin synthase sub no N/A 0.590 0.149 0.337 7e-98
Q10977 1876 Phthiocerol synthesis pol yes N/A 0.503 0.269 0.342 4e-94
Q7TXM0 1876 Phthiocerol/phenolphthioc yes N/A 0.503 0.269 0.341 2e-93
Q7TXL9 1538 Phthiocerol/phenolphthioc no N/A 0.515 0.336 0.332 8e-90
Q10978 1538 Phthiocerol synthesis pol no N/A 0.515 0.336 0.332 9e-90
>sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 Back     alignment and function desciption
 Score =  793 bits (2049), Expect = 0.0,   Method: Composition-based stats.
 Identities = 423/1010 (41%), Positives = 628/1010 (62%), Gaps = 57/1010 (5%)

Query: 1    MPETQISIVFAEKITNFNIKNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDF 60
            +P T+++ +F +     ++ +W   ++ ELQ     +++Y   +L RY  +I+   ++  
Sbjct: 3081 LPHTKVTGIF-QPAEQGSMDDWTRKVWAELQASTEQTVLY--QNLKRYVNHIEQTTIQP- 3136

Query: 61   KNSYIKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSKLNSIIYKKLKKFNN--- 117
             NS +K GGTYLITGG G LG LF+ +L   Y+ NLIL+GRS  N    K++K+  +   
Sbjct: 3137 DNSKLKSGGTYLITGGVGGLGYLFAKHLAKNYAANLILTGRSPFNDEKQKQIKELKDLGG 3196

Query: 118  KAIYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSK 177
            +A+Y + DVSD + M   +    +  G I+GV+H AGI    S I +   ++F  ++  K
Sbjct: 3197 EAMYAEADVSDPIAMGDCVKRGKDRFGAINGVIHAAGIES-DSAIFDKKIESFQRIIEPK 3255

Query: 178  ISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVYAKYLNN 237
            I+GTIAL+  L+N         LDF+CYFSSSSA+LGDFG CDYA+GNRFQ  YA+Y N 
Sbjct: 3256 INGTIALDEWLKN-------EDLDFMCYFSSSSAVLGDFGCCDYAIGNRFQMAYAQYRN- 3307

Query: 238  KNIYKKYTNKLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQD 297
                + +  K   INWP+W +   KIG+ E TD Y KSS Q+ L   +G+++FE +L Q 
Sbjct: 3308 ----ELHNGKTFVINWPVWKDGGMKIGDEETTDMYLKSSGQRFLEAEEGIRMFEHILAQQ 3363

Query: 298  KIQYLVLSGELEKLNQIIN----------NIAPKVSENK-KINNFNIEKFIENDIKNHIC 346
              Q+LV++G+  ++++ +             AP   ENK ++   +IEK +E+D+K HI 
Sbjct: 3364 DAQHLVIAGQPSRVSRFLGMTEPAIPEPATQAPLAQENKDEVKTLSIEKRLEHDLKEHIH 3423

Query: 347  NILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFI 406
             +L   K ++  NKN AD+GFDSI LA+FS +LSK +++++ P++FF YSTL+ LI++F+
Sbjct: 3424 TLLKISKDKLNLNKNWADFGFDSIYLAKFSNVLSKHFNIEVTPALFFGYSTLQELISFFL 3483

Query: 407  KNHNNTMIKFYRNKYPLKTESKNISILYDNKINENYENVSKKSNFILNKNTDINSEELIA 466
             +H   +  FYR+     +E++     Y           SKKS   ++       +E IA
Sbjct: 3484 TDHKELIEAFYRDD---ASEAQKPPEAYAVIPVALEPEASKKSIRQVH-------DEPIA 3533

Query: 467  IIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSI 526
            IIGMSGRFP A +++E W  L N K  IS+IP +  DW     +P K+      +W   +
Sbjct: 3534 IIGMSGRFPQADSVHELWDNLKNGKSCISDIPGERRDWGRANRDPEKAV----PRWGAFL 3589

Query: 527  PGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEG 586
              ID FDPLFF+ISP EAE MDPRQR  L+E+W   EDAGY  ++I  +  G++VGVEEG
Sbjct: 3590 KDIDRFDPLFFQISPKEAESMDPRQRIFLEEAWHTFEDAGYMGDRIKGKSCGVYVGVEEG 3649

Query: 587  SNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHEC 646
                   D   +  T NA LSAR+AY +DLKGP MA+  ACSS LVA H AC +LRQ +C
Sbjct: 3650 EYAHLTGDTDYINGTQNATLSARIAYALDLKGPNMALTAACSSGLVAIHQACSALRQGDC 3709

Query: 647  DTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSRAL 706
            + A++ GV+L IS  ++ A+T A MLSP+G+C VFD+ ANGLVP EAV AV+LK LS+A+
Sbjct: 3710 EMALAGGVSLNISHMSFEALTRAEMLSPNGQCKVFDQDANGLVPGEAVAAVLLKPLSKAI 3769

Query: 707  SDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGT 766
             D D I+  I+ SG+NYDGKTNGITAPN  SQ ELI+++Y+K+ +NP DI Y++ H TG+
Sbjct: 3770 EDKDHIYGCIKASGVNYDGKTNGITAPNPFSQAELIENIYEKNEINPLDIQYVMAHSTGS 3829

Query: 767  KLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPA 826
             LGDP+E+ AL  VF   T  ++FC I+S K  IGHTFAASG V+LI+++ ++K +IIPA
Sbjct: 3830 NLGDPLEVQALTSVFSKYTKQKQFCMISSIKPLIGHTFAASGTVALISMLMAMKNQIIPA 3889

Query: 827  SLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYISTN 886
            + HCE EN YI  K SPF + K N+ W   N+K R+G +S  G+SGTNAH V++EYI  +
Sbjct: 3890 THHCESENPYIPFKESPFVLCKENRSWIKKNQKPRMGTISTTGISGTNAHAVIEEYIPDD 3949

Query: 887  FKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENFVYTLMQGRHH 946
              + + +     +P  + V+SA+    L++   +++ +L +N+ + + +  YTL  GR  
Sbjct: 3950 QPSTQRH---QGSP-QIFVISAQNDDRLQDAACRMIAYLEQNHNLSLPDVAYTLQVGRKA 4005

Query: 947  FQYRCAIIISSIEEVVKII--------NDTLNSKEKILHTNYLKGIVSHK 988
             + R AI+ ++ E++V+ +        N  ++ +++ L+T Y +GI+  +
Sbjct: 4006 MEARLAIVANNQEQLVRKLKEYVEAMKNGGVSGQQRSLYTGYTEGILEEQ 4055




Involved in some intermediate steps for the synthesis of the antibiotic polyketide bacillaene which is involved in secondary metabolism.
Bacillus subtilis (strain 168) (taxid: 224308)
>sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 Back     alignment and function description
>sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 Back     alignment and function description
>sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 Back     alignment and function description
>sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 Back     alignment and function description
>sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 Back     alignment and function description
>sp|Q10977|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis GN=ppsA PE=3 SV=2 Back     alignment and function description
>sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 Back     alignment and function description
>sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 Back     alignment and function description
>sp|Q10978|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis GN=ppsB PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1005
44662946 8601 mixed type I polyketide synthase/nonribo 0.972 0.113 0.500 0.0
423456310 1806 hypothetical protein IEE_05053, partial 0.968 0.538 0.499 0.0
421078401 3436 Beta-ketoacyl synthase [Pelosinus fermen 0.960 0.280 0.449 0.0
117617418 5521 BryB [Candidatus Endobugula sertula] 0.967 0.176 0.461 0.0
121624846 5511 BryB [Candidatus Endobugula sertula] 0.947 0.172 0.470 0.0
315647766 5441 putative mixed polyketide synthase/non-r 0.966 0.178 0.439 0.0
345022635 2991 DfnG [Ornithinibacillus scapharcae TW25] 0.968 0.325 0.446 0.0
326205046 1696 6-deoxyerythronolide-B synthase [Clostri 0.852 0.505 0.463 0.0
394993052 2713 DfnG, partial [Bacillus sp. 916] gi|3938 0.947 0.350 0.444 0.0
345022706 1625 hypothetical protein OTW25_15521 [Ornith 0.964 0.596 0.455 0.0
>gi|44662946|gb|AAS47564.1| mixed type I polyketide synthase/nonribosomal peptide synthetase [symbiont bacterium of Paederus fuscipes] Back     alignment and taxonomy information
 Score =  984 bits (2545), Expect = 0.0,   Method: Composition-based stats.
 Identities = 515/1029 (50%), Positives = 691/1029 (67%), Gaps = 52/1029 (5%)

Query: 1    MPETQISIVFAEKITNFNIK----NWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSII 56
            MPETQ+++VF E+  +        +W+ +L  EL   KL S  Y     +R+   I+ + 
Sbjct: 7253 MPETQVAVVFRERAADTGESSPTWDWLEVLVAELFAEKLRSACYRQG--VRHVPLIRPLA 7310

Query: 57   LKDFKNSYIKQGGTYLITGGTGRLGMLFSDYLINKYSTNLILSGRSK-LNSIIYKKLKKF 115
             +    S  KQGG YLITGG G LGM+ +++L   Y+  L+LSGRS  L +  Y+ L+  
Sbjct: 7311 WQPGSASPFKQGGVYLITGGGGGLGMIVAEHLATVYAARLVLSGRSSSLAAEKYELLQAR 7370

Query: 116  NNKAIYIQVDVSDKLKMISEINSIINNIGPIDGVLHIAGISGLTSNILEANYKNFYSVLS 175
              + +Y+  DV+D   M   ++    +  P++GVLHIAG++G T+ +L+A    F  VL 
Sbjct: 7371 GAQVLYVGADVTDVHAMQEVVDQARRHFSPLNGVLHIAGLNG-TAEVLKAEADAFQRVLD 7429

Query: 176  SKISGTIALNYALENTILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVYAKYL 235
            +KI+G+  L+  L       ++  LDF+CYF SSSAI+GDFGSCDYA+GNRFQ+ YA Y 
Sbjct: 7430 AKITGSQVLDQVL-------RRESLDFICYFCSSSAIIGDFGSCDYALGNRFQSAYALYR 7482

Query: 236  NNKNIYKKYTNKLITINWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLI 295
                     + K + INWPLW +    +G+ EQT FY +SS Q+ L   + L L EQLL 
Sbjct: 7483 AQMVESSALSGKTLAINWPLWQDGGLGVGDAEQTRFYLQSSGQRSLCSQEALALLEQLLT 7542

Query: 296  QDKIQYLVLSGELEKLNQIINN---------------IAPKVSENKKINN-FNIEKFIEN 339
            QD+ Q LV +G+ ++L + +N                 A  V+E  ++    ++++ +  
Sbjct: 7543 QDRAQCLVWAGQPDRLLRWVNQEPLEAATVTVPEPVRAAKAVAERAELGGGLDLQQCLLR 7602

Query: 340  DIKNHICNILNTKKSEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLE 399
            D+K  IC +L T+ +E+  + NL D+GFDSISLAEFSR+LS+FYSLDI PS+FFS+STL 
Sbjct: 7603 DLKTKICELLGTQYNELENHANLVDFGFDSISLAEFSRVLSRFYSLDISPSVFFSHSTLN 7662

Query: 400  RLITYFIKNHNNTMIKFYRNKYPLKTESKNISILYDNKINENYENVSKKSNFILNKNTDI 459
            RL  YF+  H  T+  FY+   P   E   +             +V      +L   T I
Sbjct: 7663 RLTAYFLAEHRQTLEGFYQQPQPAGPEHAPVPTEVAQV------SVPVPVTALLPTGTSI 7716

Query: 460  NS-----EELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKS 514
             S     +E IAIIG+SGRFP AR I E W+IL   +D I E+P   FDW+ YY +P + 
Sbjct: 7717 GSASQGQDEPIAIIGLSGRFPQARTIEELWRILEQGRDAIQEVPIDRFDWRSYY-SPSQE 7775

Query: 515  SNKINSKWYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIAN 574
             +K NSKW G IPGI EFDPLFFEISPLEAERMDPRQRHL+QE+WLALEDAGYGP Q+  
Sbjct: 7776 MSKSNSKWGGCIPGIAEFDPLFFEISPLEAERMDPRQRHLMQEAWLALEDAGYGPEQLEC 7835

Query: 575  QKIGMFVGVEEGSNYQDRL-DQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVA 633
             KI MFVGVEEG +YQ RL  Q +LTS HN IL++RLAYF++LKGPVMAINTACSS+LVA
Sbjct: 7836 NKISMFVGVEEGCDYQRRLTQQTSLTSMHNGILASRLAYFLNLKGPVMAINTACSSALVA 7895

Query: 634  THIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEA 693
             H ACQSLR  ECDTAI+AGVNL+++PEAY+ MT AGMLSPDGKCYVFD+RANGLVP EA
Sbjct: 7896 VHQACQSLRHGECDTAIAAGVNLLVAPEAYVGMTQAGMLSPDGKCYVFDKRANGLVPGEA 7955

Query: 694  VVAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNP 753
            V  VVLKRLS+AL+DGDPI A+IRGSGINYDGKTNGITAP+G SQTEL++ +Y++  L P
Sbjct: 7956 VAVVVLKRLSKALADGDPIKALIRGSGINYDGKTNGITAPSGASQTELLEGIYRQCALQP 8015

Query: 754  EDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLI 813
            +DI+YI+THGTGT+LGDP+EINAL+DVFK KT  Q FCA+TS KSN+GHTFAASGLVSLI
Sbjct: 8016 QDISYIVTHGTGTQLGDPIEINALYDVFKGKTDKQGFCALTSIKSNLGHTFAASGLVSLI 8075

Query: 814  NLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGT 873
            +LV +I+++ IP+SLHCE++N+YI  + SPFY+N   K W     + RIGAVSAFGMSGT
Sbjct: 8076 SLVLAIRHRTIPSSLHCEQKNDYIRWQESPFYVNTRKKHWECALGQPRIGAVSAFGMSGT 8135

Query: 874  NAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCI 933
            NAH+V+QE+     +  + + + ++ PY++ V+SAKT+ +L+E+++Q   +L ++  +  
Sbjct: 8136 NAHVVVQEH-----QPAEPSRWSTAAPYYLWVVSAKTETTLQEQIRQWEDYLSRHPDLDF 8190

Query: 934  ENFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKEKILHTNYLKGIVSHKFTSNK 993
            E   YTL++GRHHF+YRCAI+   + +V++ +   L+ + +    N   G V   F+  K
Sbjct: 8191 EAVSYTLLKGRHHFKYRCAIVAKDLSQVLQALRQALDRQTQ---ANLCMGCVDRDFSGQK 8247

Query: 994  IIDSYINKL 1002
             I  +I  L
Sbjct: 8248 AIRDFIASL 8256




Source: symbiont bacterium of Paederus fuscipes

Species: symbiont bacterium of Paederus fuscipes

Genus:

Family:

Order:

Class:

Phylum:

Superkingdom: Bacteria

>gi|423456310|ref|ZP_17433162.1| hypothetical protein IEE_05053, partial [Bacillus cereus BAG5X1-1] gi|401130743|gb|EJQ38403.1| hypothetical protein IEE_05053, partial [Bacillus cereus BAG5X1-1] Back     alignment and taxonomy information
>gi|421078401|ref|ZP_15539355.1| Beta-ketoacyl synthase [Pelosinus fermentans JBW45] gi|392523591|gb|EIW46763.1| Beta-ketoacyl synthase [Pelosinus fermentans JBW45] Back     alignment and taxonomy information
>gi|117617418|gb|ABK51300.1| BryB [Candidatus Endobugula sertula] Back     alignment and taxonomy information
>gi|121624846|gb|ABM63527.1| BryB [Candidatus Endobugula sertula] Back     alignment and taxonomy information
>gi|315647766|ref|ZP_07900867.1| putative mixed polyketide synthase/non-ribosomal peptide synthetase [Paenibacillus vortex V453] gi|315276412|gb|EFU39755.1| putative mixed polyketide synthase/non-ribosomal peptide synthetase [Paenibacillus vortex V453] Back     alignment and taxonomy information
>gi|345022635|ref|ZP_08786248.1| DfnG [Ornithinibacillus scapharcae TW25] Back     alignment and taxonomy information
>gi|326205046|ref|ZP_08194893.1| 6-deoxyerythronolide-B synthase [Clostridium papyrosolvens DSM 2782] gi|325984802|gb|EGD45651.1| 6-deoxyerythronolide-B synthase [Clostridium papyrosolvens DSM 2782] Back     alignment and taxonomy information
>gi|394993052|ref|ZP_10385815.1| DfnG, partial [Bacillus sp. 916] gi|393806094|gb|EJD67450.1| DfnG, partial [Bacillus sp. 916] Back     alignment and taxonomy information
>gi|345022706|ref|ZP_08786319.1| hypothetical protein OTW25_15521 [Ornithinibacillus scapharcae TW25] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1005
UNIPROTKB|Q4KCD4 4163 rzxE "Polyketide synthase RzxE 0.949 0.229 0.406 9.9e-195
UNIPROTKB|Q4KCD6 4039 rzxD "Polyketide synthase RzxD 0.834 0.207 0.329 9.8e-120
UNIPROTKB|Q4KCD7 4937 rzxC "Polyketide synthase RzxC 0.842 0.171 0.307 4.3e-102
UNIPROTKB|Q4KCD3 2541 rzxF "Polyketide synthase RzxF 0.596 0.235 0.315 1.7e-101
UNIPROTKB|Q4KCD8 6675 rzxB "Polyketide synthase/nonr 0.582 0.087 0.330 6.3e-87
UNIPROTKB|O53490 4151 pks12 "Probable polyketide syn 0.479 0.116 0.340 5.1e-87
UNIPROTKB|Q10977 1876 ppsA "Phthiocerol synthesis po 0.416 0.223 0.400 1.1e-81
UNIPROTKB|Q7TXM0 1876 ppsA "Phthiocerol/phenolphthio 0.416 0.223 0.398 5e-81
UNIPROTKB|Q10978 1538 ppsB "Phthiocerol synthesis po 0.411 0.269 0.386 3.2e-80
UNIPROTKB|Q7TXL9 1538 ppsB "Phthiocerol/phenolphthio 0.411 0.269 0.386 3.2e-80
UNIPROTKB|Q4KCD4 rzxE "Polyketide synthase RzxE" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
 Score = 1902 (674.6 bits), Expect = 9.9e-195, P = 9.9e-195
 Identities = 411/1012 (40%), Positives = 599/1012 (59%)

Query:    20 KNWINILFKELQEPKLFSIMYYGNDLIRYQLNIKSIILKDFKNSYIKQGGTYLITGGTGR 79
             + W+  L+++L      S +Y      R  L I + +    +   + Q  T LITGG G 
Sbjct:  1210 RRWLQRLWRQLSGQPTGSRLYRDTRSQRPVL-IAAPVEAAAEPLALDQLNTLLITGGLGE 1268

Query:    80 LGMLFSDYLINKY------STNLILSGRSKLNSIIYKKLKKFNN---KAIYIQVDVSDKL 130
             LG+L +  L N+          L+L+GRS L++    ++   ++   +  ++Q D +D+ 
Sbjct:  1269 LGLLLAGELSNRARLRTDGQLQLLLNGRSPLSATTRARIDALSHEHCRVFHVQADCADRP 1328

Query:   131 KMXXXXXXXXXXXGPIDGVLHIAGISGLTSNILEANYKNFYSVLSSKISGTIALNYALEN 190
              +           GPIDG++H AG+   + ++L ++ + F +VL++KI  T  L+  L  
Sbjct:  1329 ALTAALAPVLAQSGPIDGLIHAAGLQA-SGSVLASSPEAFAAVLNAKIGATQVLDQVLAE 1387

Query:   191 TILKLQKNKLDFVCYFSSSSAILGDFGSCDYAMGNRFQTVXXXXXXXXXXXXXXXXXLIT 250
               L L       +C+FSSSSA+LGD G+C YAM NRFQ                   ++ 
Sbjct:  1388 QPLAL-------ICHFSSSSALLGDMGACSYAMANRFQQAYARYVQRGRARR-----VVA 1435

Query:   251 INWPLWNNSKFKIGNNEQTDFYFKSSKQKVLHENDGLKLFEQLLIQDKIQYLVLSGELEK 310
             INWPLW      +G  E T+FY KSS Q++L   +GL L  Q++  D  Q LVL+G+  +
Sbjct:  1436 INWPLWREGGMALGERESTEFYLKSSGQRMLESAEGLALLRQIVGSDIPQVLVLAGQPAR 1495

Query:   311 LNQIINNI-APKVSXXXXXXXX----------------XXXXXXXXDIKNHICNILNTKK 353
             L Q++  I  P                                   D++      L  ++
Sbjct:  1496 LQQLLEGINQPTAKATAGQPATVLPRAPAHSRPELKGLSLEQSLAWDLRELASRPLQAER 1555

Query:   354 SEIYKNKNLADYGFDSISLAEFSRILSKFYSLDIMPSIFFSYSTLERLITYFIKNHNNTM 413
               + +  NLAD+GFDSISLAE++ +L++ + L + P +FFS+STL +L  + +  H   +
Sbjct:  1556 QSLEEECNLADFGFDSISLAEYAGLLNRHFGLTLTPEVFFSHSTLAKLAAHLLAQHRQAV 1615

Query:   414 IKFYRNKYPLKTESKNISILYDNKINENYENVSKKSNFILNKNTDINSEELIAIIGMSGR 473
                Y   +P+ T           +     +  ++ +    + +    + E +AIIG+SGR
Sbjct:  1616 EACYL--HPV-TRDPQAEPEAQPETQPEAQPEAQPAPLTSSASASAPATEAMAIIGISGR 1672

Query:   474 FPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFD 533
             FP AR  +E W++L   +D++SEIP + +DW+ +Y +P ++  K    W GS+PGIDEFD
Sbjct:  1673 FPGARTTDELWQVLAEGRDMVSEIPPERYDWREHYGDPRENPTKTRCIWMGSVPGIDEFD 1732

Query:   534 PLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRL 593
             PLFFEISP EA  +DPRQR LLQESW  LEDAG GP Q+A Q++GMFVGVEEG ++Q   
Sbjct:  1733 PLFFEISPREATHLDPRQRLLLQESWNVLEDAGIGPRQLATQRVGMFVGVEEG-DFQRLA 1791

Query:   594 DQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAG 653
              + +LTS+HN IL++RLAYF++L GP MAINTACSS+LVA H A  SLR  EC+ AI+AG
Sbjct:  1792 GEESLTSSHNGILASRLAYFLNLTGPTMAINTACSSALVALHQAASSLRNQECEMAIAAG 1851

Query:   654 VNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAVVLKRLSRALSDGDPIH 713
             VNL+ S +A+I MT AGMLSPDGKC+ FD RANG+VP EAV  V+LK L+RA +DGD I+
Sbjct:  1852 VNLIFSADAFIGMTQAGMLSPDGKCFAFDHRANGMVPGEAVCCVLLKPLARAEADGDRIY 1911

Query:   714 AIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVE 773
               +R SG+NYDGKTNGITAP+G+SQ  L++ VY+++ ++ + ++YI+THGTGT+LGDPVE
Sbjct:  1912 GTLRASGLNYDGKTNGITAPSGVSQQRLLEEVYRRAGIDTQAVDYIVTHGTGTQLGDPVE 1971

Query:   774 INALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKE 833
             INAL+D F   +     CA+TS K+N+GHTFAASGLVS+I+L+Q+++++ IPASLHCE+E
Sbjct:  1972 INALNDAFGGNSPGH--CALTSTKTNLGHTFAASGLVSVISLLQALRHETIPASLHCEQE 2029

Query:   834 NNYIILKNSPFYINKSNKKWNTVN-EKLRIGAVSAFGMSGTNAHIVLQEYISTNFKNIKN 892
             N+YI  + SPFY+NK+NK W     ++ R+GAVSAFGMSGTNAH+V+Q Y        + 
Sbjct:  2030 NHYIQWQQSPFYVNKANKPWPQAGRDRERLGAVSAFGMSGTNAHVVVQSYSQ------RA 2083

Query:   893 NTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNN--TVCIENFVYTLMQGRHHFQYR 950
             +      P +++VLSAKT  +L+EK  Q+ + L +       +    +TL++GRHHF+YR
Sbjct:  2084 DDAALRRPCYVLVLSAKTAEALEEKAAQLNVALEQGGYRDAQMPAISHTLLEGRHHFRYR 2143

Query:   951 CAXXXXXXXXXXXXXNDTLNSKEKILHTNYLKGIVSHKFTSNKIIDSYINKL 1002
              A                L  +++    N   G V   F   K +  YI +L
Sbjct:  2144 LALVAADLEETRYGLQRYLAGEKR---PNLFAGEVERDFAPRKTVVRYIEQL 2192


GO:0030639 "polyketide biosynthetic process" evidence=IDA;TAS
UNIPROTKB|Q4KCD6 rzxD "Polyketide synthase RzxD" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KCD7 rzxC "Polyketide synthase RzxC" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KCD3 rzxF "Polyketide synthase RzxF" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|Q4KCD8 rzxB "Polyketide synthase/nonribosomal peptide synthetase hybrid RzxB" [Pseudomonas protegens Pf-5 (taxid:220664)] Back     alignment and assigned GO terms
UNIPROTKB|O53490 pks12 "Probable polyketide synthase pks12" [Mycobacterium tuberculosis H37Rv (taxid:83332)] Back     alignment and assigned GO terms
UNIPROTKB|Q10977 ppsA "Phthiocerol synthesis polyketide synthase type I PpsA" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q7TXM0 ppsA "Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA" [Mycobacterium bovis AF2122/97 (taxid:233413)] Back     alignment and assigned GO terms
UNIPROTKB|Q10978 ppsB "Phthiocerol synthesis polyketide synthase type I PpsB" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
UNIPROTKB|Q7TXL9 ppsB "Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB" [Mycobacterium bovis AF2122/97 (taxid:233413)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1005
cd00833421 cd00833, PKS, polyketide synthases (PKSs) polymeri 0.0
COG3321 1061 COG3321, COG3321, Polyketide synthase modules and 0.0
smart00825298 smart00825, PKS_KS, Beta-ketoacyl synthase 1e-148
pfam00109243 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, 2e-83
cd00825332 cd00825, decarbox_cond_enzymes, decarboxylating co 6e-62
cd00834406 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier prot 3e-58
TIGR02813 2582 TIGR02813, omega_3_PfaA, polyketide-type polyunsat 2e-57
COG0304412 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) sy 5e-53
cd08953436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2e-47
pfam02801119 pfam02801, Ketoacyl-synt_C, Beta-ketoacyl synthase 9e-46
cd00828407 cd00828, elong_cond_enzymes, "elongating" condensi 1e-42
cd00327254 cd00327, cond_enzymes, Condensing enzymes; Family 1e-37
smart00822180 smart00822, PKS_KR, This enzymatic domain is part 1e-35
pfam08659181 pfam08659, KR, KR domain 3e-34
PRK05952381 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protei 9e-34
TIGR03150407 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protei 7e-33
PTZ00050421 PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein 2e-32
PRK06333424 PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protei 2e-30
PRK07314411 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protei 1e-29
PRK07103410 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl 4e-29
PRK06501425 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protei 1e-25
PLN02836437 PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protei 1e-24
PRK14691342 PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protei 5e-24
cd08955376 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase ( 5e-21
PRK09116405 PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protei 2e-20
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 2e-20
PRK07910418 PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protei 3e-20
cd05274375 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatt 2e-19
PRK08722414 PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protei 6e-19
PLN02787540 PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protei 8e-19
PRK07967406 PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protei 3e-17
PRK08439406 PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protei 2e-15
cd00832399 cd00832, CLF, Chain-length factor (CLF) is a facto 8e-14
PRK09185392 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protei 9e-14
cd08954452 cd08954, KR_1_FAS_SDR_x, beta-ketoacyl reductase ( 1e-12
pfam0055066 pfam00550, PP-binding, Phosphopantetheine attachme 5e-09
cd08956448 cd08956, KR_3_FAS_SDR_x, beta-ketoacyl reductase ( 7e-08
TIGR028132582 TIGR02813, omega_3_PfaA, polyketide-type polyunsat 1e-07
COG1028251 COG1028, FabG, Dehydrogenases with different speci 1e-06
smart0082386 smart00823, PKS_PP, Phosphopantetheine attachment 4e-06
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 2e-05
cd05233234 cd05233, SDR_c, classical (c) SDRs 2e-05
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 4e-05
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 1e-04
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 1e-04
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 1e-04
cd00829375 cd00829, SCP-x_thiolase, Thiolase domain associate 2e-04
pfam00108262 pfam00108, Thiolase_N, Thiolase, N-terminal domain 4e-04
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 0.001
COG0183392 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid 0.001
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 0.002
COG023680 COG0236, AcpP, Acyl carrier protein [Lipid metabol 0.002
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.003
pfam01370233 pfam01370, Epimerase, NAD dependent epimerase/dehy 0.003
>gnl|CDD|238429 cd00833, PKS, polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
 Score =  585 bits (1511), Expect = 0.0
 Identities = 202/422 (47%), Positives = 271/422 (64%), Gaps = 10/422 (2%)

Query: 465 IAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYG 524
           IAI+GM+ RFP A + +EFW+ L+  +D ISEIPE  +D   YY +P K   K  ++  G
Sbjct: 3   IAIVGMACRFPGAADPDEFWENLLEGRDAISEIPEDRWDADGYYPDPGKP-GKTYTRRGG 61

Query: 525 SIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVE 584
            +  +D FD  FF ISP EAE MDP+QR LL+ +W ALEDAGY P  +A  + G+FVG  
Sbjct: 62  FLDDVDAFDAAFFGISPREAEAMDPQQRLLLEVAWEALEDAGYSPESLAGSRTGVFVGAS 121

Query: 585 EGSNYQDRLDQVN-------LTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHIA 637
             S+Y + L +          T T  A L+ R++YF DL+GP + ++TACSSSLVA H+A
Sbjct: 122 -SSDYLELLARDPDEIDAYAATGTSRAFLANRISYFFDLRGPSLTVDTACSSSLVALHLA 180

Query: 638 CQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVAV 697
           CQSLR  ECD A+  GVNL++SP+ ++  + AGMLSPDG+C  FD  A+G V  E V  V
Sbjct: 181 CQSLRSGECDLALVGGVNLILSPDMFVGFSKAGMLSPDGRCRPFDADADGYVRGEGVGVV 240

Query: 698 VLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDIN 757
           VLKRLS AL DGD I+A+IRGS +N DG+T GITAP+G +Q  LI+  Y ++ ++P DI+
Sbjct: 241 VLKRLSDALRDGDRIYAVIRGSAVNQDGRTKGITAPSGEAQAALIRRAYARAGVDPSDID 300

Query: 758 YIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQ 817
           Y+  HGTGT LGDP+E+ AL  VF       +   I S KSNIGH  AA+GL  LI +V 
Sbjct: 301 YVEAHGTGTPLGDPIEVEALAKVFGGSRSADQPLLIGSVKSNIGHLEAAAGLAGLIKVVL 360

Query: 818 SIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHI 877
           ++++ +IP +LH E  N  I  + SP  +    + W       R G VS+FG  GTNAH+
Sbjct: 361 ALEHGVIPPNLHFETPNPKIDFEESPLRVPTEARPWPAPAGPRRAG-VSSFGFGGTNAHV 419

Query: 878 VL 879
           +L
Sbjct: 420 IL 421


PKSs can be divided into 2 groups, modular type I PKSs consisting of one or more large multifunctional proteins and iterative type II PKSs, complexes of several monofunctional subunits. Length = 421

>gnl|CDD|225858 COG3321, COG3321, Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|214836 smart00825, PKS_KS, Beta-ketoacyl synthase Back     alignment and domain information
>gnl|CDD|215723 pfam00109, ketoacyl-synt, Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238421 cd00825, decarbox_cond_enzymes, decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|238430 cd00834, KAS_I_II, Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|223381 COG0304, FabB, 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|217236 pfam02801, Ketoacyl-synt_C, Beta-ketoacyl synthase, C-terminal domain Back     alignment and domain information
>gnl|CDD|238424 cd00828, elong_cond_enzymes, "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>gnl|CDD|238201 cd00327, cond_enzymes, Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases Back     alignment and domain information
>gnl|CDD|219957 pfam08659, KR, KR domain Back     alignment and domain information
>gnl|CDD|235653 PRK05952, PRK05952, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|200247 TIGR03150, fabF, beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>gnl|CDD|240245 PTZ00050, PTZ00050, 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>gnl|CDD|235781 PRK06333, PRK06333, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|235987 PRK07314, PRK07314, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|180839 PRK07103, PRK07103, polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>gnl|CDD|235817 PRK06501, PRK06501, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|215449 PLN02836, PLN02836, 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>gnl|CDD|173154 PRK14691, PRK14691, 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>gnl|CDD|187658 cd08955, KR_2_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 2, complex (x) Back     alignment and domain information
>gnl|CDD|181657 PRK09116, PRK09116, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|236129 PRK07910, PRK07910, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|187582 cd05274, KR_FAS_SDR_x, ketoreductase (KR) and fatty acid synthase (FAS), complex (x) SDRs Back     alignment and domain information
>gnl|CDD|181539 PRK08722, PRK08722, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|215421 PLN02787, PLN02787, 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>gnl|CDD|181184 PRK07967, PRK07967, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>gnl|CDD|236265 PRK08439, PRK08439, 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>gnl|CDD|238428 cd00832, CLF, Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>gnl|CDD|236398 PRK09185, PRK09185, 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>gnl|CDD|187657 cd08954, KR_1_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 1, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|215989 pfam00550, PP-binding, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|187659 cd08956, KR_3_FAS_SDR_x, beta-ketoacyl reductase (KR) domain of fatty acid synthase (FAS), subgroup 3, complex (x) Back     alignment and domain information
>gnl|CDD|234022 TIGR02813, omega_3_PfaA, polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|214834 smart00823, PKS_PP, Phosphopantetheine attachment site Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|238425 cd00829, SCP-x_thiolase, Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>gnl|CDD|215722 pfam00108, Thiolase_N, Thiolase, N-terminal domain Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|223261 COG0183, PaaJ, Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|223314 COG0236, AcpP, Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|216461 pfam01370, Epimerase, NAD dependent epimerase/dehydratase family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1005
COG3321 1061 Polyketide synthase modules and related proteins [ 100.0
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 100.0
KOG1202|consensus 2376 100.0
PRK08722414 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PLN02787540 3-oxoacyl-[acyl-carrier-protein] synthase II 100.0
PRK07910418 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK06333424 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
cd00832399 CLF Chain-length factor (CLF) is a factor required 100.0
PLN02836437 3-oxoacyl-[acyl-carrier-protein] synthase 100.0
PRK07314411 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK07967406 3-oxoacyl-(acyl carrier protein) synthase I; Revie 100.0
PRK08439406 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
cd00833421 PKS polyketide synthases (PKSs) polymerize simple 100.0
smart00825424 PKS_KS Beta-ketoacyl synthase. The structure of be 100.0
PRK09116405 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
TIGR03150407 fabF beta-ketoacyl-acyl-carrier-protein synthase I 100.0
KOG1394|consensus440 100.0
PTZ00050421 3-oxoacyl-acyl carrier protein synthase; Provision 100.0
cd00828407 elong_cond_enzymes "elongating" condensing enzymes 100.0
cd00834406 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) 100.0
PRK07103410 polyketide beta-ketoacyl:acyl carrier protein synt 100.0
PRK05952381 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
COG0304412 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Li 100.0
PRK06501425 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK14691342 3-oxoacyl-(acyl carrier protein) synthase II; Prov 100.0
PRK06519398 3-oxoacyl-(acyl carrier protein) synthase II; Revi 100.0
PRK09185392 3-oxoacyl-(acyl carrier protein) synthase I; Revie 100.0
PF00109254 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal 100.0
cd00825332 decarbox_cond_enzymes decarboxylating condensing e 100.0
PRK06147348 3-oxoacyl-(acyl carrier protein) synthase; Validat 100.0
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.97
cd00327254 cond_enzymes Condensing enzymes; Family of enzymes 99.96
TIGR028132582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.96
KOG1202|consensus2376 99.96
KOG1201|consensus300 99.95
KOG1200|consensus256 99.95
COG0300265 DltE Short-chain dehydrogenases of various substra 99.95
KOG1205|consensus282 99.95
PF02801119 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-termina 99.94
PRK07791286 short chain dehydrogenase; Provisional 99.92
PRK06139330 short chain dehydrogenase; Provisional 99.92
PRK05876275 short chain dehydrogenase; Provisional 99.92
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.92
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.91
PRK05872296 short chain dehydrogenase; Provisional 99.91
PRK08339263 short chain dehydrogenase; Provisional 99.91
PRK07109334 short chain dehydrogenase; Provisional 99.9
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.9
PRK08589272 short chain dehydrogenase; Validated 99.9
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.9
PRK07478254 short chain dehydrogenase; Provisional 99.9
PRK05867253 short chain dehydrogenase; Provisional 99.9
PRK07063260 short chain dehydrogenase; Provisional 99.9
PRK07677252 short chain dehydrogenase; Provisional 99.9
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.9
PRK06114254 short chain dehydrogenase; Provisional 99.9
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.9
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.9
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.9
PRK05599246 hypothetical protein; Provisional 99.9
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.9
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.9
PRK05855582 short chain dehydrogenase; Validated 99.89
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.89
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.89
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.89
PRK08251248 short chain dehydrogenase; Provisional 99.89
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.89
KOG0725|consensus270 99.89
PRK07825273 short chain dehydrogenase; Provisional 99.89
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.89
PRK07062265 short chain dehydrogenase; Provisional 99.89
PRK06484520 short chain dehydrogenase; Validated 99.89
PRK06194287 hypothetical protein; Provisional 99.89
PRK07985294 oxidoreductase; Provisional 99.89
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.89
PRK08643256 acetoin reductase; Validated 99.89
PRK08303305 short chain dehydrogenase; Provisional 99.89
PRK08862227 short chain dehydrogenase; Provisional 99.89
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.89
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.88
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.88
PRK05866293 short chain dehydrogenase; Provisional 99.88
KOG4169|consensus261 99.88
PRK12743256 oxidoreductase; Provisional 99.88
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.88
PRK07454241 short chain dehydrogenase; Provisional 99.88
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.88
PRK08267260 short chain dehydrogenase; Provisional 99.88
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.88
PRK07576264 short chain dehydrogenase; Provisional 99.88
PRK07024257 short chain dehydrogenase; Provisional 99.88
PRK06172253 short chain dehydrogenase; Provisional 99.88
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.88
PRK05650270 short chain dehydrogenase; Provisional 99.88
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.88
PRK12747252 short chain dehydrogenase; Provisional 99.88
PRK07814263 short chain dehydrogenase; Provisional 99.88
PRK07035252 short chain dehydrogenase; Provisional 99.88
PRK06128300 oxidoreductase; Provisional 99.88
PRK08265261 short chain dehydrogenase; Provisional 99.88
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.88
PRK08936261 glucose-1-dehydrogenase; Provisional 99.88
PRK09242257 tropinone reductase; Provisional 99.88
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.88
PRK07831262 short chain dehydrogenase; Provisional 99.88
PLN02253280 xanthoxin dehydrogenase 99.87
PRK06180277 short chain dehydrogenase; Provisional 99.87
PRK08278273 short chain dehydrogenase; Provisional 99.87
PRK07832272 short chain dehydrogenase; Provisional 99.87
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.87
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.87
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.87
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.87
PRK05993277 short chain dehydrogenase; Provisional 99.87
PRK05717255 oxidoreductase; Validated 99.87
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.87
PRK07890258 short chain dehydrogenase; Provisional 99.87
PRK06123248 short chain dehydrogenase; Provisional 99.87
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.87
PRK12937245 short chain dehydrogenase; Provisional 99.87
PRK08340259 glucose-1-dehydrogenase; Provisional 99.87
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.87
PRK08628258 short chain dehydrogenase; Provisional 99.87
PRK06181263 short chain dehydrogenase; Provisional 99.87
PRK08226263 short chain dehydrogenase; Provisional 99.87
PRK06398258 aldose dehydrogenase; Validated 99.87
PRK06947248 glucose-1-dehydrogenase; Provisional 99.87
PRK06179270 short chain dehydrogenase; Provisional 99.87
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.87
PRK09072263 short chain dehydrogenase; Provisional 99.87
PRK08277278 D-mannonate oxidoreductase; Provisional 99.87
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.86
PRK06138252 short chain dehydrogenase; Provisional 99.86
PRK06483236 dihydromonapterin reductase; Provisional 99.86
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.86
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.86
PRK07775274 short chain dehydrogenase; Provisional 99.86
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.86
PRK06914280 short chain dehydrogenase; Provisional 99.86
PLN02780320 ketoreductase/ oxidoreductase 99.86
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.86
PRK06182273 short chain dehydrogenase; Validated 99.86
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK06125259 short chain dehydrogenase; Provisional 99.86
PRK05693274 short chain dehydrogenase; Provisional 99.86
PRK06701290 short chain dehydrogenase; Provisional 99.86
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.86
PRK07856252 short chain dehydrogenase; Provisional 99.86
PRK08263275 short chain dehydrogenase; Provisional 99.86
PRK09134258 short chain dehydrogenase; Provisional 99.86
PRK07904253 short chain dehydrogenase; Provisional 99.86
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.86
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.86
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.85
PRK07067257 sorbitol dehydrogenase; Provisional 99.85
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.85
PRK05854313 short chain dehydrogenase; Provisional 99.85
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.85
PRK10538248 malonic semialdehyde reductase; Provisional 99.85
PRK06064389 acetyl-CoA acetyltransferase; Provisional 99.85
PRK06841255 short chain dehydrogenase; Provisional 99.85
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.85
PRK07069251 short chain dehydrogenase; Validated 99.85
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.85
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.85
PRK06500249 short chain dehydrogenase; Provisional 99.85
PRK12939250 short chain dehydrogenase; Provisional 99.85
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.85
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.85
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.85
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.84
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.84
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.84
PRK12744257 short chain dehydrogenase; Provisional 99.84
PLN00015308 protochlorophyllide reductase 99.84
PRK07774250 short chain dehydrogenase; Provisional 99.84
cd00751386 thiolase Thiolase are ubiquitous enzymes that cata 99.84
PRK07201657 short chain dehydrogenase; Provisional 99.84
PRK09186256 flagellin modification protein A; Provisional 99.84
PRK05656393 acetyl-CoA acetyltransferase; Provisional 99.84
PRK12827249 short chain dehydrogenase; Provisional 99.84
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.84
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.84
PRK12746254 short chain dehydrogenase; Provisional 99.84
PRK06198260 short chain dehydrogenase; Provisional 99.84
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.84
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.84
PRK06484520 short chain dehydrogenase; Validated 99.83
PRK06482276 short chain dehydrogenase; Provisional 99.83
KOG1210|consensus331 99.83
PRK06949258 short chain dehydrogenase; Provisional 99.83
PRK06940275 short chain dehydrogenase; Provisional 99.83
PRK06197306 short chain dehydrogenase; Provisional 99.83
PRK05875276 short chain dehydrogenase; Provisional 99.83
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.83
KOG1207|consensus245 99.83
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.83
KOG1610|consensus322 99.83
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.83
PRK08703239 short chain dehydrogenase; Provisional 99.83
PRK06057255 short chain dehydrogenase; Provisional 99.83
PRK06101240 short chain dehydrogenase; Provisional 99.83
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.83
PRK06523260 short chain dehydrogenase; Provisional 99.82
PRK07102243 short chain dehydrogenase; Provisional 99.82
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.82
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.82
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.82
PRK08324681 short chain dehydrogenase; Validated 99.82
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.82
KOG1199|consensus260 99.82
PRK07578199 short chain dehydrogenase; Provisional 99.82
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.81
PRK07326237 short chain dehydrogenase; Provisional 99.81
PRK07023243 short chain dehydrogenase; Provisional 99.81
PRK06924251 short chain dehydrogenase; Provisional 99.81
KOG1208|consensus314 99.81
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.81
PRK09291257 short chain dehydrogenase; Provisional 99.81
COG1028251 FabG Dehydrogenases with different specificities ( 99.81
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.81
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.8
PRK07577234 short chain dehydrogenase; Provisional 99.8
PRK06196315 oxidoreductase; Provisional 99.8
KOG1611|consensus249 99.8
PRK12742237 oxidoreductase; Provisional 99.8
PRK12828239 short chain dehydrogenase; Provisional 99.8
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.8
PRK07074257 short chain dehydrogenase; Provisional 99.79
PRK08017256 oxidoreductase; Provisional 99.79
TIGR01930386 AcCoA-C-Actrans acetyl-CoA acetyltransferases. Thi 99.79
PRK12829264 short chain dehydrogenase; Provisional 99.79
KOG1209|consensus289 99.78
PRK08264238 short chain dehydrogenase; Validated 99.77
PRK12578385 acetyl-CoA acetyltransferase; Provisional 99.77
PRK09135249 pteridine reductase; Provisional 99.77
PRK07041230 short chain dehydrogenase; Provisional 99.77
PRK07516389 acetyl-CoA acetyltransferase; Provisional 99.77
PRK09051394 beta-ketothiolase; Provisional 99.77
PRK05884223 short chain dehydrogenase; Provisional 99.77
PLN02644394 acetyl-CoA C-acetyltransferase 99.77
PRK12367245 short chain dehydrogenase; Provisional 99.77
PRK06633392 acetyl-CoA acetyltransferase; Provisional 99.76
PRK09009235 C factor cell-cell signaling protein; Provisional 99.76
PRK07108392 acetyl-CoA acetyltransferase; Provisional 99.76
PRK07060245 short chain dehydrogenase; Provisional 99.75
KOG1014|consensus312 99.75
TIGR02430400 pcaF beta-ketoadipyl CoA thiolase. Members of this 99.75
PRK07806248 short chain dehydrogenase; Provisional 99.74
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.74
cd00829375 SCP-x_thiolase Thiolase domain associated with ste 99.73
PRK13359400 beta-ketoadipyl CoA thiolase; Provisional 99.73
PRK07851406 acetyl-CoA acetyltransferase; Provisional 99.73
PRK09052399 acetyl-CoA acetyltransferase; Provisional 99.73
PRK08177225 short chain dehydrogenase; Provisional 99.72
PRK08219227 short chain dehydrogenase; Provisional 99.72
PRK06953222 short chain dehydrogenase; Provisional 99.72
PRK07661391 acetyl-CoA acetyltransferase; Provisional 99.72
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.71
PRK06445394 acetyl-CoA acetyltransferase; Provisional 99.71
PRK07515372 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.71
PRK08242402 acetyl-CoA acetyltransferase; Validated 99.7
PRK08256391 lipid-transfer protein; Provisional 99.7
PLN02287452 3-ketoacyl-CoA thiolase 99.7
PRK05790393 putative acyltransferase; Provisional 99.69
PRK06158384 thiolase; Provisional 99.69
PRK09050401 beta-ketoadipyl CoA thiolase; Validated 99.69
TIGR02445385 fadA fatty oxidation complex, beta subunit FadA. T 99.69
PRK06954397 acetyl-CoA acetyltransferase; Provisional 99.69
PRK08947387 fadA 3-ketoacyl-CoA thiolase; Reviewed 99.68
PRK06205404 acetyl-CoA acetyltransferase; Provisional 99.68
PRK08131401 acetyl-CoA acetyltransferase; Provisional 99.67
PRK06157398 acetyl-CoA acetyltransferase; Validated 99.67
PRK08235393 acetyl-CoA acetyltransferase; Provisional 99.67
PRK06065392 acetyl-CoA acetyltransferase; Provisional 99.67
PRK06365430 acetyl-CoA acetyltransferase; Provisional 99.67
PRK06059399 lipid-transfer protein; Provisional 99.66
PTZ00455438 3-ketoacyl-CoA thiolase; Provisional 99.66
PRK07801382 acetyl-CoA acetyltransferase; Provisional 99.66
PRK07850387 acetyl-CoA acetyltransferase; Provisional 99.66
PRK08963428 fadI 3-ketoacyl-CoA thiolase; Reviewed 99.65
PRK08142388 acetyl-CoA acetyltransferase; Provisional 99.65
PRK08313386 acetyl-CoA acetyltransferase; Provisional 99.65
KOG1204|consensus253 99.65
PRK06366388 acetyl-CoA acetyltransferase; Provisional 99.63
PRK06289403 acetyl-CoA acetyltransferase; Provisional 99.62
PRK06504390 acetyl-CoA acetyltransferase; Provisional 99.6
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.6
PRK08170426 acetyl-CoA acetyltransferase; Provisional 99.59
TIGR02446430 FadI fatty oxidation complex, beta subunit FadI. T 99.59
PRK06720169 hypothetical protein; Provisional 99.58
PRK09352319 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.57
PRK06066385 acetyl-CoA acetyltransferase; Provisional 99.56
PRK07204329 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.56
cd00826393 nondecarbox_cond_enzymes nondecarboxylating conden 99.55
PRK09268427 acetyl-CoA acetyltransferase; Provisional 99.52
PRK06690361 acetyl-CoA acetyltransferase; Provisional 99.49
PRK07855386 lipid-transfer protein; Provisional 99.48
TIGR00747318 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III 99.48
PRK06025417 acetyl-CoA acetyltransferase; Provisional 99.46
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.45
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.44
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.44
PLN03209576 translocon at the inner envelope of chloroplast su 99.43
cd00830320 KAS_III Ketoacyl-acyl carrier protein synthase III 99.43
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.43
KOG1478|consensus341 99.42
PRK08257498 acetyl-CoA acetyltransferase; Validated 99.4
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.39
PRK09258338 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.39
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.38
PRK12879325 3-oxoacyl-(acyl carrier protein) synthase III; Rev 99.38
PRK07937352 lipid-transfer protein; Provisional 99.36
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.3
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.3
PLN02896353 cinnamyl-alcohol dehydrogenase 99.3
PLN02583297 cinnamoyl-CoA reductase 99.3
PLN02214342 cinnamoyl-CoA reductase 99.29
PLN02572442 UDP-sulfoquinovose synthase 99.28
PLN02653340 GDP-mannose 4,6-dehydratase 99.24
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 99.24
PLN02240352 UDP-glucose 4-epimerase 99.24
PF0055067 PP-binding: Phosphopantetheine attachment site; In 99.22
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.22
PLN02650351 dihydroflavonol-4-reductase 99.22
cd00827324 init_cond_enzymes "initiating" condensing enzymes 99.21
PLN00198338 anthocyanidin reductase; Provisional 99.21
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 99.18
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.18
KOG1502|consensus327 99.18
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 99.17
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.16
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.16
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.15
PRK06840339 hypothetical protein; Validated 99.12
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.1
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.08
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.06
PLN02686367 cinnamoyl-CoA reductase 99.06
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.04
TIGR00748345 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase 99.04
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.03
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.01
PRK04262347 hypothetical protein; Provisional 98.99
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 98.97
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 98.97
KOG1406|consensus408 98.94
TIGR02845327 spore_V_AD stage V sporulation protein AD. Bacillu 98.93
TIGR01746367 Thioester-redct thioester reductase domain. It has 98.91
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 98.9
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.89
PRK05963326 3-oxoacyl-(acyl carrier protein) synthase II; Revi 98.89
PRK0098278 acpP acyl carrier protein; Provisional 98.87
KOG1390|consensus396 98.85
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.84
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.83
KOG1371|consensus343 98.82
PLN02427386 UDP-apiose/xylose synthase 98.82
cd00831361 CHS_like Chalcone and stilbene synthases; plant-sp 98.77
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 98.77
PRK08304337 stage V sporulation protein AD; Validated 98.73
PLN03171399 chalcone synthase-like protein; Provisional 98.72
CHL0012482 acpP acyl carrier protein; Validated 98.72
PLN02695370 GDP-D-mannose-3',5'-epimerase 98.71
PRK0588391 acyl carrier protein; Validated 98.7
PLN02260668 probable rhamnose biosynthetic enzyme 98.69
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.68
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.66
PRK1244980 acyl carrier protein; Provisional 98.66
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.65
COG0183392 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolis 98.64
TIGR01835379 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synt 98.62
PLN03169391 chalcone synthase family protein; Provisional 98.62
PRK0535082 acyl carrier protein; Provisional 98.62
PLN03170401 chalcone synthase; Provisional 98.6
PLN03172393 chalcone synthase family protein; Provisional 98.6
PRK0918489 acyl carrier protein; Provisional 98.59
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.58
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.58
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 98.57
PRK12880353 3-oxoacyl-(acyl carrier protein) synthase III; Rev 98.57
PLN03173391 chalcone synthase; Provisional 98.57
PLN02996491 fatty acyl-CoA reductase 98.55
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.55
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 98.55
TIGR0051777 acyl_carrier acyl carrier protein. S (Ser) at posi 98.54
PLN02206442 UDP-glucuronate decarboxylase 98.53
PRK11908347 NAD-dependent epimerase/dehydratase family protein 98.53
PLN03168389 chalcone synthase; Provisional 98.53
CHL00194317 ycf39 Ycf39; Provisional 98.49
smart0082386 PKS_PP Phosphopantetheine attachment site. Phospho 98.48
KOG1389|consensus435 98.47
PRK06060705 acyl-CoA synthetase; Validated 98.47
PRK12404334 stage V sporulation protein AD; Provisional 98.46
PRK07201657 short chain dehydrogenase; Provisional 98.45
PRK0708183 acyl carrier protein; Provisional 98.42
PLN02166436 dTDP-glucose 4,6-dehydratase 98.41
PRK0711779 acyl carrier protein; Validated 98.39
PRK05865854 hypothetical protein; Provisional 98.39
PRK08309177 short chain dehydrogenase; Provisional 98.33
PRK0582884 acyl carrier protein; Validated 98.31
PF00108264 Thiolase_N: Thiolase, N-terminal domain; InterPro: 98.3
COG3320382 Putative dehydrogenase domain of multifunctional n 98.29
PRK0817282 putative acyl carrier protein IacP; Validated 98.29
KOG1430|consensus361 98.29
PF08643299 DUF1776: Fungal family of unknown function (DUF177 98.28
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.27
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.26
PLN02778298 3,5-epimerase/4-reductase 98.25
PLN02503605 fatty acyl-CoA reductase 2 98.2
COG4982866 3-oxoacyl-[acyl-carrier protein] 98.19
COG023680 AcpP Acyl carrier protein [Lipid metabolism / Seco 98.19
PRK0763986 acyl carrier protein; Provisional 98.15
COG3425377 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipi 98.14
PLN02854521 3-ketoacyl-CoA synthase 98.13
TIGR02816 538 pfaB_fam PfaB family protein. The protein PfaB is 98.12
COG343374 Aryl carrier domain [Secondary metabolites biosynt 98.06
KOG1391|consensus396 98.01
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.01
PTZ00171148 acyl carrier protein; Provisional 98.0
TIGR01833454 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synth 97.99
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 97.98
PRK0508778 D-alanine--poly(phosphoribitol) ligase subunit 2; 97.88
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 97.87
PLN02260668 probable rhamnose biosynthetic enzyme 97.86
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 97.83
PLN02377502 3-ketoacyl-CoA synthase 97.81
PLN02932478 3-ketoacyl-CoA synthase 97.79
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 97.79
PRK102521296 entF enterobactin synthase subunit F; Provisional 97.78
PLN02577459 hydroxymethylglutaryl-CoA synthase 97.76
PRK0650893 acyl carrier protein; Provisional 97.75
KOG1392|consensus465 97.72
PRK12320699 hypothetical protein; Provisional 97.71
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 97.71
PRK12548289 shikimate 5-dehydrogenase; Provisional 97.7
PRK056914334 peptide synthase; Validated 97.59
KOG1221|consensus467 97.56
PRK124673956 peptide synthase; Provisional 97.54
PF02803123 Thiolase_C: Thiolase, C-terminal domain; InterPro: 97.54
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 97.53
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 97.48
PF13723218 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-termina 97.44
PLN02192511 3-ketoacyl-CoA synthase 97.42
PRK06732229 phosphopantothenate--cysteine ligase; Validated 97.41
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 97.41
KOG4022|consensus236 97.41
PRK12467 3956 peptide synthase; Provisional 97.4
PRK123165163 peptide synthase; Provisional 97.38
PRK05691 4334 peptide synthase; Validated 97.37
PLN00016378 RNA-binding protein; Provisional 97.35
TIGR0168873 dltC D-alanine--poly(phosphoribitol) ligase, subun 97.28
KOG1748|consensus131 97.26
PRK12316 5163 peptide synthase; Provisional 97.19
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.73
PF0854580 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP) 96.52
KOG0747|consensus331 96.47
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 96.41
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 96.4
PLN00415466 3-ketoacyl-CoA synthase 96.32
KOG1429|consensus350 96.31
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.22
PTZ00325321 malate dehydrogenase; Provisional 96.21
PRK09620229 hypothetical protein; Provisional 96.21
PF08392290 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase- 95.9
KOG1431|consensus315 95.86
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.73
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 95.69
PF07451329 SpoVAD: Stage V sporulation protein AD (SpoVAD); I 95.62
KOG2865|consensus391 95.59
KOG1203|consensus411 95.55
PRK14982340 acyl-ACP reductase; Provisional 95.53
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.51
KOG1372|consensus376 95.45
PLN00106323 malate dehydrogenase 95.36
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 94.88
COG3424356 BcsA Predicted naringenin-chalcone synthase [Secon 94.71
PF00195226 Chal_sti_synt_N: Chalcone and stilbene synthases, 94.65
KOG2774|consensus366 94.41
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 94.37
PF01154174 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A s 93.89
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 93.56
KOG1198|consensus347 93.35
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 92.85
PRK05086312 malate dehydrogenase; Provisional 92.79
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 92.53
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 92.47
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 92.02
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 92.0
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 91.96
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 91.84
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 91.79
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 91.55
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 90.66
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 90.48
PRK09880343 L-idonate 5-dehydrogenase; Provisional 90.37
PRK06849389 hypothetical protein; Provisional 90.12
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 89.82
>COG3321 Polyketide synthase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
Probab=100.00  E-value=1.8e-123  Score=1168.94  Aligned_cols=531  Identities=40%  Similarity=0.637  Sum_probs=498.9

Q ss_pred             CcEEEEeeccccCCCCCHHHHHHHHHcCCccccccCcccccccccccCCcCCCCCccceeeeccCCCCCCCCccCCCChh
Q psy612          463 ELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEISPL  542 (1005)
Q Consensus       463 ~~IaIvG~~~~~P~~~~~~~fw~~L~~g~~~i~~~p~~r~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~FD~~~f~is~~  542 (1005)
                      ++||||||+|||||++++++||++|.+|+++|+++|++|||++.+|++++..+++.+++||||+++++.||+.||||||+
T Consensus         4 ~~IAIiGm~~rfPga~~~~~~W~~l~~g~~~i~~ip~~rwd~~~~~~~~~~~~gk~~~~~ggfl~~~~~FD~~fFgisPr   83 (1061)
T COG3321           4 EPIAIIGMACRFPGADSPEEFWDLLKEGRDEITEVPADRWDVDAYYDPDPTVPGKSYSRWGGFLDDVDDFDALFFGISPR   83 (1061)
T ss_pred             CcEEEEeccccCCCCCCHHHHHHHHhcCCceeeecChhhhhHhhccCCccccccccccccccccCCccccCHHHcCCCHH
Confidence            34999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhccCCHHHHHHHHHHHHHHHhcCCCCCCCCCCceEEEEeeccCCcccccc------ccccccccchhHHHHHHHHHhCC
Q psy612          543 EAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQDRL------DQVNLTSTHNAILSARLAYFMDL  616 (1005)
Q Consensus       543 ea~~mdpq~rl~L~~a~~AledAG~~~~~~~~~~~Gv~~g~~~~~~~~~~~------~~~~~~~~~~~~~a~ris~~~~l  616 (1005)
                      ||+.||||||++||++|+|||||||.+..+.+++||||+|++..+|.....      ..+..+++..+++++||||+|||
T Consensus        84 EA~~mDPQqRllLe~aw~AlEdAG~~~~~l~g~~tgV~~g~~~~~y~~~~~~~~~~~~~~~~~g~~~~~~a~Risy~l~l  163 (1061)
T COG3321          84 EAEAMDPQQRLLLEVAWEALEDAGIYPDSLRGSATGVFAGASVADYLLLLLADDEAEPEYAITGNSSSVAAGRISYVLGL  163 (1061)
T ss_pred             HHHhcCchHhHHHHHHHHHHHHcCCCccccCCcceEEEEeeccCccccccccccccccceecccchhhHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999888765542      34667888889999999999999


Q ss_pred             CCCcccccccchhHHHHHHHHHHHHhcCCcCEEEEeecccCCCHHHHHHHHHcCCCCCCCCCcCCCCCCCCceecCccEE
Q psy612          617 KGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVA  696 (1005)
Q Consensus       617 ~Gps~~v~taCsSsl~Al~~A~~~l~~G~~d~alvggv~~~~~~~~~~~~~~~~~ls~~g~~~pfd~~a~G~~~gEGa~~  696 (1005)
                      +||+++|||+|||||+|+|+||++|++||||+||+||||+.++|..++.+++.|+||++|+|++||+++|||++|||+|+
T Consensus       164 ~GPs~~vdtaCSSsLvAvhlA~~sL~~Ge~d~alaGgv~l~~~p~~~~~~~~~g~ls~~g~c~~fd~~adG~v~geG~g~  243 (1061)
T COG3321         164 SGPSVTVDTACSSSLVAVHLACQSLRLGECDLALAGGVNLVLSPESSYLFSAGGMLSPDGRCKAFDADADGYVRGEGAGV  243 (1061)
T ss_pred             CCCCccccchhhHHHHHHHHHHHHHHcCCCCEEEecceEeccCCcceeeeecccCcCCCCcceecccCCCCEEEeeeEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEcccchhhcCCCceEEEEEEeeeccCCCCCCCCCCCHHHHHHHHHHHHHHcCCCCCCccEEEecCCCCCCCCHHHHHH
Q psy612          697 VVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEINA  776 (1005)
Q Consensus       697 vvLk~l~~A~~~g~~I~avI~g~~~~~dG~~~~~~~p~~~~q~~~i~~al~~agi~~~~I~yve~hgtgt~~gD~~E~~a  776 (1005)
                      |+||||++|++|||+|||||+|+++|+||++.++|+||+.+|..++++||++|||+|++|+|||+|||||++|||||+++
T Consensus       244 vvLKrl~~A~~dgd~IyavI~gsavn~dG~~~gltaP~~~aQ~~v~~~al~~a~i~p~tv~yvEaHgTGT~lGDpiE~~a  323 (1061)
T COG3321         244 VVLKRLSDAERDGDRIYAVIRGSAVNQDGRSNGLTAPNLEAQADVIREALADAGIDPATVQYVEAHGTGTPLGDPIEANA  323 (1061)
T ss_pred             EEEEEhHHHHhCCCeEEEEEEeeeeccCCCcCCCCCCCHHHHHHHHHHHHHhcCCCcccCcEEEecCCCCCCcCHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhccCCCCCCceeEeccCCCcCchhhchhhHHHHHHHHHhhcCCCCCCCCCCCcccccccCCCCeeecccccccccc
Q psy612          777 LHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTV  856 (1005)
Q Consensus       777 l~~~~~~~~~~~~~~~igsvK~~iGH~~~AaG~~~lik~~l~l~~~~ipp~~~~~~~n~~i~~~~~~~~v~~~~~~w~~~  856 (1005)
                      |.++|+... +..+|.|||+|+||||+++|||++|+||++|+|+|++|||++||++|||.++|+.+||+|+++.++|+..
T Consensus       324 L~~v~~~~~-~~~~c~iGSvKsNiGH~~~AaGiagliK~~Lal~~~~ip~~l~~~~~np~i~~~~sp~~v~~~~~~W~~~  402 (1061)
T COG3321         324 LGAVYGEGA-PAQPCAIGSVKSNIGHLEAAAGIAGLIKTALALKHGYIPPTLHFDTPNPEIDFDSSPFVVPTEATPWPTG  402 (1061)
T ss_pred             HHHHhccCC-CCCcccccccccccccHHHHHHHHHHHHHHHhhhcCccCCcCCCCCCCcCCccccCCeEeecCCcCCCCC
Confidence            999999877 6789999999999999999999999999999999999999999999999999999999999999999875


Q ss_pred             ccCccEEEEcccCCCCceEEEEEecccccccccCCCCCccCCCCeEEEEeecCCHHHHHHHHHHHHHHHHhCCCC-CHHH
Q psy612          857 NEKLRIGAVSAFGMSGTNAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTV-CIEN  935 (1005)
Q Consensus       857 ~~~~r~a~v~sfG~gG~nah~il~~~~~~~~~~~~~~~~~~~~~~~l~~lSa~~~~~l~~~~~~l~~~l~~~~~~-~l~~  935 (1005)
                      . .+|+|+||||||||||+|+|||||++...      .. ....+++|+|||||+++|+.++.+|++|++.+... +|.|
T Consensus       403 ~-~prrAgvssfG~gGtNaHvIlEe~~~~~~------~~-~~~~p~~l~lSAk~~~~L~~~a~~l~~~l~~~~~~~~l~d  474 (1061)
T COG3321         403 G-GPRRAGVSSFGFGGTNAHVILEEAPPRAE------ST-IPSSPRLLVLSAKTAERLAATAPRLADRLELQGGLLSLAD  474 (1061)
T ss_pred             C-CCceeeeeccCCCCCceEEEEeecCCccc------CC-CCCCCceeeeecCCHHHHHHHHHHHHHHHHhCcccchHHH
Confidence            4 68999999999999999999999986111      01 11122899999999999999999999999987666 9999


Q ss_pred             HHHHHHhcCCcCCcEEEEEeCCHHHHHHHHHhhhccccccccCcccc-----ccccccccCccchHHHHHhhhc
Q psy612          936 FVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKEKILHTNYLK-----GIVSHKFTSNKIIDSYINKLFY 1004 (1005)
Q Consensus       936 ~a~tl~~~r~~~~~R~a~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~-----~~~~~~f~g~g~~~~~~~~~~~ 1004 (1005)
                      +||||+.+|++|++|.++|++|++|+.+.|+.+..++..  ....+.     +++.|+|+|||+|+.+|||.||
T Consensus       475 ia~Tl~~gR~~~~~R~~~va~~~eel~~~L~~~~~~~~~--~~~~~~~~~~~~~~vfvf~gqgsq~~~mg~el~  546 (1061)
T COG3321         475 VAYTLQAGRPHFEHRLAVVANDREELEAGLRAFAAGKAK--ALSGVGADDSGKKTVFVFPGQGSQWAGMGRELY  546 (1061)
T ss_pred             HHHHHHhhhhhccceeEEEeCCHHHHHHHHHHHhcCCCC--ccceecccCCCCceEEEeCchHHHHHHHHHHHh
Confidence            999999999999999999999999999999999988543  222222     2589999999999999999998



>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PRK08722 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PLN02787 3-oxoacyl-[acyl-carrier-protein] synthase II Back     alignment and domain information
>PRK07910 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK06333 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00832 CLF Chain-length factor (CLF) is a factor required for polyketide chain initiation of aromatic antibiotic-producing polyketide synthases (PKSs) of filamentous bacteria Back     alignment and domain information
>PLN02836 3-oxoacyl-[acyl-carrier-protein] synthase Back     alignment and domain information
>PRK07314 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK07967 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PRK08439 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>cd00833 PKS polyketide synthases (PKSs) polymerize simple fatty acids into a large variety of different products, called polyketides, by successive decarboxylating Claisen condensations Back     alignment and domain information
>smart00825 PKS_KS Beta-ketoacyl synthase Back     alignment and domain information
>PRK09116 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>TIGR03150 fabF beta-ketoacyl-acyl-carrier-protein synthase II Back     alignment and domain information
>KOG1394|consensus Back     alignment and domain information
>PTZ00050 3-oxoacyl-acyl carrier protein synthase; Provisional Back     alignment and domain information
>cd00828 elong_cond_enzymes "elongating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type I and II and polyketide synthases Back     alignment and domain information
>cd00834 KAS_I_II Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II Back     alignment and domain information
>PRK07103 polyketide beta-ketoacyl:acyl carrier protein synthase; Validated Back     alignment and domain information
>PRK05952 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>COG0304 FabB 3-oxoacyl-(acyl-carrier-protein) synthase [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK06501 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK14691 3-oxoacyl-(acyl carrier protein) synthase II; Provisional Back     alignment and domain information
>PRK06519 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK09185 3-oxoacyl-(acyl carrier protein) synthase I; Reviewed Back     alignment and domain information
>PF00109 ketoacyl-synt: Beta-ketoacyl synthase, N-terminal domain; InterPro: IPR014030 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>cd00825 decarbox_cond_enzymes decarboxylating condensing enzymes; Family of enzymes that catalyze the formation of a new carbon-carbon bond by a decarboxylating Claisen-like condensation reaction Back     alignment and domain information
>PRK06147 3-oxoacyl-(acyl carrier protein) synthase; Validated Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>cd00327 cond_enzymes Condensing enzymes; Family of enzymes that catalyze a (decarboxylating or non-decarboxylating) Claisen-like condensation reaction Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PF02801 Ketoacyl-synt_C: Beta-ketoacyl synthase, C-terminal domain; InterPro: IPR014031 Beta-ketoacyl-ACP synthase 2 Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06064 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd00751 thiolase Thiolase are ubiquitous enzymes that catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05656 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01930 AcCoA-C-Actrans acetyl-CoA acetyltransferases Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12578 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07516 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09051 beta-ketothiolase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02644 acetyl-CoA C-acetyltransferase Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06633 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK07108 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>TIGR02430 pcaF beta-ketoadipyl CoA thiolase Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd00829 SCP-x_thiolase Thiolase domain associated with sterol carrier protein (SCP)-x isoform and related proteins; SCP-2 has multiple roles in intracellular lipid circulation and metabolism Back     alignment and domain information
>PRK13359 beta-ketoadipyl CoA thiolase; Provisional Back     alignment and domain information
>PRK07851 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK09052 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07661 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06445 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07515 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK08242 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08256 lipid-transfer protein; Provisional Back     alignment and domain information
>PLN02287 3-ketoacyl-CoA thiolase Back     alignment and domain information
>PRK05790 putative acyltransferase; Provisional Back     alignment and domain information
>PRK06158 thiolase; Provisional Back     alignment and domain information
>PRK09050 beta-ketoadipyl CoA thiolase; Validated Back     alignment and domain information
>TIGR02445 fadA fatty oxidation complex, beta subunit FadA Back     alignment and domain information
>PRK06954 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08947 fadA 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK06205 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08131 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06157 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>PRK08235 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06065 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06365 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06059 lipid-transfer protein; Provisional Back     alignment and domain information
>PTZ00455 3-ketoacyl-CoA thiolase; Provisional Back     alignment and domain information
>PRK07801 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07850 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08963 fadI 3-ketoacyl-CoA thiolase; Reviewed Back     alignment and domain information
>PRK08142 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK08313 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>PRK06366 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06289 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06504 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK08170 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>TIGR02446 FadI fatty oxidation complex, beta subunit FadI Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK09352 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK06066 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07204 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>cd00826 nondecarbox_cond_enzymes nondecarboxylating condensing enzymes; In general, thiolases catalyze the reversible thiolytic cleavage of 3-ketoacyl-CoA into acyl-CoA and acetyl-CoA, a 2-step reaction involving a covalent intermediate formed with a catalytic cysteine Back     alignment and domain information
>PRK09268 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK06690 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PRK07855 lipid-transfer protein; Provisional Back     alignment and domain information
>TIGR00747 fabH 3-oxoacyl-(acyl-carrier-protein) synthase III Back     alignment and domain information
>PRK06025 acetyl-CoA acetyltransferase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>cd00830 KAS_III Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>PRK08257 acetyl-CoA acetyltransferase; Validated Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK09258 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK12879 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK07937 lipid-transfer protein; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PF00550 PP-binding: Phosphopantetheine attachment site; InterPro: IPR006163 Phosphopantetheine (or pantetheine 4' phosphate) is the prosthetic group of acyl carrier proteins (ACP) in some multienzyme complexes where it serves as a 'swinging arm' for the attachment of activated fatty acid and amino-acid groups [] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>cd00827 init_cond_enzymes "initiating" condensing enzymes are a subclass of decarboxylating condensing enzymes, including beta-ketoacyl [ACP] synthase, type III and polyketide synthases, type III, which include chalcone synthase and related enzymes Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK06840 hypothetical protein; Validated Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR00748 HMG_CoA_syn_Arc hydroxymethylglutaryl-CoA synthase, putative Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK04262 hypothetical protein; Provisional Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>KOG1406|consensus Back     alignment and domain information
>TIGR02845 spore_V_AD stage V sporulation protein AD Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK05963 3-oxoacyl-(acyl carrier protein) synthase II; Reviewed Back     alignment and domain information
>PRK00982 acpP acyl carrier protein; Provisional Back     alignment and domain information
>KOG1390|consensus Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>cd00831 CHS_like Chalcone and stilbene synthases; plant-specific polyketide synthases (PKS) and related enzymes, also called type III PKSs Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK08304 stage V sporulation protein AD; Validated Back     alignment and domain information
>PLN03171 chalcone synthase-like protein; Provisional Back     alignment and domain information
>CHL00124 acpP acyl carrier protein; Validated Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK05883 acyl carrier protein; Validated Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK12449 acyl carrier protein; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0183 PaaJ Acetyl-CoA acetyltransferase [Lipid metabolism] Back     alignment and domain information
>TIGR01835 HMG-CoA-S_prok 3-hydroxy-3-methylglutaryl CoA synthase, prokaryotic clade Back     alignment and domain information
>PLN03169 chalcone synthase family protein; Provisional Back     alignment and domain information
>PRK05350 acyl carrier protein; Provisional Back     alignment and domain information
>PLN03170 chalcone synthase; Provisional Back     alignment and domain information
>PLN03172 chalcone synthase family protein; Provisional Back     alignment and domain information
>PRK09184 acyl carrier protein; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK12880 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PLN03173 chalcone synthase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>TIGR00517 acyl_carrier acyl carrier protein Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PLN03168 chalcone synthase; Provisional Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>smart00823 PKS_PP Phosphopantetheine attachment site Back     alignment and domain information
>KOG1389|consensus Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12404 stage V sporulation protein AD; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07081 acyl carrier protein; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07117 acyl carrier protein; Validated Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05828 acyl carrier protein; Validated Back     alignment and domain information
>PF00108 Thiolase_N: Thiolase, N-terminal domain; InterPro: IPR020616 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK08172 putative acyl carrier protein IacP; Validated Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>COG0236 AcpP Acyl carrier protein [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07639 acyl carrier protein; Provisional Back     alignment and domain information
>COG3425 PksG 3-hydroxy-3-methylglutaryl CoA synthase [Lipid metabolism] Back     alignment and domain information
>PLN02854 3-ketoacyl-CoA synthase Back     alignment and domain information
>TIGR02816 pfaB_fam PfaB family protein Back     alignment and domain information
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1391|consensus Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PTZ00171 acyl carrier protein; Provisional Back     alignment and domain information
>TIGR01833 HMG-CoA-S_euk 3-hydroxy-3-methylglutaryl-CoA-synthase, eukaryotic clade Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK05087 D-alanine--poly(phosphoribitol) ligase subunit 2; Validated Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PLN02377 3-ketoacyl-CoA synthase Back     alignment and domain information
>PLN02932 3-ketoacyl-CoA synthase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PLN02577 hydroxymethylglutaryl-CoA synthase Back     alignment and domain information
>PRK06508 acyl carrier protein; Provisional Back     alignment and domain information
>KOG1392|consensus Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PF02803 Thiolase_C: Thiolase, C-terminal domain; InterPro: IPR020617 Two different types of thiolase [, , ] are found both in eukaryotes and in prokaryotes: acetoacetyl-CoA thiolase (2 Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PF13723 Ketoacyl-synt_2: Beta-ketoacyl synthase, N-terminal domain Back     alignment and domain information
>PLN02192 3-ketoacyl-CoA synthase Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR01688 dltC D-alanine--poly(phosphoribitol) ligase, subunit 2 Back     alignment and domain information
>KOG1748|consensus Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PF08545 ACP_syn_III: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; InterPro: IPR013751 Fatty acid synthesis (FAS) is a vital aspect of cellular physiology which can occur by two distinct pathways Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN00415 3-ketoacyl-CoA synthase Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>PF08392 FAE1_CUT1_RppA: FAE1/Type III polyketide synthase-like protein; InterPro: IPR013601 This domain is found in proteins that are described as 3-ketoacyl-CoA synthases, type III polyketide synthases, fatty acid elongases and fatty acid condensing enzymes, and are found in both prokaryotic and eukaryotic (mainly plant) species Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF07451 SpoVAD: Stage V sporulation protein AD (SpoVAD); InterPro: IPR010894 This family contains the bacterial stage V sporulation protein AD (SpoVAD), which is approximately 340 residues long Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>COG3424 BcsA Predicted naringenin-chalcone synthase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF00195 Chal_sti_synt_N: Chalcone and stilbene synthases, N-terminal domain; InterPro: IPR001099 Synonym(s): Chalcone synthase, Flavonone synthase, 6'-deoxychalcone synthase Naringenin-chalcone synthases (2 Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF01154 HMG_CoA_synt_N: Hydroxymethylglutaryl-coenzyme A synthase N terminal; InterPro: IPR013528 Synonym(s): 3-hydroxy-3-methylglutaryl-coenzyme A synthase, HMG-CoA synthase Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1005
2qo3_A 915 Crystal Structure Of [ks3][at3] Didomain From Modul 5e-81
2hg4_A 917 Structure Of The Ketosynthase-acyltransferase Didom 1e-78
3hhd_A 965 Structure Of The Human Fatty Acid Synthase Ks-Mat D 1e-63
2vz8_A 2512 Crystal Structure Of Mammalian Fatty Acid Synthase 1e-61
2iwy_A438 Human Mitochondrial Beta-ketoacyl Acp Synthase Leng 5e-24
2c9h_A444 Structure Of Mitochondrial Beta-Ketoacyl Synthase L 7e-23
1j3n_A408 Crystal Structure Of 3-Oxoacyl-(Acyl-Carrier Protei 2e-22
1tqy_A424 The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Le 2e-20
1e5m_A416 Beta Ketoacyl Acyl Carrier Protein Synthase Ii (Kas 6e-19
3o04_A413 Crystal Structure Of The Beta-Keto-Acyl Carrier Pro 6e-18
3kzu_A428 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 9e-18
2gqd_A437 The Crystal Structure Of B-Ketoacyl-Acp Synthase Ii 8e-17
4ewg_A412 Crystal Structure Of A Beta-Ketoacyl Synthase From 1e-16
4ddo_A451 Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protei 3e-16
2gp6_A434 X-Ray Crystal Structure Of Mycobacterium Tuberculos 7e-16
4f32_A451 Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protei 9e-15
3e60_A424 Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protei 1e-14
1ox0_A430 The Crystal Structure Of Beta-Ketoacyl-[acyl Carrie 1e-14
2rjt_A428 Crystal Structure Analysis Of A Surface Entropy Red 1e-14
3u0f_A411 The Structure Of Beta-Ketoacyl Synthase From Brucel 2e-14
1w0i_A431 Arabidopsis Thaliana Mitochondrial Kas Length = 431 2e-14
3lrf_A428 Crystal Structure Of Beta-Ketoacyl Synthase From Br 3e-14
2alm_A431 Crystal Structure Analysis Of A Mutant Beta-Ketoacy 2e-13
1dd8_A406 Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Pr 4e-13
1fj4_A406 The Structure Of Beta-Ketoacyl-[acyl Carrier Protei 4e-13
1h4f_A406 E. Coli Beta-Ketoacyl [acyl Carrier Protein] Syntha 8e-13
2wgd_A416 Crystal Structure Of Kasa Of Mycobacterium Tubercul 1e-12
2byw_A418 Structure Of Escherichia Coli Beta-Ketoacyl (Acyl C 3e-12
2byz_A418 Structure Of E. Coli Kas I H298q Mutant In Complex 4e-12
2byy_A418 E. Coli Kas I H298e Mutation Length = 418 5e-12
2vb7_C406 Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Ap 7e-12
1f91_A406 Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In 7e-12
1ek4_A418 Beta-Ketoacyl [acyl Carrier Protein] Synthase I In 8e-12
1b3n_A412 Beta-Ketoacyl Carrier Protein Synthase As A Drug Ta 8e-12
3oyt_A410 1.84 Angstrom Resolution Crystal Structure Of 3-Oxo 1e-11
2gfw_A427 Structure Of Wild Type E. Coli Fabf (Kasii) Length 1e-11
2wgf_A416 Crystal Structure Of Mycobacterium Tuberculosis C17 4e-11
2gfy_A427 Structure Of E. Coli Fabf(K335a) Mutant With Covale 6e-11
3hnz_A427 Structure Of E. Coli Fabf(C163a) In Complex With Pl 2e-10
1tqy_B415 The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Le 3e-10
2gfv_A427 Structure Of E. Coli Fabf (Kasii) C163q Mutant Leng 3e-10
3slk_A795 Structure Of Ketoreductase And Enoylreductase Didom 1e-05
3zen_D3089 Cryo-em Structure Of The Mycobacterial Fatty Acid S 3e-04
>pdb|2QO3|A Chain A, Crystal Structure Of [ks3][at3] Didomain From Module 3 Of 6- Deoxyerthronolide B Synthase Length = 915 Back     alignment and structure

Iteration: 1

Score = 299 bits (766), Expect = 5e-81, Method: Compositional matrix adjust. Identities = 166/496 (33%), Positives = 272/496 (54%), Gaps = 15/496 (3%) Query: 465 IAIIGMSGRFPAARNINE-FWKILINNKDVISEIP-EKIFDW-KLYYENPIKSSNKINSK 521 IAI+ M+ R P N + W++L + +S P ++ +D +L++ +P K Sbjct: 8 IAIVSMACRLPGGVNTPQRLWELLREGGETLSGFPTDRGWDLARLHHPDPDNPGTSYVDK 67 Query: 522 WYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFV 581 G + FD FF +SP EA MDP+QR LL+ SW +E+AG P+ + G+F+ Sbjct: 68 -GGFLDDAAGFDAEFFGVSPREAAAMDPQQRLLLETSWELVENAGIDPHSLRGTATGVFL 126 Query: 582 GVE-----EGSNYQDRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLVATHI 636 GV E + + ++ ++T A+ S R++Y M L+GP ++++TACSSSLVA H+ Sbjct: 127 GVAKFGYGEDTAAAEDVEGYSVTGVAPAVASGRISYTMGLEGPSISVDTACSSSLVALHL 186 Query: 637 ACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAVVA 696 A +SLR+ E A+ G +M +P ++ + L+ DG+ F A+G SE V Sbjct: 187 AVESLRKGESSMAVVGGAAVMATPGVFVDFSRQRALAADGRSKAFGAGADGFGFSEGVTL 246 Query: 697 VVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDI 756 V+L+RLS A +G + A++RGS +N DG +NG++AP+G +Q +I+ + L P D+ Sbjct: 247 VLLERLSEARRNGHEVLAVVRGSALNQDGASNGLSAPSGPAQRRVIRQALESCGLEPGDV 306 Query: 757 NYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLV 816 + + HGTGT LGDP+E NAL D + + + S KSNIGHT AA+G+ L+ +V Sbjct: 307 DAVEAHGTGTALGDPIEANALLDTYGRDRDADRPLWLGSVKSNIGHTQAAAGVTGLLKVV 366 Query: 817 QSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAH 876 +++ +PA+LH E+ ++ + + N+ W E+ R AVSAFG+SGTNAH Sbjct: 367 LALRNGELPATLHVEEPTPHVDWSSGGVALLAGNQPWRR-GERTRRAAVSAFGISGTNAH 425 Query: 877 IVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIENF 936 ++++E + + T P +VV SA++ +L+ + QI L + + + Sbjct: 426 VIVEEAPE---REHRETTAHDGRPVPLVV-SARSTAALRAQAAQIAELLERPDA-DLAGV 480 Query: 937 VYTLMQGRHHFQYRCA 952 L R ++R A Sbjct: 481 GLGLATTRARHEHRAA 496
>pdb|2HG4|A Chain A, Structure Of The Ketosynthase-acyltransferase Didomain Of Module 5 From Debs. Length = 917 Back     alignment and structure
>pdb|3HHD|A Chain A, Structure Of The Human Fatty Acid Synthase Ks-Mat Didomain As A Framework For Inhibitor Design. Length = 965 Back     alignment and structure
>pdb|2VZ8|A Chain A, Crystal Structure Of Mammalian Fatty Acid Synthase Length = 2512 Back     alignment and structure
>pdb|2IWY|A Chain A, Human Mitochondrial Beta-ketoacyl Acp Synthase Length = 438 Back     alignment and structure
>pdb|2C9H|A Chain A, Structure Of Mitochondrial Beta-Ketoacyl Synthase Length = 444 Back     alignment and structure
>pdb|1J3N|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl-Carrier Protein) Synthase Ii From Thermus Thermophilus Hb8 Length = 408 Back     alignment and structure
>pdb|1TQY|A Chain A, The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Length = 424 Back     alignment and structure
>pdb|1E5M|A Chain A, Beta Ketoacyl Acyl Carrier Protein Synthase Ii (Kasii) From Synechocystis Sp Length = 416 Back     alignment and structure
>pdb|3O04|A Chain A, Crystal Structure Of The Beta-Keto-Acyl Carrier Protein Synthase Ii (Lmo2201) From Listeria Monocytogenes Length = 413 Back     alignment and structure
>pdb|3KZU|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase Ii From Brucella Melitensis Length = 428 Back     alignment and structure
>pdb|2GQD|A Chain A, The Crystal Structure Of B-Ketoacyl-Acp Synthase Ii (Fabf) From Staphylococcus Aureus Length = 437 Back     alignment and structure
>pdb|4EWG|A Chain A, Crystal Structure Of A Beta-Ketoacyl Synthase From Burkholderia Phymatum Stm815 Length = 412 Back     alignment and structure
>pdb|4DDO|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Synthase Ii From Burkholderia Vietnamiensis Length = 451 Back     alignment and structure
>pdb|2GP6|A Chain A, X-Ray Crystal Structure Of Mycobacterium Tuberculosis Beta- Ketoacyl Acyl Carrier Protein Synthase Ii (Mtkasb) Length = 434 Back     alignment and structure
>pdb|4F32|A Chain A, Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Synthase Ii From Burkholderia Vietnamiensis In Complex With Platencin Length = 451 Back     alignment and structure
>pdb|3E60|A Chain A, Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase Ii From Bartonella Henselae Length = 424 Back     alignment and structure
>pdb|1OX0|A Chain A, The Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase Ii From Streptococcus Pneumoniae Length = 430 Back     alignment and structure
>pdb|2RJT|A Chain A, Crystal Structure Analysis Of A Surface Entropy Reduction Mutant Of S. Pneumoniae Fabf Length = 428 Back     alignment and structure
>pdb|3U0F|A Chain A, The Structure Of Beta-Ketoacyl Synthase From Brucella Melitensis Bound To The Fragment 7-Hydroxycoumarin Length = 411 Back     alignment and structure
>pdb|1W0I|A Chain A, Arabidopsis Thaliana Mitochondrial Kas Length = 431 Back     alignment and structure
>pdb|3LRF|A Chain A, Crystal Structure Of Beta-Ketoacyl Synthase From Brucella Melitensis Length = 428 Back     alignment and structure
>pdb|2ALM|A Chain A, Crystal Structure Analysis Of A Mutant Beta-Ketoacyl-[acyl Carrier Protein] Synthase Ii From Streptococcus Pneumoniae Length = 431 Back     alignment and structure
>pdb|1DD8|A Chain A, Crystal Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase I From Escherichia Coli Length = 406 Back     alignment and structure
>pdb|1FJ4|A Chain A, The Structure Of Beta-Ketoacyl-[acyl Carrier Protein] Synthase I In Complex With Thiolactomycin, Implications For Drug Design Length = 406 Back     alignment and structure
>pdb|1H4F|A Chain A, E. Coli Beta-Ketoacyl [acyl Carrier Protein] Synthase I K328r Length = 406 Back     alignment and structure
>pdb|2WGD|A Chain A, Crystal Structure Of Kasa Of Mycobacterium Tuberculosis Length = 416 Back     alignment and structure
>pdb|2BYW|A Chain A, Structure Of Escherichia Coli Beta-Ketoacyl (Acyl Carrier Protein) Synthase I Lys328ala Mutant Length = 418 Back     alignment and structure
>pdb|2BYZ|A Chain A, Structure Of E. Coli Kas I H298q Mutant In Complex With C12 Fatty Acid Length = 418 Back     alignment and structure
>pdb|2BYY|A Chain A, E. Coli Kas I H298e Mutation Length = 418 Back     alignment and structure
>pdb|2VB7|C Chain C, Beta-Ketoacyl-Acp Synthase I (Kas) From E. Coli, Apo Structure After Soak In Peg Solution Length = 406 Back     alignment and structure
>pdb|1F91|A Chain A, Beta-Ketoacyl-[acyl-Carrier-Protein] Synthase I In Complex With C10 Fatty Acid Substrate Length = 406 Back     alignment and structure
>pdb|1EK4|A Chain A, Beta-Ketoacyl [acyl Carrier Protein] Synthase I In Complex With Dodecanoic Acid To 1.85 Resolution Length = 418 Back     alignment and structure
>pdb|1B3N|A Chain A, Beta-Ketoacyl Carrier Protein Synthase As A Drug Target, Implications From The Crystal Structure Of A Complex With The Inhibitor Cerulenin. Length = 412 Back     alignment and structure
>pdb|3OYT|A Chain A, 1.84 Angstrom Resolution Crystal Structure Of 3-Oxoacyl-(Acyl Carrier Protein) Synthase I (Fabb) From Yersinia Pestis Co92 Length = 410 Back     alignment and structure
>pdb|2GFW|A Chain A, Structure Of Wild Type E. Coli Fabf (Kasii) Length = 427 Back     alignment and structure
>pdb|2WGF|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis C171q Kasa Variant Length = 416 Back     alignment and structure
>pdb|2GFY|A Chain A, Structure Of E. Coli Fabf(K335a) Mutant With Covalently Linked Dodecanoic Acid Length = 427 Back     alignment and structure
>pdb|3HNZ|A Chain A, Structure Of E. Coli Fabf(C163a) In Complex With Platensimycin Length = 427 Back     alignment and structure
>pdb|1TQY|B Chain B, The Actinorhodin KetosynthaseCHAIN LENGTH FACTOR Length = 415 Back     alignment and structure
>pdb|2GFV|A Chain A, Structure Of E. Coli Fabf (Kasii) C163q Mutant Length = 427 Back     alignment and structure
>pdb|3SLK|A Chain A, Structure Of Ketoreductase And Enoylreductase Didomain From Modular Polyketide Synthase Length = 795 Back     alignment and structure
>pdb|3ZEN|D Chain D, Cryo-em Structure Of The Mycobacterial Fatty Acid Synthase Length = 3089 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1005
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 1e-158
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 1e-158
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 2e-16
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 1e-154
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 1e-153
4ewg_A412 Beta-ketoacyl synthase; ssgcid, structural genomic 1e-36
1e5m_A416 KAS II, beta ketoacyl acyl carrier protein synthas 1e-36
2gqd_A437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 2e-36
1tqy_B415 Actinorhodin polyketide putative beta-ketoacyl SY; 3e-36
3o04_A413 LMO2201 protein, beta-keto-acyl carrier protein sy 3e-36
1tqy_A424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 4e-35
1j3n_A408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 7e-35
2ix4_A431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 1e-34
3ho9_A427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 1e-34
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 4e-33
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 3e-23
2iwz_A438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 6e-33
1ox0_A430 Beta ketoacyl-acyl carrier protein synthase; trans 1e-32
4ddo_A451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 2e-32
2wge_A416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 5e-32
2gp6_A434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 8e-32
3mqd_A428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 1e-31
3kzu_A428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 1e-31
2vba_A406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 1e-29
3slk_A795 Polyketide synthase extender module 2; rossmann fo 2e-25
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 2e-22
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 4e-16
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 7e-18
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 1e-17
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 2e-17
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 3e-16
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 2e-15
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 1e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 6e-10
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 6e-09
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 1e-09
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 2e-08
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 9e-06
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 2e-05
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 2e-04
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 4e-04
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 9e-04
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Length = 965 Back     alignment and structure
 Score =  492 bits (1268), Expect = e-158
 Identities = 149/518 (28%), Positives = 247/518 (47%), Gaps = 63/518 (12%)

Query: 461 SEELIAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKL-YYENPIKSSNKIN 519
           + E + I GMSG+ P + N+ EFW  LI   D++++       WK   Y  P        
Sbjct: 2   TGEEVVIAGMSGKLPESENLQEFWDNLIGGVDMVTDDDR---RWKAGLYGLP-------- 50

Query: 520 SKWYGSIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGM 579
            +  G +  +  FD  FF + P +A  MDP+ R LL+ ++ A+ D G  P+ +     G+
Sbjct: 51  -RRSGKLKDLSRFDASFFGVHPKQAHTMDPQLRLLLEVTYEAIVDGGINPDSLRGTHTGV 109

Query: 580 FVGVEEGSNYQDRLDQV-------NLTSTHNAILSARLAYFMDLKGPVMAINTACSSSLV 632
           +VGV  GS   + L +        ++     A+++ RL++F D +GP +A++TACSSSL+
Sbjct: 110 WVGVS-GSETSEALSRDPETLVGYSMVGCQRAMMANRLSFFFDFRGPSIALDTACSSSLM 168

Query: 633 ATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSE 692
           A   A Q++   +C  AI  G+N+++ P   +     GMLSP+G C  FD   NG   SE
Sbjct: 169 ALQNAYQAIHSGQCPAAIVGGINVLLKPNTSVQFLRLGMLSPEGTCKAFDTAGNGYCRSE 228

Query: 693 AVVAVVLKRLSRALSDGDPIHAIIRGSGINYDG-KTNGITAPNGISQTELIKSVYKKSNL 751
            VVAV+L + S A      ++A I  +G N DG K  G+T P+G  Q +LI+S+Y+ + +
Sbjct: 229 GVVAVLLTKKSLA----RRVYATILNAGTNTDGFKEQGVTFPSGDIQEQLIRSLYQSAGV 284

Query: 752 NPEDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQ---KFCAITSNKSNIGHTFAASG 808
            PE   YI  HGTGTK+GDP E+N +              +   I S KSN+GH   ASG
Sbjct: 285 APESFEYIEAHGTGTKVGDPQELNGITR-----ALCATRQEPLLIGSTKSNMGHPEPASG 339

Query: 809 LVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWN-----TVNEKL--- 860
           L +L  ++ S+++ +   +LH    N  I                       V++ L   
Sbjct: 340 LAALAKVLLSLEHGLWAPNLHFHSPNPEI-------------PALLDGRLQVVDQPLPVR 386

Query: 861 -RIGAVSAFGMSGTNAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMK 919
                +++FG  G+N HI+L+                 +    ++  S +T  ++++ ++
Sbjct: 387 GGNVGINSFGFGGSNVHIILRPNTQP-----PPAPAPHATLPRLLRASGRTPEAVQKLLE 441

Query: 920 QILLFLRKNNTVCIENFVYTLMQGRHHFQYRCAIIISS 957
           Q L   +    + + N +  +        +R   ++  
Sbjct: 442 QGLRHSQDLAFLSMLNDIAAV--PATAMPFRGYAVLGG 477


>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Length = 917 Back     alignment and structure
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Length = 915 Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Length = 412 Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Length = 416 Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Length = 437 Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Length = 415 Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Length = 413 Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Length = 424 Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Length = 408 Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Length = 431 Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Length = 427 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Length = 438 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Length = 430 Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Length = 451 Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Length = 416 Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Length = 434 Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Length = 428 Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Length = 428 Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Length = 406 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Length = 1878 Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Length = 525 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Length = 1887 Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Length = 496 Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Length = 486 Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Length = 511 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Length = 212 Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Length = 88 Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Length = 89 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Length = 317 Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Length = 99 Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Length = 312 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Length = 342 Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1005
2qo3_A 915 Eryaii erythromycin polyketide synthase modules 3; 100.0
2hg4_A 917 DEBS, 6-deoxyerythronolide B synthase; ketosynthas 100.0
3hhd_A 965 Fatty acid synthase; transferase, multienzyme, meg 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 100.0
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 100.0
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 100.0
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 100.0
3zen_D3089 Fatty acid synthase; transferase, mycolic acid bio 100.0
2iwz_A438 3-oxoacyl-[acyl-carrier-protein] synthase; mitocho 100.0
3ho9_A427 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, 100.0
1tqy_A424 Beta-ketoacyl synthase/acyl transferase; alpha-bet 100.0
1tqy_B415 Actinorhodin polyketide putative beta-ketoacyl SY; 100.0
1e5m_A416 KAS II, beta ketoacyl acyl carrier protein synthas 100.0
2gqd_A437 3-oxoacyl-[acyl-carrier-protein] synthase 2; dupli 100.0
2vba_A406 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytop 100.0
4ewg_A412 Beta-ketoacyl synthase; ssgcid, structural genomic 100.0
3mqd_A428 Beta-ketoacyl synthase; ssgcid, ALS collaborative 100.0
3o04_A413 LMO2201 protein, beta-keto-acyl carrier protein sy 100.0
2gp6_A434 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiol 100.0
2ix4_A431 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ke 100.0
2wge_A416 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta 100.0
1j3n_A408 3-oxoacyl-(acyl-carrier protein) synthase II; cond 100.0
1ox0_A430 Beta ketoacyl-acyl carrier protein synthase; trans 100.0
3kzu_A428 3-oxoacyl-(acyl-carrier-protein) synthase II; seat 100.0
4ddo_A451 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgci 100.0
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 100.0
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 100.0
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 100.0
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 100.0
2vz8_A2512 Fatty acid synthase; transferase, phosphopantethei 100.0
1wdk_C390 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrame 100.0
1wl4_A397 Acetyl-coenzyme A acetyltransferase 2; thiolase fo 100.0
2vu1_A392 Acetyl-COA acetyltransferase; acyltransferase, PHB 99.97
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.97
1ulq_A401 Putative acetyl-COA acetyltransferase; structural 99.97
2wu9_A442 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine o 99.97
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.97
2ib8_A395 Acetyl-COA acetyltransferase; thiolase fold, potas 99.97
2iik_A418 3-ketoacyl-COA thiolase, peroxisomal; fatty acid m 99.97
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.97
4dd5_A396 Acetyl-COA acetyltransferase; structural genomics, 99.97
4egv_A520 Acetyl-COA acetyltransferase; NEW SUB-family, thio 99.97
3goa_A387 3-ketoacyl-COA thiolase; metabolism, fatty acid, p 99.96
3ss6_A394 Acetyl-COA acetyltransferase; structural genomics, 99.96
4e1l_A395 Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, 99.96
1ub7_A322 3-oxoacyl-[acyl-carrier protein] synthase; fatty a 99.96
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.96
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.96
1afw_A393 3-ketoacetyl-COA thiolase; fatty acid metabolism; 99.96
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.96
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.96
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.96
1hnj_A317 Beta-ketoacyl-acyl carrier protein synthase III; F 99.95
2ebd_A309 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.95
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.95
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.95
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.95
1mzj_A339 Beta-ketoacylsynthase III; beta-ketosynthase, arom 99.95
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.94
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.94
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.94
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.94
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.94
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.94
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.94
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.94
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.94
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.94
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.94
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.94
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.94
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.94
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.94
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.94
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.94
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.94
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.94
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.94
3rih_A293 Short chain dehydrogenase or reductase; structural 99.94
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.94
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.94
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.94
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.94
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.94
3svk_A407 Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, 99.94
1zow_A313 3-oxoacyl-[acyl-carrier-protein] synthase III; FAB 99.94
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.94
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.94
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.93
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.93
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.93
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.93
3tox_A280 Short chain dehydrogenase; structural genomics, PS 99.93
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.93
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.93
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.93
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.93
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.93
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.93
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 99.93
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.93
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.93
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 99.93
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.93
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.93
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.93
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.93
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.93
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.93
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.93
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.93
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.93
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.93
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.93
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.93
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.93
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.93
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.93
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.93
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.93
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.93
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.93
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.93
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.93
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.93
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.93
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.93
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.93
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.92
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.92
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.92
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.92
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.92
2x3e_A331 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, 99.92
3cxt_A291 Dehydrogenase with different specificities; rossma 99.92
1u6e_A335 3-oxoacyl-[acyl-carrier-protein] synthase III; tra 99.92
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.92
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.92
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.92
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.92
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.92
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.92
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.92
1u0m_A382 Putative polyketide synthase; type III polyketide 99.92
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.92
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.92
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.92
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.92
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.92
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.92
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.92
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.92
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.92
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.92
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.92
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.92
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.92
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.92
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.92
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.92
1xkq_A280 Short-chain reductase family member (5D234); parra 99.92
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.92
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.92
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.92
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.92
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.91
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.91
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.91
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.91
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.91
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.91
2h84_A374 Steely1; thiolase-fold, type III polyketide syntha 99.91
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.91
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.91
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.91
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.91
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.91
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.91
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.91
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.91
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.91
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.91
1spx_A278 Short-chain reductase family member (5L265); paral 99.91
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.91
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.91
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.91
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.91
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.91
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.91
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.91
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.91
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.91
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.9
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.9
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.9
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.9
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.9
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.9
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.9
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.9
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.9
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.9
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.9
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.9
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.9
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.9
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.9
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.9
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.9
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.9
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.9
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.9
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.9
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.9
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.9
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.9
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.9
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.9
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.9
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.9
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.9
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.9
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.9
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.9
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.9
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.9
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.9
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.89
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.89
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.89
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.89
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.89
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.89
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.89
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.89
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.89
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.89
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.89
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.88
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.88
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.88
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.88
4e4y_A244 Short chain dehydrogenase family protein; structur 99.88
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.88
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.88
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.88
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.88
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.87
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.87
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.87
3oml_A613 GH14720P, peroxisomal multifunctional enzyme type 99.87
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.87
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.86
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.86
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.86
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.86
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.86
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.86
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.86
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.85
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.85
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.84
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.83
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.81
3s21_A345 3-oxoacyl-[ACP] synthase III; non-decarboxylative 99.81
3tzy_A 491 Polyketide synthase PKS13; acyltransferase, long f 99.81
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.81
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.8
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 99.8
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.79
3tsy_A979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.78
1ted_A393 PKS18; thiolase fold, substrate binding tunnel, tr 99.77
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.77
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.69
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.67
2d3m_A406 Pentaketide chromone synthase; chalcone synthase, 99.63
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.59
3a5r_A387 Benzalacetone synthase; chalcone synthase, type II 99.59
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.56
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.54
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.53
1xes_A413 Dihydropinosylvin synthase; native structure, tran 99.51
4amm_A 401 DYNE8; transferase; 1.40A {Micromonospora chersina 99.51
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.51
1ee0_A402 2-pyrone synthase; polyketide synthase, thiolase f 99.5
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.5
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.49
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.49
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.49
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.48
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.47
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.47
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.47
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.46
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.46
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.46
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.45
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.45
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.45
1xq6_A253 Unknown protein; structural genomics, protein stru 99.44
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.44
1xpm_A396 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA s 99.44
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.44
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.43
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.43
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.43
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.43
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.43
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.42
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.42
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.42
3led_A392 3-oxoacyl-acyl carrier protein synthase III; struc 99.42
1i88_A389 CHS2, chalcone synthase 2; polyketide synthase, tr 99.42
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.41
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.4
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.4
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.4
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.4
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.4
3h78_A359 PQS biosynthetic enzyme; PQSD, anthranilic acid, a 99.4
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.4
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.38
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.38
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.38
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.37
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.37
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.36
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 99.36
2f82_A450 HMG-COA synthase; HMGS1, transferase; 2.10A {Brass 99.35
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.34
4efi_A354 3-oxoacyl-(acyl-carrier protein) synthase; structu 99.34
3awk_A402 Chalcone synthase-like polyketide synthase; type I 99.34
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.34
3ov2_A393 Curcumin synthase; type III polyketide synthase, t 99.33
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.33
3il6_A321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 99.32
3s3l_A357 CERJ; acyltransferase, FABH homologue, KS III homo 99.31
2ju1_A95 Erythronolide synthase; carrier protein domain, mo 99.31
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.31
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.31
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.31
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.3
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.3
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.29
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.29
2p0u_A413 Stilbenecarboxylate synthase 2; polyketide synthas 99.29
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.28
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.28
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.27
2afd_A88 Protein ASL1650; twisted antiparallel helical bund 99.27
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.27
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.26
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.25
1z45_A699 GAL10 bifunctional protein; epimerase, mutarotase, 99.24
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.24
4i4d_A93 Peptide synthetase NRPS type II-PCP; structural ge 99.23
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.23
2kr5_A89 PKS, aflatoxin biosynthesis polyketide synthase; a 99.23
2liu_A99 CURA; holo state, transferase; NMR {Lyngbya majusc 99.23
3oit_A387 OS07G0271500 protein; type III polyketide synthase 99.22
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.22
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.21
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.2
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.18
1dny_A91 Non-ribosomal peptide synthetase peptidyl carrier 99.17
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.15
2cg5_B91 Fatty acid synthase; transferase-hydrolase complex 99.13
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.13
2ava_A82 ACP I, acyl carrier protein I, chloroplast; four-h 99.11
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.1
1l0i_A78 Acyl carrier protein; acyl chain binding, fatty ac 99.1
2ehs_A77 ACP, acyl carrier protein; lipid transport, struct 99.1
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.1
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.09
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.08
2lol_A81 ACP, acyl carrier protein; lipid transport; NMR {R 99.07
3lma_A347 Stage V sporulation protein AD (spovad); NESG, str 99.07
1x3o_A80 Acyl carrier protein; structural genomics, riken s 99.07
2cnr_A82 FAS, ACP, acyl carrier protein; polykdetide, phosp 99.06
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.06
2kjs_A87 Putative acyl carrier protein; alpha, ACP, PNS, st 99.06
2qnw_A82 Acyl carrier protein; malaria, SGC, structural gen 99.04
3euo_A379 Type III pentaketide synthase; alpha helix, acyltr 99.04
2cq8_A110 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH 99.03
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 99.03
4ewp_A350 3-oxoacyl-[acyl-carrier-protein] synthase 3; trans 99.03
2kwl_A84 ACP, acyl carrier protein; structural genomics, se 99.01
1f80_D81 Acyl carrier protein; transferase; HET: PN2; 2.30A 99.01
3gzm_A81 Acyl carrier protein; helix bundle, phosphopanteth 99.0
1vku_A100 Acyl carrier protein; TM0175, structural genomics, 99.0
3e1h_A465 PKSIIINC, putative uncharacterized protein; resorc 99.0
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 98.99
1or5_A83 Acyl carrier protein; ACP, biosynthesis, frenolici 98.98
2wm3_A299 NMRA-like family domain containing protein 1; unkn 98.98
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 98.98
2dnw_A99 Acyl carrier protein; ACP, fatty acid biosynthesis 98.97
1af8_A86 Actinorhodin polyketide synthase acyl carrier Pro; 98.96
2l22_A212 Mupirocin didomain acyl carrier protein; biosynthe 98.96
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 98.94
1nq4_A95 Oxytetracycline polyketide synthase acyl carrier p 98.92
1klp_A115 ACP, ACPM, meromycolate extension acyl carrier pro 98.9
3v7i_A413 Putative polyketide synthase; type III polyketide 98.89
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 98.89
3v4n_A388 HMG-COA synthase; hydroxymethylglutaryl-COA syntha 98.89
2l3v_A79 ACP, acyl carrier protein; structural genomi seatt 98.89
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 98.87
3ejb_A97 Acyl carrier protein; protein-protein complex, cyt 98.87
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.84
2l4b_A88 Acyl carrier protein; infectious disease, human gr 98.84
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 98.83
2kw2_A101 Specialized acyl carrier protein; structural genom 98.83
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 98.82
2lte_A103 Specialized acyl carrier protein; APO protein, tra 98.31
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 98.81
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.8
4dxe_H101 ACP, acyl carrier protein; acyl-carrier-protein sy 98.8
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.77
2p8u_A478 Hydroxymethylglutaryl-COA synthase, cytoplasmic; h 98.76
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.75
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.73
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.73
3sqz_A425 Putative hydroxymethylglutaryl-COA synthase; thiol 98.71
2jq4_A105 AGR_C_4658P, hypothetical protein ATU2571; ATC2521 98.66
2amw_A83 Hypothetical protein NE2163; all helical protein, 98.65
1dv5_A80 APO-DCP, APO-D-alanyl carrier protein; 3-helix bun 98.63
2v4w_A460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 98.63
3ius_A286 Uncharacterized conserved protein; APC63810, silic 98.62
3tej_A329 Enterobactin synthase component F; nonribosomal pe 98.61
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.61
3ce7_A107 Specific mitochodrial acyl carrier protein; malari 98.43
2lki_A105 Putative uncharacterized protein; helical bundle, 98.42
2kci_A87 Putative acyl carrier protein; alpha, ACP, PCP, st 98.37
1fh1_A92 NODF, nodulation protein F; ROOT nodulation factor 98.37
2l9f_A102 CALE8, meacp; transferase, acyl carrier protein; N 98.36
2jgp_A520 Tyrocidine synthetase 3; multifunctional enzyme, a 98.3
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 98.28
2cgq_A113 Acyl carrier protein ACPA; RV0033, protein transpo 98.25
2fq1_A287 Isochorismatase; ENTB, NRPS, multi-domain, ACP, hy 98.22
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 98.19
4f6l_B508 AUSA reductase domain protein; thioester reductase 98.18
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 98.12
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 98.11
2vsq_A1304 Surfactin synthetase subunit 3; ligase, peptidyl c 98.02
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 98.0
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 97.99
2wya_A460 Hydroxymethylglutaryl-COA synthase, mitochondrial; 97.95
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.72
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 97.59
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.55
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.54
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 97.46
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 97.15
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 96.99
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 96.97
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 96.92
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 96.89
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 96.88
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 96.88
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 96.87
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 96.81
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 96.76
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 96.7
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 96.57
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 96.53
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 96.45
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 96.42
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 96.32
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 96.15
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 96.14
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.08
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 96.07
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 96.06
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.06
3krt_A456 Crotonyl COA reductase; structural genomics, prote 96.03
3gms_A340 Putative NADPH:quinone reductase; structural genom 96.01
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.96
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 95.85
4eye_A342 Probable oxidoreductase; structural genomics, niai 95.72
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 95.65
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 95.45
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 95.4
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 95.39
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 95.37
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 95.3
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 95.25
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 95.22
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 95.17
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 95.08
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 95.04
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 95.0
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 94.92
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 94.82
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 94.78
3fbg_A346 Putative arginate lyase; structural genomics, unkn 94.71
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 94.69
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 94.6
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 94.46
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 94.2
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 94.08
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 93.83
>2qo3_A Eryaii erythromycin polyketide synthase modules 3; ketosynthase, acyltransferase, phosphopantetheine, transfera; 2.59A {Saccharopolyspora erythraea} Back     alignment and structure
Probab=100.00  E-value=2.6e-107  Score=1022.71  Aligned_cols=537  Identities=31%  Similarity=0.497  Sum_probs=490.3

Q ss_pred             cCcEEEEeeccccCCC-CCHHHHHHHHHcCCccccccCccc-ccccccccCCcCCCCCccceeeeccCCCCCCCCccCCC
Q psy612          462 EELIAIIGMSGRFPAA-RNINEFWKILINNKDVISEIPEKI-FDWKLYYENPIKSSNKINSKWYGSIPGIDEFDPLFFEI  539 (1005)
Q Consensus       462 ~~~IaIvG~~~~~P~~-~~~~~fw~~L~~g~~~i~~~p~~r-~~~~~~~~~~~~~~~~~~~~~~g~~~~~~~FD~~~f~i  539 (1005)
                      +++||||||+||||++ .++++||++|.+|+++++++|++| |+...+|++++...++.+++++||+++++.||+.||||
T Consensus         5 ~~~iaIvG~~~~~P~g~~~~~~~w~~L~~g~~~~~~~p~~r~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~FD~~~f~i   84 (915)
T 2qo3_A            5 SDPIAIVSMACRLPGGVNTPQRLWELLREGGETLSGFPTDRGWDLARLHHPDPDNPGTSYVDKGGFLDDAAGFDAEFFGV   84 (915)
T ss_dssp             CCCEEEEEEEEECSTTCCSHHHHHHHHHTTCCCCEECCSSSCCCHHHHBCSCTTSTTCBSCCEEBCCSCSSEECHHHHTC
T ss_pred             CCCEEEEeeEEECCCCCCCHHHHHHHHHcCCCcccCCCccccCChhhccCcccccCCCcccceeEEeCCccccCHhhcCC
Confidence            5789999999999997 999999999999999999999999 99999999888888999999999999999999999999


Q ss_pred             ChhhhccCCHHHHHHHHHHHHHHHhcCCCCCCCCCCceEEEEeeccCCccc-----cccccccccccchhHHHHHHHHHh
Q psy612          540 SPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVEEGSNYQ-----DRLDQVNLTSTHNAILSARLAYFM  614 (1005)
Q Consensus       540 s~~ea~~mdpq~rl~L~~a~~AledAG~~~~~~~~~~~Gv~~g~~~~~~~~-----~~~~~~~~~~~~~~~~a~ris~~~  614 (1005)
                      +|+|++.||||||++|+++|+|||||||+++++++.+||||+|++..+|..     ..++++.++++..+++++||||.|
T Consensus        85 ~~~ea~~mdp~~rL~leaa~eALedAGi~~~~i~~~~~gV~vG~~~~~~~~~~~~~~~~~~~~~~g~~~~~~a~ris~~l  164 (915)
T 2qo3_A           85 SPREAAAMDPQQRLLLETSWELVENAGIDPHSLRGTATGVFLGVAKFGYGEDTAAAEDVEGYSVTGVAPAVASGRISYTM  164 (915)
T ss_dssp             CHHHHHTSCHHHHHHHHHHHHHHHHTTCCGGGGTTBCCEEEEECCCCCTTTTCC---CTTCHHHHTTCHHHHHHHHHHHH
T ss_pred             CHHHHHhCCHHHHHHHHHHHHHHHHcCCChHHcCCcceEEEEEecCchHHhhhcccccccccccccccccHHHHHHHHHh
Confidence            999999999999999999999999999999999999999999988776642     223445567778889999999999


Q ss_pred             CCCCCcccccccchhHHHHHHHHHHHHhcCCcCEEEEeecccCCCHHHHHHHHHcCCCCCCCCCcCCCCCCCCceecCcc
Q psy612          615 DLKGPVMAINTACSSSLVATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLSPDGKCYVFDERANGLVPSEAV  694 (1005)
Q Consensus       615 ~l~Gps~~v~taCsSsl~Al~~A~~~l~~G~~d~alvggv~~~~~~~~~~~~~~~~~ls~~g~~~pfd~~a~G~~~gEGa  694 (1005)
                      ||+||+++|+|+||||++|||+||++|++|+||+|||||++.+++|..+..|..++++|++|+|+|||.++|||++|||+
T Consensus       165 gl~Gps~tv~taCsSsl~Al~~A~~~I~~G~~d~aLvgGve~~~~p~~~~~~~~~~~ls~~g~~~~Fd~~adG~v~gEGa  244 (915)
T 2qo3_A          165 GLEGPSISVDTACSSSLVALHLAVESLRKGESSMAVVGGAAVMATPGVFVDFSRQRALAADGRSKAFGAGADGFGFSEGV  244 (915)
T ss_dssp             TBCSCEEEEECGGGHHHHHHHHHHHHHHTTSCSSEEEEEEECCSSTHHHHHHHTTTCBCSSCCCCTTBTTCCCBCBBCEE
T ss_pred             CCCCCEEEECCCCHHHHHHHHHHHHHHHcCCCCEEEEeEehhhcCHHHHHHHhhhcccCCCCCcccccCCCCceeecCce
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEcccchhhcCCCceEEEEEEeeeccCCCCCCCCCCCHHHHHHHHHHHHHHcCCCCCCccEEEecCCCCCCCCHHHH
Q psy612          695 VAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNPEDINYIITHGTGTKLGDPVEI  774 (1005)
Q Consensus       695 ~~vvLk~l~~A~~~g~~I~avI~g~~~~~dG~~~~~~~p~~~~q~~~i~~al~~agi~~~~I~yve~hgtgt~~gD~~E~  774 (1005)
                      |+||||++++|+++|++|||+|+|+++|+||++.+++.|++.+|.++|++||++||++|+||+|||+|||||++||++|.
T Consensus       245 gavVL~~~~~A~~~g~~i~a~I~G~~~~~dg~~~~~~~p~~~~~~~~i~~Al~~Agl~p~dId~ve~HgtgT~~gD~~E~  324 (915)
T 2qo3_A          245 TLVLLERLSEARRNGHEVLAVVRGSALNQDGASNGLSAPSGPAQRRVIRQALESCGLEPGDVDAVEAHGTGTALGDPIEA  324 (915)
T ss_dssp             EEEEEEEHHHHHHTTCCCCEEEEEEEEEECCSCSSTTCCCHHHHHHHHHHHHHHTTCCGGGCCEEECCCCCCTTTHHHHH
T ss_pred             EEEEEeEhHHhhhCCCCeEEEEEEEEEecCCCccCCCCCCHHHHHHHHHHHHHHcCCCHHHCcEEEecCCCCccCCHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhccCCCCCCceeEeccCCCcCchhhchhhHHHHHHHHHhhcCCCCCCCCCCCcccccccCCCCeeecccccccc
Q psy612          775 NALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKENNYIILKNSPFYINKSNKKWN  854 (1005)
Q Consensus       775 ~al~~~~~~~~~~~~~~~igsvK~~iGH~~~AaG~~~lik~~l~l~~~~ipp~~~~~~~n~~i~~~~~~~~v~~~~~~w~  854 (1005)
                      .+|.++|+.......+|+|||+|+||||+++|||++++||++++|+|++|||++||++|||.|++++++|+++++.++|+
T Consensus       325 ~al~~~f~~~~~~~~~~~vgs~K~~iGH~~~AaG~~~lik~~l~L~~~~ipp~~~~~~~~p~~~~~~~~~~~~~~~~~w~  404 (915)
T 2qo3_A          325 NALLDTYGRDRDADRPLWLGSVKSNIGHTQAAAGVTGLLKVVLALRNGELPATLHVEEPTPHVDWSSGGVALLAGNQPWR  404 (915)
T ss_dssp             HHHHHHTSSSCCTTSCEEEECTHHHHCBCGGGHHHHHHHHHHHHHHHTEECCCSSCSSBCTTSCCSSSSEEECSSCEECC
T ss_pred             HHHHHHhccccCCCCcccccCcccceeCCccccchHHHHHHHHHHhcCCCCCCCCCCCCCcccccccCceeeecCCcccc
Confidence            99999998765556789999999999999999999999999999999999999999999999999999999999999997


Q ss_pred             ccccCccEEEEcccCCCCceEEEEEecccccccccCCCCCccCCCCeEEEEeecCCHHHHHHHHHHHHHHHHhCCCCCHH
Q psy612          855 TVNEKLRIGAVSAFGMSGTNAHIVLQEYISTNFKNIKNNTFISSNPYHMVVLSAKTKISLKEKMKQILLFLRKNNTVCIE  934 (1005)
Q Consensus       855 ~~~~~~r~a~v~sfG~gG~nah~il~~~~~~~~~~~~~~~~~~~~~~~l~~lSa~~~~~l~~~~~~l~~~l~~~~~~~l~  934 (1005)
                      .. ..+|+++||||||||+|+|+|||+++......    ......+..+|+|||+|+++|++++++|.+||+ +++..|.
T Consensus       405 ~~-~~~r~a~v~sfG~gG~Nah~vl~~~~~~~~~~----~~~~~~~~~~~~lsa~~~~~l~~~~~~~~~~l~-~~~~~l~  478 (915)
T 2qo3_A          405 RG-ERTRRAAVSAFGISGTNAHVIVEEAPEREHRE----TTAHDGRPVPLVVSARSTAALRAQAAQIAELLE-RPDADLA  478 (915)
T ss_dssp             SS-SSCCEEEEEEECTTSEEEEEEEEECCC------------CCSSCEEEEEEESSHHHHHHHHHHHHHHTT-SSSCCHH
T ss_pred             cC-CCCcEEEEeeecCCCceEEEEEeecccccccc----ccccCCcccceeEecCCHHHHHHHHHHHHHHhc-CCccchh
Confidence            53 45789999999999999999999987532111    011122457899999999999999999999998 7778899


Q ss_pred             HHHHHHHhcCCcCCcEEEEEeCCHHHHHHHHHhhhcccccc--ccCc--cccc-cccccccCccchHHHHHhhhc
Q psy612          935 NFVYTLMQGRHHFQYRCAIIISSIEEVVKIINDTLNSKEKI--LHTN--YLKG-IVSHKFTSNKIIDSYINKLFY 1004 (1005)
Q Consensus       935 ~~a~tl~~~r~~~~~R~a~~~~~~~~l~~~l~~~~~~~~~~--~~~~--~~~~-~~~~~f~g~g~~~~~~~~~~~ 1004 (1005)
                      |+||||+++|.||+||.+++++|.+||+++|+.+..+....  ...+  ...+ ++.|+|+|||+||.||||.||
T Consensus       479 d~~~tl~~~r~~~~~r~~~~~~~~~~l~~~l~~~~~~~~~~~~~~~~~~~~~~~~vafvF~GQGsQ~~gMg~~L~  553 (915)
T 2qo3_A          479 GVGLGLATTRARHEHRAAVVASTREEAVRGLREIAAGAATADAVVEGVTEVDGRNVVFLFPGQGSQWAGMGAELL  553 (915)
T ss_dssp             HHHHHHHHSSCCCSEEEEEEESSHHHHHHHHHHHHHTCCCCTTEEEEECSCSCCCEEEEECCTTCCCTTTTHHHH
T ss_pred             HHHHHHhhcccccCceEEEEECCHHHHHHHHHHHhcCCCCccceeeccccCCCCceeeecCCCcccccchhHHHH
Confidence            99999999999999999999999999999999987763221  0001  1124 899999999999999999997



>2hg4_A DEBS, 6-deoxyerythronolide B synthase; ketosynthase, acyltransferase, module 5, transferase; 2.73A {Saccharopolyspora erythraea} Back     alignment and structure
>3hhd_A Fatty acid synthase; transferase, multienzyme, megasynthase, fatty acid synthesis, acetylation, cytoplasm, fatty acid biosynthesis, hydrolase; 2.15A {Homo sapiens} PDB: 2jfk_A* 2jfd_A Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2iwz_A 3-oxoacyl-[acyl-carrier-protein] synthase; mitochondria, mitochondrion, lipid synthesis, fatty acid SYN fatty acid biosynthesis; 1.65A {Homo sapiens} PDB: 2iwy_A 2c9h_A Back     alignment and structure
>3ho9_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; FABF, platensimycin, platencin A1, KAS2, acyltransferase, fatty acid biosynthesis; HET: N3A; 1.90A {Escherichia coli} PDB: 3hnz_A* 3ho2_A* 3i8p_A* 3g11_A* 2gfx_A* 3g0y_A* 2gfv_A* 2gfw_A 2gfy_A* 1kas_A 1b3n_A Back     alignment and structure
>1tqy_A Beta-ketoacyl synthase/acyl transferase; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1tqy_B Actinorhodin polyketide putative beta-ketoacyl SY; alpha-beta-alpha-beta-alpha, heterodimer, transferase; 2.00A {Streptomyces coelicolor} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1e5m_A KAS II, beta ketoacyl acyl carrier protein synthase II; condensing enzyme, biosynthetic role, carbon-carbon bond formation; 1.54A {Synechocystis SP} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2gqd_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; duplicated babababb fold, transferase; 2.30A {Staphylococcus aureus} Back     alignment and structure
>2vba_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; cytoplasm, antibiotic, transferase, amino-thiazole, acyltransferase, lipid synthesis; HET: P4T; 1.36A {Escherichia coli} SCOP: c.95.1.1 c.95.1.1 PDB: 1fj4_A* 1g5x_A 2aq7_A* 1fj8_A* 2aqb_A 2bui_A 2buh_A 2vb7_A* 2vb8_A 2vb9_A* 1h4f_A 1dd8_A 2cdh_A 2bz4_A 2byz_A 2bz3_A* 2byy_A* 1f91_A* 2cf2_A 2byw_A ... Back     alignment and structure
>4ewg_A Beta-ketoacyl synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, transferase; 2.25A {Burkholderia phymatum} Back     alignment and structure
>3mqd_A Beta-ketoacyl synthase; ssgcid, ALS collaborative crystallography, beta-ketoacyl SYN brucella melitensis, fragments of LIFE; HET: 3MQ; 1.25A {Brucella melitensis biovar abortus} PDB: 3lrf_A* 3u0e_A* 3u0f_A* Back     alignment and structure
>3o04_A LMO2201 protein, beta-keto-acyl carrier protein synthase II; csgid, structural genomics; 1.85A {Listeria monocytogenes} Back     alignment and structure
>2gp6_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; thiolase fold, structural genomics, PSI, protein structure initiative; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ix4_A 3-oxoacyl-[acyl-carrier-protein] synthase; beta-ketoacyl-(acyl carrier protein) synthase, lipid metabol condensing enzyme; 1.95A {Arabidopsis thaliana} SCOP: c.95.1.1 c.95.1.1 PDB: 1w0i_A Back     alignment and structure
>2wge_A 3-oxoacyl-[acyl-carrier-protein] synthase 1; beta ketoacyl synthase I thiolactomycin, cytoplasm, transferase, acyltransferase; HET: TLM; 1.80A {Mycobacterium tuberculosis} PDB: 2wgd_A* 2wgg_A* 2wgf_A* Back     alignment and structure
>1j3n_A 3-oxoacyl-(acyl-carrier protein) synthase II; condensing enzymes, fatty acid elongation, acyl-carrier protein (ACP); HET: CIT; 2.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>1ox0_A Beta ketoacyl-acyl carrier protein synthase; transferase; 1.30A {Streptococcus pneumoniae} SCOP: c.95.1.1 c.95.1.1 PDB: 1oxh_A 2alm_A 2rjt_A Back     alignment and structure
>3kzu_A 3-oxoacyl-(acyl-carrier-protein) synthase II; seattle structural genomics center for infectious disease, ssgcid, acyltransferase; 1.75A {Brucella melitensis} PDB: 3e60_A Back     alignment and structure
>4ddo_A 3-oxoacyl-[acyl-carrier-protein] synthase 2; ssgcid, struct genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia vietnamiensis} PDB: 4f32_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1wdk_C 3-ketoacyl-COA thiolase; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: c.95.1.1 c.95.1.1 PDB: 1wdl_C* 1wdm_C* 2d3t_C* Back     alignment and structure
>1wl4_A Acetyl-coenzyme A acetyltransferase 2; thiolase fold; HET: COA; 1.55A {Homo sapiens} PDB: 1wl5_A Back     alignment and structure
>2vu1_A Acetyl-COA acetyltransferase; acyltransferase, PHB biosynthesis, thiolase FOL; HET: CSO OPI; 1.51A {Zoogloea ramigera} PDB: 1nl7_A* 1ou6_A* 2vu0_A* 1m4s_A* 2vu2_A* 2wkv_A* 2wku_A* 1m1t_A 1m3k_A 1m1o_A 1m3z_A* 2vtz_A* 2wl5_A* 2wkt_A* 2wl4_A* 1m4t_A* 2wl6_A 1qfl_A* 1dlv_A* 1dlu_A* ... Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>1ulq_A Putative acetyl-COA acetyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 3.00A {Thermus thermophilus} SCOP: c.95.1.1 c.95.1.1 Back     alignment and structure
>2wu9_A 3-ketoacyl-COA thiolase 2, peroxisomal; cysteine oxidation, fatty acid metabolism, oxylipin biosynthesis, plant lipid metabolism; 1.50A {Arabidopsis thaliana} PDB: 2c7y_A 2c7z_A 2wua_A Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>2ib8_A Acetyl-COA acetyltransferase; thiolase fold, potassium ION, chloride, beta-alpha-beta-ALPH alpha-beta-BETA topology; HET: MES; 1.85A {Homo sapiens} PDB: 2ib7_A* 2ib9_A* 2ibu_A* 2ibw_A* 2iby_A* 2f2s_A* Back     alignment and structure
>2iik_A 3-ketoacyl-COA thiolase, peroxisomal; fatty acid metabolism, structural genomics, structural genom consortium, SGC, transferase; 2.55A {Homo sapiens} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>4dd5_A Acetyl-COA acetyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, thiolase; 1.25A {Clostridium difficile} Back     alignment and structure
>4egv_A Acetyl-COA acetyltransferase; NEW SUB-family, thiolase fold; 2.71A {Mycobacterium smegmatis} Back     alignment and structure
>3goa_A 3-ketoacyl-COA thiolase; metabolism, fatty acid, phospholipid, IDP01071, acyltransferase, cytoplasm, fatty acid metabolism; 1.70A {Salmonella typhimurium} Back     alignment and structure
>3ss6_A Acetyl-COA acetyltransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; HET: CSO; 1.70A {Bacillus anthracis} Back     alignment and structure
>4e1l_A Acetoacetyl-COA thiolase 2; 3-layer(ABA) sandwich, transferase; 2.00A {Clostridium difficile} Back     alignment and structure
>1ub7_A 3-oxoacyl-[acyl-carrier protein] synthase; fatty acid synthesis, beta-ketoacyl-ACP synthase III, FABH; 2.30A {Thermus thermophilus} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1afw_A 3-ketoacetyl-COA thiolase; fatty acid metabolism; 1.80A {Saccharomyces cerevisiae} SCOP: c.95.1.1 c.95.1.1 PDB: 1pxt_A Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>1hnj_A Beta-ketoacyl-acyl carrier protein synthase III; FABH, transferase; HET: MLC; 1.46A {Escherichia coli} SCOP: c.95.1.2 c.95.1.2 PDB: 1hn9_A* 1hnh_A* 1hnd_A* 1hnk_A 1mzs_A* 2eft_A* 2gyo_A* 3il9_A 1ebl_A* Back     alignment and structure
>2ebd_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, aquifex VF5, lipid metabolism, structural genomics; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1mzj_A Beta-ketoacylsynthase III; beta-ketosynthase, aromatic polyketide, biosynthetic engineering, catalytic triad, transferase; HET: COA; 2.10A {Streptomyces SP} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3svk_A Acetyl-COA acetyltransferase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium avium} Back     alignment and structure
>1zow_A 3-oxoacyl-[acyl-carrier-protein] synthase III; FABH, fatty acid biosynthesis, transferase; 2.00A {Staphylococcus aureus subsp} PDB: 3il7_A Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2x3e_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; HED, transferase, acyltransferase, lipid synthesis, multifun enzyme; 1.81A {Pseudomonas aeruginosa} Back     alignment and structure
>1u6e_A 3-oxoacyl-[acyl-carrier-protein] synthase III; transferase; 1.85A {Mycobacterium tuberculosis} SCOP: c.95.1.2 c.95.1.2 PDB: 1u6s_A* 1m1m_A 1hzp_A* 2qnx_A* 2qnz_A* 2qo1_A* 2qx1_A* 2qo0_A* 2qny_A* 2ahb_A 2aj9_A Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1u0m_A Putative polyketide synthase; type III polyketide synthase, PKS, bacterial, thiolase fold, beta-alpha-beta-alpha fold, catalytic triad; HET: 15P; 2.22A {Streptomyces coelicolor} SCOP: c.95.1.2 c.95.1.2 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2h84_A Steely1; thiolase-fold, type III polyketide synthase, PKS, chalcone-S synthase superfamily, type I PKS; HET: P6G; 2.90A {Dictyostelium discoideum} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3s21_A 3-oxoacyl-[ACP] synthase III; non-decarboxylative claisen condensation reaction, transfera; HET: CER; 1.70A {Xanthomonas campestris PV} PDB: 3s23_A* 3row_A 3s1z_A 3s20_A* 3fk5_A Back     alignment and structure
>3tzy_A Polyketide synthase PKS13; acyltransferase, long fatty acid chain transferase, acyl CAR protein, transferase; HET: PLM; 2.20A {Mycobacterium tuberculosis} PDB: 3tzw_A 3tzx_A* 3tzz_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>1ted_A PKS18; thiolase fold, substrate binding tunnel, transferase; HET: MYR; 2.25A {Mycobacterium tuberculosis} SCOP: c.95.1.2 PDB: 1tee_A Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3a5r_A Benzalacetone synthase; chalcone synthase, type III polyketide synthase, transferase, acyltransferase; HET: HC4; 1.60A {Rheum palmatum} PDB: 3a5q_A* 3a5s_A Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1xes_A Dihydropinosylvin synthase; native structure, transferase; HET: 3IO; 1.70A {Pinus sylvestris} PDB: 1xet_A* 1u0u_A Back     alignment and structure
>4amm_A DYNE8; transferase; 1.40A {Micromonospora chersina} PDB: 4amn_A 4amp_A 4amo_A Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>1xpm_A 3-hydroxy-3-methylglutaryl COA synthase; HMG-COA synthase, HMGS, coenzyme A, thiolase fold, condensing enzyme; HET: HMG CAA; 1.60A {Staphylococcus aureus subsp} SCOP: c.95.1.2 c.95.1.2 PDB: 1xpl_A* 1xpk_A* 1tvz_A 1txt_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>3led_A 3-oxoacyl-acyl carrier protein synthase III; structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.45A {Rhodopseudomonas palustris} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3h78_A PQS biosynthetic enzyme; PQSD, anthranilic acid, anthraniloyl-COA, transferase; HET: BE2; 1.70A {Pseudomonas aeruginosa PAO1} PDB: 3h76_A 3h77_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>2f82_A HMG-COA synthase; HMGS1, transferase; 2.10A {Brassica juncea} PDB: 2f9a_A* 2fa0_A* 2fa3_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>4efi_A 3-oxoacyl-(acyl-carrier protein) synthase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.35A {Burkholderia xenovorans} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3ov2_A Curcumin synthase; type III polyketide synthase, transferase; 2.32A {Curcuma longa} PDB: 3ov3_A Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>3s3l_A CERJ; acyltransferase, FABH homologue, KS III homologue, dimethyl transfer, transferase; 2.00A {Streptomyces tendae} PDB: 3t5y_A* 3t6s_A* 3t8e_A 3t5y_B* Back     alignment and structure
>2ju1_A Erythronolide synthase; carrier protein domain, modular polyketide synthase, alpha- helical bundle, acyltransferase; NMR {Saccharopolyspora erythraea} PDB: 2ju2_A Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2afd_A Protein ASL1650; twisted antiparallel helical bundle, acyl carrier protein FA structural genomics, PSI, protein structure initiative; NMR {Nostoc SP} PDB: 2afe_A Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>4i4d_A Peptide synthetase NRPS type II-PCP; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MLY; 2.10A {Streptomyces verticillus} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2kr5_A PKS, aflatoxin biosynthesis polyketide synthase; acyl carrrier protein, holo, phosphopantetheine, transport protein; HET: PNS; NMR {Aspergillus parasiticus} Back     alignment and structure
>2liu_A CURA; holo state, transferase; NMR {Lyngbya majuscula} PDB: 2liw_A* Back     alignment and structure
>3oit_A OS07G0271500 protein; type III polyketide synthases, transferase; 2.00A {Oryza sativa} PDB: 3ale_A Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1dny_A Non-ribosomal peptide synthetase peptidyl carrier protein; four-helix bundle, modular enzyme, domain, flexible region; NMR {Brevibacillus brevis} SCOP: a.28.1.2 PDB: 2gdw_A 2gdx_A 2gdy_A 2k2q_A Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2cg5_B Fatty acid synthase; transferase-hydrolase complex, transferase/hydrolase (comple fatty acid biosynthesis, phosphopantetheine transferase; HET: COA; 2.7A {Homo sapiens} PDB: 2png_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2ava_A ACP I, acyl carrier protein I, chloroplast; four-helix-bundle, biosynthetic protein; NMR {Spinacia oleracea} PDB: 2fva_A* 2fve_A 2fvf_A* 2xz0_D* 2xz1_C* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1l0i_A Acyl carrier protein; acyl chain binding, fatty acid biosynt lipid transport; HET: PSR; 1.20A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ny7_B* 2fhs_C 1l0h_A* 1acp_A 1t8k_A 2fac_A* 2fad_A* 2fae_A* 2k92_A 2k93_A 2k94_A 2l0q_A Back     alignment and structure
>2ehs_A ACP, acyl carrier protein; lipid transport, structural genomics, NPPSFA, national proje protein structural and functional analyses; 1.30A {Aquifex aeolicus} PDB: 2eht_A Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2lol_A ACP, acyl carrier protein; lipid transport; NMR {Rickettsia prowazekii str} Back     alignment and structure
>3lma_A Stage V sporulation protein AD (spovad); NESG, structural genomics, PSI-2, protein structure initiative; 1.99A {Bacillus licheniformis} PDB: 3lm6_A Back     alignment and structure
>1x3o_A Acyl carrier protein; structural genomics, riken structural genomics/proteomics in RSGI, NPPSFA; 1.50A {Thermus thermophilus} Back     alignment and structure
>2cnr_A FAS, ACP, acyl carrier protein; polykdetide, phosphopantetheine, lipid transport; NMR {Streptomyces coelicolor} PDB: 2koo_A* 2kop_A* 2koq_A* 2kor_A* 2kos_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2qnw_A Acyl carrier protein; malaria, SGC, structural genomics CONS fatty acid biosynthesis, lipid synthesis, phosphopantethein transit peptide; 1.90A {Toxoplasma gondii} Back     alignment and structure
>2cq8_A 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH, PP-binding, acyl carrier protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>4ewp_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; transferase; 2.20A {Micrococcus luteus nctc 2665} Back     alignment and structure
>2kwl_A ACP, acyl carrier protein; structural genomics, seattle structura genomics center for infectious disease, ssgcid, lipid bindi protein; NMR {Borrelia burgdorferi} Back     alignment and structure
>1f80_D Acyl carrier protein; transferase; HET: PN2; 2.30A {Bacillus subtilis} SCOP: a.28.1.1 PDB: 2x2b_A* 1hy8_A Back     alignment and structure
>3gzm_A Acyl carrier protein; helix bundle, phosphopantetheine, fatty acid biosynthesis, L synthesis, transit peptide, biosynthetic protein; HET: PNS; 1.80A {Plasmodium falciparum} SCOP: a.28.1.0 PDB: 3gzl_A* 2fq0_A* 2fq2_A* Back     alignment and structure
>1vku_A Acyl carrier protein; TM0175, structural genomics, JCSG, Pro structure initiative, PSI; 2.00A {Thermotoga maritima} SCOP: a.28.1.1 Back     alignment and structure
>3e1h_A PKSIIINC, putative uncharacterized protein; resorcinolic lipid synthase, type III PKS, acyltransferase, transferase; 2.58A {Neurospora crassa} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>1or5_A Acyl carrier protein; ACP, biosynthesis, frenolicin, holo, polyketide synthase, PKS, biosynthetic protein; NMR {Streptomyces roseofulvus} SCOP: a.28.1.1 Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2dnw_A Acyl carrier protein; ACP, fatty acid biosynthesis, mitochondria, NADH:ubiquinone oxidereductase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1af8_A Actinorhodin polyketide synthase acyl carrier Pro; acyl carrier protein, solution STR antibiotic biosynthesis; NMR {Streptomyces coelicolor} SCOP: a.28.1.1 PDB: 2af8_A 2k0x_A* 2k0y_A 2kg6_A* 2kg8_A* 2kg9_A* 2kga_A* 2kgc_A* 2kgd_A* 2kge_A* Back     alignment and structure
>2l22_A Mupirocin didomain acyl carrier protein; biosynthetic protein; NMR {Pseudomonas fluorescens} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1nq4_A Oxytetracycline polyketide synthase acyl carrier protein; solution structure, dynamics, ACP, biosynthetic protein; NMR {Streptomyces rimosus} SCOP: a.28.1.1 Back     alignment and structure
>1klp_A ACP, ACPM, meromycolate extension acyl carrier protein; four-helix bundle, ligand transport; NMR {Mycobacterium tuberculosis} SCOP: a.28.1.1 Back     alignment and structure
>3v7i_A Putative polyketide synthase; type III polyketide synthase, acyltransferase, transferase,; 2.90A {Streptomyces coelicolor} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3v4n_A HMG-COA synthase; hydroxymethylglutaryl-COA synthase, nitrosylation, transfera inhibitor complex; HET: BTB; 1.60A {Enterococcus faecalis} PDB: 3v4x_A* 1x9e_A 1ysl_B* 1ysl_A* 2hdb_A* Back     alignment and structure
>2l3v_A ACP, acyl carrier protein; structural genomi seattle structural genomics center for infectious disease, lipid binding protein; NMR {Brucella melitensis} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3ejb_A Acyl carrier protein; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Escherichia coli} SCOP: a.28.1.1 PDB: 3ejd_A* 3eje_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2l4b_A Acyl carrier protein; infectious disease, human granulocytic anaplasmosis, ssgcid, structural genomics; NMR {Anaplasma phagocytophilum} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>2kw2_A Specialized acyl carrier protein; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Rhodopseudomonas palustris} PDB: 2ll8_A* 2lpk_A 3lmo_A Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2lte_A Specialized acyl carrier protein; APO protein, transferase; NMR {Pseudomonas aeruginosa} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>4dxe_H ACP, acyl carrier protein; acyl-carrier-protein synthase, type II acid synthesis pathway; 2.51A {Staphylococcus aureus} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2p8u_A Hydroxymethylglutaryl-COA synthase, cytoplasmic; hydromethylglutaryl COA, mevalonate pathway, structural GENO structural genomics consortium, SGC; HET: COA; 2.00A {Homo sapiens} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2jq4_A AGR_C_4658P, hypothetical protein ATU2571; ATC2521, unknown function, ATC, S genomics, PSI-2, protein structure initiative; NMR {Agrobacterium tumefaciens} SCOP: a.28.1.1 Back     alignment and structure
>1dv5_A APO-DCP, APO-D-alanyl carrier protein; 3-helix bundle, transport protein; NMR {Lactobacillus casei} SCOP: a.28.1.3 PDB: 1hqb_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3ce7_A Specific mitochodrial acyl carrier protein; malaria, mitochondrial, ACP, fatty acid biosynthesis, lipid synthesis, phosphopantetheine; 1.64A {Toxoplasma} Back     alignment and structure
>2lki_A Putative uncharacterized protein; helical bundle, acyl carrier, phosphopantetheine, fatty acid biosynthesis, lipid synthesis, PSI-biology; HET: PNS; NMR {Nitrosomonas europaea} Back     alignment and structure
>1fh1_A NODF, nodulation protein F; ROOT nodulation factor, protein backbone fold, lipid binding protein; NMR {Rhizobium leguminosarum} SCOP: i.11.1.1 Back     alignment and structure
>2l9f_A CALE8, meacp; transferase, acyl carrier protein; NMR {Micromonospora echinospora} Back     alignment and structure
>2jgp_A Tyrocidine synthetase 3; multifunctional enzyme, antibiotic biosynthesis, condensatio domain, peptide bond formation, ligase; 1.85A {Brevibacillus brevis} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2cgq_A Acyl carrier protein ACPA; RV0033, protein transport, phosphopant; 1.83A {Mycobacterium tuberculosis} Back     alignment and structure
>2fq1_A Isochorismatase; ENTB, NRPS, multi-domain, ACP, hydrolase; 2.30A {Escherichia coli} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2wya_A Hydroxymethylglutaryl-COA synthase, mitochondrial; steroid biosynthesis, cholesterol biosynthesis, mitochondrion, phosphoprotein; HET: HMG; 1.70A {Homo sapiens} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1005
d1j3na1249 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II { 7e-65
d2gfva1250 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II { 2e-57
d1e5ma1250 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II { 5e-51
d1ox0a1256 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II 3e-49
d2ix4a1270 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II 3e-47
d1tqya2205 c.95.1.1 (A:219-423) Actinorhodin polyketide putat 3e-43
d2vbaa1253 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {E 5e-42
d2gfva2161 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II 1e-36
d1j3na2159 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II 4e-35
d1e5ma2161 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II 6e-35
d1tqya1216 c.95.1.1 (A:3-218) Actinorhodin polyketide putativ 5e-33
d2ix4a2161 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II 1e-31
d1tqyb2194 c.95.1.1 (B:210-403) Actinorhodin polyketide putat 6e-31
d1tqyb1208 c.95.1.1 (B:2-209) Actinorhodin polyketide putativ 1e-29
d2vbaa2151 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I 5e-28
d1ox0a2158 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II 1e-25
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 9e-12
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 7e-10
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 3e-08
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 5e-08
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 8e-08
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 2e-07
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 3e-07
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 3e-07
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 5e-07
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 9e-07
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 1e-06
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-06
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 3e-06
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 3e-06
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 4e-06
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 5e-06
d1kewa_361 c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) { 6e-06
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 7e-06
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 8e-06
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 9e-06
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 1e-05
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 1e-05
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 1e-05
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 2e-05
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 2e-05
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 2e-05
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 2e-05
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 4e-05
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 4e-05
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 6e-05
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 6e-05
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 1e-04
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 1e-04
d2af8a_86 a.28.1.1 (A:) Actinorhodin polyketide synthase acy 2e-04
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 3e-04
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 3e-04
d1udca_338 c.2.1.2 (A:) Uridine diphosphogalactose-4-epimeras 3e-04
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 5e-04
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 0.001
d1or5a_82 a.28.1.1 (A:) Frenolicin polyketide synthase acyl 0.001
d1db3a_357 c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escheric 0.001
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 0.001
d1f80d_74 a.28.1.1 (D:) Acyl carrier protein {Bacillus subti 0.001
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 0.002
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 0.002
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 0.003
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 0.003
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 0.003
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 0.003
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 0.004
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 249 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Beta-ketoacyl-ACP synthase II
species: Thermus thermophilus [TaxId: 274]
 Score =  217 bits (553), Expect = 7e-65
 Identities = 53/263 (20%), Positives = 86/263 (32%), Gaps = 36/263 (13%)

Query: 465 IAIIGMSGRFPAARNINEFWKILINNKDVISEIPEKIFDWKLYYENPIKSSNKINSKWYG 524
           + + G+    P       F K  +  K  +  I    FD                     
Sbjct: 4   VVVTGLGALTPIGVGQEAFHKAQLAGKSGVRPITR--FDASALP---------------- 45

Query: 525 SIPGIDEFDPLFFEISPLEAERMDPRQRHLLQESWLALEDAGYGPNQIANQKIGMFVGVE 584
                +        +   E  R+D   ++ L  + LALEDAG  P  +  +++G  VG  
Sbjct: 46  VRIAAEVDVDPGAYLDRKELRRLDRFVQYALIAAQLALEDAGLKPEDLDPERVGTLVGTG 105

Query: 585 EGSNYQ-------------DRLDQVNLTSTHNAILSARLAYFMDLKGPVMAINTACSSSL 631
            G                 +R+    +      + SA +A      GP   + TAC++  
Sbjct: 106 IGGMETWEAQSRVFLERGPNRISPFFIPMMIANMASAHIAMRYGFTGPSSTVVTACATGA 165

Query: 632 VATHIACQSLRQHECDTAISAGVNLMISPEAYIAMTSAGMLS-----PDGKCYVFDERAN 686
            A   A + ++  E D  ++ G    I+P A  A      LS     P+     F    +
Sbjct: 166 DALGSALRMIQLGEADLVLAGGTEAAITPMAIGAFAVMRALSTRNEEPEKASRPFTLSRD 225

Query: 687 GLVPSEAVVAVVLKRLSRALSDG 709
           G V  E    +VL+    A   G
Sbjct: 226 GFVMGEGAGVLVLEAYEHAKKRG 248


>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 250 Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 250 Back     information, alignment and structure
>d1ox0a1 c.95.1.1 (A:-5-251) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 256 Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Length = 270 Back     information, alignment and structure
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 205 Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Length = 253 Back     information, alignment and structure
>d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Length = 161 Back     information, alignment and structure
>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Length = 159 Back     information, alignment and structure
>d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Length = 161 Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Length = 216 Back     information, alignment and structure
>d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Length = 161 Back     information, alignment and structure
>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Length = 194 Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Length = 208 Back     information, alignment and structure
>d2vbaa2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Length = 151 Back     information, alignment and structure
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Length = 158 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Length = 361 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Length = 86 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Length = 338 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Length = 82 Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Length = 357 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Length = 74 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1005
d1tqya2205 Actinorhodin polyketide putative beta-ketoacyl syn 100.0
d1tqyb2194 Actinorhodin polyketide putative beta-ketoacyl syn 100.0
d1e5ma1250 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 100.0
d2gfva1250 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 100.0
d1j3na1249 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 100.0
d1ox0a1256 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 100.0
d1e5ma2161 Beta-ketoacyl-ACP synthase II {Synechocystis sp. [ 100.0
d2ix4a1270 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 100.0
d2gfva2161 Beta-ketoacyl-ACP synthase II {Escherichia coli [T 100.0
d2vbaa1253 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 100.0
d1j3na2159 Beta-ketoacyl-ACP synthase II {Thermus thermophilu 100.0
d1ox0a2158 Beta-ketoacyl-ACP synthase II {Streptococcus pneum 100.0
d2ix4a2161 Beta-ketoacyl-ACP synthase II {Thale cress (Arabid 100.0
d2vbaa2151 Beta-ketoacyl-ACP synthase I {Escherichia coli [Ta 100.0
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 100.0
d1tqyb1208 Actinorhodin polyketide putative beta-ketoacyl syn 100.0
d1tqya1216 Actinorhodin polyketide putative beta-ketoacyl syn 99.98
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.96
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.96
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.96
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.96
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.96
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.96
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.96
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.96
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.96
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.96
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.96
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.96
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.96
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.96
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.96
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.96
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.96
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.96
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.95
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.95
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.95
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.95
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.95
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.95
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.95
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.95
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.95
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.94
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.94
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.94
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.94
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.94
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.94
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.94
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.94
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.93
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.93
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.93
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.93
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.93
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.93
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.93
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.92
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.92
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.92
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.92
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.91
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.91
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.91
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.9
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.9
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 99.9
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.9
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.87
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.87
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.85
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.85
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.82
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.81
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.81
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.79
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.78
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.72
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.71
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.59
d2af8a_86 Actinorhodin polyketide synthase acyl carrier prot 99.35
d2gdwa176 Peptidyl carrier protein (PCP), thioester domain { 99.34
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.3
d1vkua_85 Acyl carrier protein {Thermotoga maritima [TaxId: 99.29
d1nq4a_95 Oxytetracycline polyketide synthase acyl carrier { 99.28
d1klpa_115 Acyl carrier protein {Mycobacterium tuberculosis [ 99.26
d1or5a_82 Frenolicin polyketide synthase acyl carrier protei 99.2
d2pnga176 Type I fatty acid synthase ACP domain {Rat (Rattus 99.15
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.15
d1dv5a_80 apo-D-alanyl carrier protein {Lactobacillus casei 99.14
d1f80d_74 Acyl carrier protein {Bacillus subtilis [TaxId: 14 99.11
d2jq4a183 Hypothetical protein Atu2571 {Agrobacterium tumefa 99.09
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.04
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.04
d1t8ka_77 Acyl carrier protein {Escherichia coli [TaxId: 562 98.97
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.97
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.95
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 98.92
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.89
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.85
d1teda_372 Polyketide synthase PKS18 {Mycobacterium tuberculo 98.84
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.83
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 98.8
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 98.8
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 98.79
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.75
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 98.74
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 98.73
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.68
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.64
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.62
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.59
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 98.59
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.57
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.51
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.46
d1ub7a1172 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 98.42
d1hnja1174 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 98.31
d1u6ea1184 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 98.3
d1ulqa1273 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 98.27
d1m3ka1268 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 98.24
d1mzja1181 Priming beta-ketosynthase from the r1128 polyketid 98.23
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.17
d1wdkc1262 Fatty oxidation complex beta subunit (3-ketoacyl-C 98.12
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 98.05
d1u0ma1200 Putative polyketide synthase SCO1206 {Streptomyces 98.0
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 97.93
d1bi5a1235 Chalcone synthase {Alfalfa (Medicago sativa) [TaxI 97.87
d1afwa1269 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 97.79
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.76
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 97.67
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 97.66
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 97.54
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.37
d1xpma1166 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Stap 97.13
d1afwa2124 Thiolase {Baker's yeast (Saccharomyces cerevisiae) 97.08
d1ulqa2125 Beta-ketoadipyl CoA thiolase {Thermus thermophilus 96.82
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 96.68
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.63
d1wdkc2128 Fatty oxidation complex beta subunit (3-ketoacyl-C 96.46
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 96.28
d1m3ka2124 Biosynthetic thiolase {Zoogloea ramigera [TaxId: 3 96.16
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 96.13
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 96.02
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 95.96
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.86
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 95.31
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.19
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 94.94
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 94.83
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 94.74
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 94.65
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.64
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 94.63
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 94.51
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 94.48
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 94.34
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 94.17
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 94.14
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 94.09
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 93.9
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 93.79
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 93.58
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.17
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 93.02
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 92.38
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 91.78
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 91.1
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 90.5
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 90.39
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 89.96
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.94
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 89.33
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 88.66
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 88.46
d1id1a_153 Rck domain from putative potassium channel Kch {Es 87.49
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 86.26
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 86.16
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 84.93
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 84.36
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 82.8
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 82.6
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 81.51
>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thiolase-like
superfamily: Thiolase-like
family: Thiolase-related
domain: Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA
species: Streptomyces coelicolor [TaxId: 1902]
Probab=100.00  E-value=1.1e-49  Score=413.90  Aligned_cols=199  Identities=25%  Similarity=0.377  Sum_probs=185.1

Q ss_pred             CCCCCcCCCCCCCCceecCccEEEEEcccchhhcCCCceEEEEEEeeeccCCCCCCCCCCCHHHHHHHHHHHHHHcCCCC
Q psy612          674 PDGKCYVFDERANGLVPSEAVVAVVLKRLSRALSDGDPIHAIIRGSGINYDGKTNGITAPNGISQTELIKSVYKKSNLNP  753 (1005)
Q Consensus       674 ~~g~~~pfd~~a~G~~~gEGa~~vvLk~l~~A~~~g~~I~avI~g~~~~~dG~~~~~~~p~~~~q~~~i~~al~~agi~~  753 (1005)
                      |+|+|||||+++|||++|||++++|||++++|++||++|||+|+|+++++||++.+.+.|++..|.++|+++|++++++|
T Consensus         3 P~~~~rpFD~~adG~v~gEGa~~~vL~~~~~A~~~g~~i~a~i~g~~~~~dg~~~~~~~~~~~~~~~~~~~al~~a~i~~   82 (205)
T d1tqya2           3 PEHASRPFDGTRDGFVLAEGAAMFVLEDYDSALARGARIHAEISGYATRCNAYHMTGLKADGREMAETIRVALDESRTDA   82 (205)
T ss_dssp             GGGCCCTTBTTCCCBCEECEEEEEEEEEHHHHHHTTCCCCEEEEEEEEEECSSCSSCCCTTCHHHHHHHHHHHHHHTCCG
T ss_pred             CCCCCCCccCCCCCEeeEeeEEEEEEeEHHHHHHCCCceEEEEEeeEccccccccCcccccccccchhhhhHHhhhcCCc
Confidence            78999999999999999999999999999999999999999999999999999988999999999999999999999999


Q ss_pred             CCccEEEecCCCCCCCCHHHHHHHHHHhccCCCCCCceeEeccCCCcCchhhchhhHHHHHHHHHhhcCCCCCCCCCCCc
Q psy612          754 EDINYIITHGTGTKLGDPVEINALHDVFKNKTYNQKFCAITSNKSNIGHTFAASGLVSLINLVQSIKYKIIPASLHCEKE  833 (1005)
Q Consensus       754 ~~I~yve~hgtgt~~gD~~E~~al~~~~~~~~~~~~~~~igsvK~~iGH~~~AaG~~~lik~~l~l~~~~ipp~~~~~~~  833 (1005)
                      +||+|||+|||||++||++|+++|.++|+...   .+++|+|+|+++||+++|||+++|+|++++|++|+|||++||+++
T Consensus        83 ~~i~~ie~hgtGt~~~D~~E~~ai~~~~~~~~---~~~~v~s~K~~~GH~~~AsG~~~li~~~~~l~~g~ipp~~~~~~~  159 (205)
T d1tqya2          83 TDIDYINAHGSGTRQNDRHETAAYKRALGEHA---RRTPVSSIKSMVGHSLGAIGSLEIAACVLALEHGVVPPTANLRTS  159 (205)
T ss_dssp             GGCCEEECCCCCCHHHHHHHHHHHHHHTGGGG---GGSCEECTHHHHCBCTTTHHHHHHHHHHHHHHHCEECCBTTCCSB
T ss_pred             cceeeeeccccccccCchhHHHHHHHhhcccc---CCceeeeecccccccccccchhHHHHHHHHHhCCeEcccCCCCCC
Confidence            99999999999999999999999999998643   347899999999999999999999999999999999999999999


Q ss_pred             ccccccCCCCeeeccccccccccccCccEEEEcccCCCCceEEEEEecccc
Q psy612          834 NNYIILKNSPFYINKSNKKWNTVNEKLRIGAVSAFGMSGTNAHIVLQEYIS  884 (1005)
Q Consensus       834 n~~i~~~~~~~~v~~~~~~w~~~~~~~r~a~v~sfG~gG~nah~il~~~~~  884 (1005)
                      ||.++++    +++.+.++|     +.|+++||||||||+|+|+||++++.
T Consensus       160 ~p~~~~~----~v~~~~~~~-----~~~~a~~~s~GfGG~na~~vl~~~~~  201 (205)
T d1tqya2         160 DPECDLD----YVPLEARER-----KLRSVLTVGSGFGGFQSAMVLRDAET  201 (205)
T ss_dssp             BTTBCSC----CCBSSCEEC-----CCSEEEEEEEETTTEEEEEEEECHHH
T ss_pred             CCCCCcc----cCCCCCcCC-----CCCEEEEeCCCCCceeEEEEEeeCCC
Confidence            9998775    344444444     35789999999999999999998764



>d1tqyb2 c.95.1.1 (B:210-403) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1e5ma1 c.95.1.1 (A:6-255) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2gfva1 c.95.1.1 (A:2-251) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3na1 c.95.1.1 (A:1-249) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5ma2 c.95.1.1 (A:256-416) Beta-ketoacyl-ACP synthase II {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2ix4a1 c.95.1.1 (A:31-300) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d2gfva2 c.95.1.1 (A:252-412) Beta-ketoacyl-ACP synthase II {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2vbaa1 c.95.1.1 (A:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3na2 c.95.1.1 (A:250-408) Beta-ketoacyl-ACP synthase II {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ox0a2 c.95.1.1 (A:252-409) Beta-ketoacyl-ACP synthase II {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2ix4a2 c.95.1.1 (A:301-461) Beta-ketoacyl-ACP synthase II {Thale cress (Arabidopsis thaliana), mitochondrial isoform [TaxId: 3702]} Back     information, alignment and structure
>d2vbaa2 c.95.1.1 (A:254-404) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1tqyb1 c.95.1.1 (B:2-209) Actinorhodin polyketide putative beta-ketoacyl synthase 2, KasB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1tqya1 c.95.1.1 (A:3-218) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2af8a_ a.28.1.1 (A:) Actinorhodin polyketide synthase acyl carrier protein, ACT ACP {Streptomyces coelicolor, A3(2) [TaxId: 1902]} Back     information, alignment and structure
>d2gdwa1 a.28.1.2 (A:8-83) Peptidyl carrier protein (PCP), thioester domain {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1vkua_ a.28.1.1 (A:) Acyl carrier protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nq4a_ a.28.1.1 (A:) Oxytetracycline polyketide synthase acyl carrier {Streptomyces rimosus [TaxId: 1927]} Back     information, alignment and structure
>d1klpa_ a.28.1.1 (A:) Acyl carrier protein {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1or5a_ a.28.1.1 (A:) Frenolicin polyketide synthase acyl carrier protein, Fren ACP {Streptomyces roseofulvus [TaxId: 33902]} Back     information, alignment and structure
>d2pnga1 a.28.1.1 (A:1-76) Type I fatty acid synthase ACP domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dv5a_ a.28.1.3 (A:) apo-D-alanyl carrier protein {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1f80d_ a.28.1.1 (D:) Acyl carrier protein {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jq4a1 a.28.1.1 (A:1-83) Hypothetical protein Atu2571 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t8ka_ a.28.1.1 (A:) Acyl carrier protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1teda_ c.95.1.2 (A:) Polyketide synthase PKS18 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1ub7a1 c.95.1.2 (A:2-173) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hnja1 c.95.1.2 (A:1-174) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulqa1 c.95.1.1 (A:3-275) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1m3ka1 c.95.1.1 (A:1-268) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1mzja1 c.95.1.2 (A:3-183) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1wdkc1 c.95.1.1 (C:2-263) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1u0ma1 c.95.1.2 (A:2-201) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1bi5a1 c.95.1.2 (A:1-235) Chalcone synthase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1afwa1 c.95.1.1 (A:25-293) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xpma1 c.95.1.2 (A:2-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1afwa2 c.95.1.1 (A:294-417) Thiolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ulqa2 c.95.1.1 (A:276-400) Beta-ketoadipyl CoA thiolase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdkc2 c.95.1.1 (C:264-391) Fatty oxidation complex beta subunit (3-ketoacyl-CoA thiolase) {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1m3ka2 c.95.1.1 (A:269-392) Biosynthetic thiolase {Zoogloea ramigera [TaxId: 350]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure