Query         psy6139
Match_columns 69
No_of_seqs    104 out of 327
Neff          5.6 
Searched_HMMs 46136
Date          Fri Aug 16 18:35:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6139.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6139hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF12861 zf-Apc11:  Anaphase-pr  99.8 3.6E-22 7.7E-27  122.7   1.8   62    1-66      2-64  (85)
  2 COG5194 APC11 Component of SCF  99.8 1.4E-21 3.1E-26  119.5  -0.0   62    1-66      2-66  (88)
  3 KOG1493|consensus               99.8   2E-20 4.4E-25  113.6   4.5   55    1-56      2-56  (84)
  4 KOG2930|consensus               99.6 3.8E-16 8.2E-21   99.5   1.2   38    1-38     28-65  (114)
  5 PF12678 zf-rbx1:  RING-H2 zinc  99.6 1.5E-15 3.3E-20   89.9   2.1   55    1-56      1-55  (73)
  6 KOG1257|consensus               98.7 9.1E-09   2E-13   79.8   2.9   39   30-69    540-578 (582)
  7 PLN03129 NADP-dependent malic   87.4     0.4 8.6E-06   38.2   2.0   34   23-56    544-578 (581)
  8 PRK13529 malate dehydrogenase;  86.1    0.44 9.6E-06   37.8   1.6   32   24-56    526-558 (563)
  9 PF12907 zf-met2:  Zinc-binding  82.9    0.38 8.3E-06   25.7   0.0   14   21-34      3-16  (40)
 10 PF13639 zf-RING_2:  Ring finge  75.8     1.1 2.5E-05   23.0   0.4   12   20-31      1-12  (44)
 11 cd05312 NAD_bind_1_malic_enz N  70.6     2.3   5E-05   31.0   1.1   30   24-53    249-279 (279)
 12 PF02132 RecR:  RecR protein;    59.5       3 6.6E-05   21.7   0.0   11   18-28     28-38  (41)
 13 PRK15202 type III secretion ch  55.8     7.8 0.00017   25.1   1.4   27   28-56     39-65  (117)
 14 COG0295 Cdd Cytidine deaminase  54.1     3.7 7.9E-05   27.1  -0.3   16   19-34     85-100 (134)
 15 PRK08298 cytidine deaminase; V  51.8     4.7  0.0001   26.3  -0.0   14   20-33     87-100 (136)
 16 PHA02565 49 recombination endo  47.7     7.2 0.00016   26.5   0.3   15   18-32     19-33  (157)
 17 PF12874 zf-met:  Zinc-finger o  47.0     7.3 0.00016   17.4   0.2   12   21-32      2-13  (25)
 18 COG0353 RecR Recombinational D  46.9     7.3 0.00016   27.3   0.3   39   18-56     65-105 (198)
 19 PRK12411 cytidine deaminase; P  45.8     6.5 0.00014   25.4  -0.1   16   19-34     83-98  (132)
 20 COG4357 Zinc finger domain con  45.5      11 0.00024   24.0   0.9   22   20-41     63-91  (105)
 21 PF10886 DUF2685:  Protein of u  41.6      12 0.00026   21.3   0.6   13   19-31      1-13  (54)
 22 PRK13844 recombination protein  40.9     8.8 0.00019   26.8  -0.0   39   18-56     68-108 (200)
 23 PRK13718 conjugal transfer pro  40.4      35 0.00077   20.9   2.5   18    2-19     19-36  (84)
 24 TIGR00615 recR recombination p  38.5      10 0.00022   26.4  -0.0   39   18-56     64-104 (195)
 25 KOG4265|consensus               38.3      11 0.00024   28.5   0.1   19   18-36    324-342 (349)
 26 PRK00076 recR recombination pr  37.3      12 0.00025   26.0   0.1   39   18-56     64-104 (196)
 27 PF13912 zf-C2H2_6:  C2H2-type   36.9      11 0.00025   17.0   0.0   12   21-32      3-14  (27)
 28 PF10367 Vps39_2:  Vacuolar sor  36.1      16 0.00035   21.4   0.6   14   18-31     77-90  (109)
 29 PF02945 Endonuclease_7:  Recom  35.2      15 0.00032   22.1   0.3   14   18-31     21-34  (81)
 30 PF13920 zf-C3HC4_3:  Zinc fing  35.0      20 0.00044   18.7   0.8   12   19-30     37-48  (50)
 31 PRK06848 hypothetical protein;  33.8      12 0.00026   24.4  -0.2   42   20-68     95-138 (139)
 32 COG2174 RPL34A Ribosomal prote  32.3      22 0.00047   22.3   0.7   19   18-36     33-51  (93)
 33 PF11100 TrbE:  Conjugal transf  31.8      33 0.00072   20.2   1.4   16    3-18     12-27  (66)
 34 PLN02182 cytidine deaminase     31.3      17 0.00036   27.4   0.1   16   19-34    129-144 (339)
 35 PF02928 zf-C5HC2:  C5HC2 zinc   31.3      27 0.00058   19.0   0.9   19   22-40      1-20  (54)
 36 PF13832 zf-HC5HC2H_2:  PHD-zin  31.3      20 0.00044   21.5   0.5   21   19-40     55-75  (110)
 37 PHA02447 hypothetical protein   31.1      19 0.00041   21.7   0.3   14   10-23     41-54  (86)
 38 PF14570 zf-RING_4:  RING/Ubox   30.6      17 0.00037   20.0   0.0   20   20-39     23-46  (48)
 39 PLN02402 cytidine deaminase     30.4      17 0.00037   26.9   0.0   14   20-33    102-115 (303)
 40 PRK05578 cytidine deaminase; V  30.2      14 0.00031   23.8  -0.4   15   19-33     83-97  (131)
 41 PF10146 zf-C4H2:  Zinc finger-  28.1      21 0.00046   25.2   0.2   19   20-38    195-213 (230)
 42 PTZ00317 NADP-dependent malic   27.3      46 0.00099   26.7   1.9   30   24-53    525-558 (559)
 43 PF00096 zf-C2H2:  Zinc finger,  26.8      24 0.00053   15.2   0.2   11   21-31      2-12  (23)
 44 KOG1039|consensus               26.0      32  0.0007   25.9   0.8   17   17-33    159-175 (344)
 45 PF15227 zf-C3HC4_4:  zinc fing  24.7      29 0.00063   17.9   0.3   11   22-32      1-11  (42)
 46 TIGR01355 cyt_deam_dimer cytid  24.6      25 0.00055   25.7   0.1   16   19-34     98-113 (283)
 47 PF04438 zf-HIT:  HIT zinc fing  23.7      28  0.0006   17.1   0.1   19   20-38      3-21  (30)
 48 COG4844 Uncharacterized protei  23.5      28  0.0006   21.0   0.1   34   20-53     38-71  (78)
 49 PF07824 Chaperone_III:  Type I  23.3       7 0.00015   25.1  -2.7   27   28-56     38-64  (112)
 50 PRK09027 cytidine deaminase; P  22.9      28 0.00061   25.6   0.0   16   19-34    126-141 (295)
 51 PF13894 zf-C2H2_4:  C2H2-type   22.8      29 0.00063   14.5   0.1   11   21-31      2-12  (24)
 52 PF03107 C1_2:  C1 domain;  Int  21.9      34 0.00075   16.4   0.2   16   21-36      2-18  (30)
 53 PRK08061 rpsN 30S ribosomal pr  21.8      29 0.00062   20.0  -0.1   20   21-40     36-55  (61)
 54 TIGR01354 cyt_deam_tetra cytid  21.6      25 0.00054   22.2  -0.4   15   19-33     80-94  (127)
 55 KOG0833|consensus               21.0      26 0.00056   24.1  -0.5   17   18-34    101-117 (173)
 56 PF06677 Auto_anti-p27:  Sjogre  21.0      32 0.00069   18.2  -0.0   17   15-31     13-29  (41)
 57 smart00451 ZnF_U1 U1-like zinc  20.7      38 0.00082   16.0   0.2   12   21-32      5-16  (35)
 58 cd00162 RING RING-finger (Real  20.7      37 0.00081   16.0   0.2    9   21-29      1-9   (45)
 59 PF01363 FYVE:  FYVE zinc finge  20.1      26 0.00057   19.3  -0.5   17   13-29      3-19  (69)

No 1  
>PF12861 zf-Apc11:  Anaphase-promoting complex subunit 11 RING-H2 finger
Probab=99.84  E-value=3.6e-22  Score=122.66  Aligned_cols=62  Identities=31%  Similarity=0.664  Sum_probs=56.3

Q ss_pred             CEEEEEEEeEEEeEeec-CCCeeccccchhhccCCCCCCCCchhhHHhhhcccccCCCCCCCccccC
Q psy6139           1 MFTLKKWNAVAMWSWDV-ECDTCAICRVQVMGTATVYPEPEDKLAFVKSFVYDYSYSEPSVPTSYSW   66 (69)
Q Consensus         1 ~~~i~~~~~v~~W~W~~-~~d~CaICr~~~~g~a~~~p~P~D~~~~V~~~~Y~~~Y~~s~lp~~y~w   66 (69)
                      +|+||+||+|+.|+||+ .+|+|||||++|+|.|+.|..|||.|++|.++ .++.|+   +..++.|
T Consensus         2 kv~i~~w~~va~W~Wd~~~dd~CgICr~~fdg~Cp~Ck~Pgd~Cplv~g~-C~H~FH---~hCI~kW   64 (85)
T PF12861_consen    2 KVKIKEWHAVATWKWDVANDDVCGICRMPFDGCCPDCKFPGDDCPLVWGK-CSHNFH---MHCILKW   64 (85)
T ss_pred             eeEEEEEEEEEEEEEecCCCCceeeEecccccCCCCccCCCCCCceeecc-CccHHH---HHHHHHH
Confidence            68999999999999997 59999999999999999999999999999998 888886   5565555


No 2  
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]
Probab=99.82  E-value=1.4e-21  Score=119.51  Aligned_cols=62  Identities=39%  Similarity=0.820  Sum_probs=55.3

Q ss_pred             CEEEEEEEeEEEeEeecCCCeeccccchhhccCCCCCC---CCchhhHHhhhcccccCCCCCCCccccC
Q psy6139           1 MFTLKKWNAVAMWSWDVECDTCAICRVQVMGTATVYPE---PEDKLAFVKSFVYDYSYSEPSVPTSYSW   66 (69)
Q Consensus         1 ~~~i~~~~~v~~W~W~~~~d~CaICr~~~~g~a~~~p~---P~D~~~~V~~~~Y~~~Y~~s~lp~~y~w   66 (69)
                      +||||+||+|+.|+||+..|+||||||+|+|+|+.|..   |+|.|+.+.|. .++.|+   ...+|.|
T Consensus         2 kvkIkkw~aVa~Wswdi~id~CaICRnhim~~C~eCq~~~~~~~eC~v~wG~-CnHaFH---~HCI~rW   66 (88)
T COG5194           2 KVKIKKWHAVALWSWDIPIDVCAICRNHIMGTCPECQFGMTPGDECPVVWGV-CNHAFH---DHCIYRW   66 (88)
T ss_pred             ceEeeeEeEEEEEecccccchhhhhhccccCcCcccccCCCCCCcceEEEEe-cchHHH---HHHHHHH
Confidence            69999999999999999999999999999999999999   99999999886 677775   4455555


No 3  
>KOG1493|consensus
Probab=99.81  E-value=2e-20  Score=113.64  Aligned_cols=55  Identities=29%  Similarity=0.595  Sum_probs=51.3

Q ss_pred             CEEEEEEEeEEEeEeecCCCeeccccchhhccCCCCCCCCchhhHHhhhcccccCC
Q psy6139           1 MFTLKKWNAVAMWSWDVECDTCAICRVQVMGTATVYPEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus         1 ~~~i~~~~~v~~W~W~~~~d~CaICr~~~~g~a~~~p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      +||||++|+++.|+|+..+|+|||||.+|+|.|+.|+.|||.|++|.| ...+.|+
T Consensus         2 kvki~~~h~~a~wtW~~~~e~CGiCRm~Fdg~Cp~Ck~PgDdCPLv~G-~C~h~fh   56 (84)
T KOG1493|consen    2 KVKIKRYHAVAWWTWDAPDETCGICRMPFDGCCPDCKLPGDDCPLVWG-YCLHAFH   56 (84)
T ss_pred             ceEEEEEEEEEEEEEcCCCCccceEecccCCcCCCCcCCCCCCccHHH-HHHHHHH
Confidence            689999999999999999999999999999999999999999999999 4666664


No 4  
>KOG2930|consensus
Probab=99.58  E-value=3.8e-16  Score=99.51  Aligned_cols=38  Identities=50%  Similarity=1.067  Sum_probs=36.1

Q ss_pred             CEEEEEEEeEEEeEeecCCCeeccccchhhccCCCCCC
Q psy6139           1 MFTLKKWNAVAMWSWDVECDTCAICRVQVMGTATVYPE   38 (69)
Q Consensus         1 ~~~i~~~~~v~~W~W~~~~d~CaICr~~~~g~a~~~p~   38 (69)
                      ||+||||++||.|+||+..|+||||||+++++|..|.-
T Consensus        28 rF~lKKWnAvAlWaWDi~vDnCAICRnHIMd~CieCQa   65 (114)
T KOG2930|consen   28 RFELKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQA   65 (114)
T ss_pred             ceEEeeeeeeeeeeeeeeechhHHHHHHHHHHHHhhcc
Confidence            69999999999999999999999999999999999853


No 5  
>PF12678 zf-rbx1:  RING-H2 zinc finger;  InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This domain constitutes a conserved region found in proteins that participate in diverse functions relevant to chromosome metabolism and cell cycle control [].The domain contains 8 cysteine/ histidine residues which are proposed to be the conserved residues involved in zinc binding.; PDB: 4A0C_D 4A0L_I 4A0K_B 2ECL_A 1LDK_C 3RTR_F 3DQV_Y 1U6G_B 1LDJ_B 2HYE_D ....
Probab=99.55  E-value=1.5e-15  Score=89.89  Aligned_cols=55  Identities=38%  Similarity=0.765  Sum_probs=47.6

Q ss_pred             CEEEEEEEeEEEeEeecCCCeeccccchhhccCCCCCCCCchhhHHhhhcccccCC
Q psy6139           1 MFTLKKWNAVAMWSWDVECDTCAICRVQVMGTATVYPEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus         1 ~~~i~~~~~v~~W~W~~~~d~CaICr~~~~g~a~~~p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      ||+||+|++|+.|+|++.+|.||||+++|++.++.+..|++.++++.+. ..+.|+
T Consensus         1 ~~~i~~~~~v~~~~~~~~~d~C~IC~~~l~~~~~~~~~~~~~~~i~~~~-C~H~FH   55 (73)
T PF12678_consen    1 KFKIKKWNAVALWSWDIADDNCAICREPLEDPCPECQAPQDECPIVWGP-CGHIFH   55 (73)
T ss_dssp             SEEEEEEEEEEEEEESSCCSBETTTTSBTTSTTCCHHHCTTTS-EEEET-TSEEEE
T ss_pred             CeEEEEEEEEEEEeecCcCCcccccChhhhChhhhhcCCccccceEecc-cCCCEE
Confidence            7999999999999999999999999999999999999999888876554 455543


No 6  
>KOG1257|consensus
Probab=98.70  E-value=9.1e-09  Score=79.84  Aligned_cols=39  Identities=44%  Similarity=0.867  Sum_probs=37.1

Q ss_pred             hccCCCCCCCCchhhHHhhhcccccCCCCCCCccccCCCC
Q psy6139          30 MGTATVYPEPEDKLAFVKSFVYDYSYSEPSVPTSYSWPKL   69 (69)
Q Consensus        30 ~g~a~~~p~P~D~~~~V~~~~Y~~~Y~~s~lp~~y~wp~~   69 (69)
                      +|+|+.+|+|+|+++|++++||+++|+ +++|++|+||.+
T Consensus       540 ~glA~~~p~P~d~~~~~~~~~y~~~Y~-~~~~~~y~~p~~  578 (582)
T KOG1257|consen  540 EGLATRYPEPKDKEKFIEESMYNPEYR-NSLPDTYDWPVE  578 (582)
T ss_pred             cCccccCCCcccHHHHHHhccCCcccc-ccccccccCccc
Confidence            799999999999999999999999998 899999999963


No 7  
>PLN03129 NADP-dependent malic enzyme; Provisional
Probab=87.38  E-value=0.4  Score=38.18  Aligned_cols=34  Identities=32%  Similarity=0.524  Sum_probs=28.2

Q ss_pred             ccccchh-hccCCCCCCCCchhhHHhhhcccccCC
Q psy6139          23 AICRVQV-MGTATVYPEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus        23 aICr~~~-~g~a~~~p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      |+.+..+ +|+|...++|+|..++|+++||+++|.
T Consensus       544 aVa~~A~~~G~A~~~~~~~~~~~~i~~~mw~P~Y~  578 (581)
T PLN03129        544 AVAAKAYEEGLATRLPRPEDLVEYAESCMYSPVYR  578 (581)
T ss_pred             HHHHHHHHcCCCCCCCCHHHHHHHHHHcCcCCCCC
Confidence            3445555 478888889999999999999999996


No 8  
>PRK13529 malate dehydrogenase; Provisional
Probab=86.05  E-value=0.44  Score=37.79  Aligned_cols=32  Identities=16%  Similarity=0.277  Sum_probs=25.7

Q ss_pred             cccchh-hccCCCCCCCCchhhHHhhhcccccCC
Q psy6139          24 ICRVQV-MGTATVYPEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus        24 ICr~~~-~g~a~~~p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      +.+.++ +|+|.. +.|+|..+||+++||+++|.
T Consensus       526 Va~~A~~~GlA~~-~~~~~~~~~i~~~~w~P~Y~  558 (563)
T PRK13529        526 VAKAAIEEGLARE-TSDEDLEQAIEDNMWQPEYR  558 (563)
T ss_pred             HHHHHHHhCCCCC-CCHHHHHHHHHhcCcCCCCc
Confidence            344444 467875 78999999999999999996


No 9  
>PF12907 zf-met2:  Zinc-binding
Probab=82.94  E-value=0.38  Score=25.71  Aligned_cols=14  Identities=43%  Similarity=0.861  Sum_probs=12.0

Q ss_pred             eeccccchhhccCC
Q psy6139          21 TCAICRVQVMGTAT   34 (69)
Q Consensus        21 ~CaICr~~~~g~a~   34 (69)
                      .|.|||+.|+.++.
T Consensus         3 ~C~iC~qtF~~t~~   16 (40)
T PF12907_consen    3 ICKICRQTFMQTTN   16 (40)
T ss_pred             CcHHhhHHHHhcCC
Confidence            69999999988764


No 10 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=75.75  E-value=1.1  Score=23.04  Aligned_cols=12  Identities=33%  Similarity=0.769  Sum_probs=9.9

Q ss_pred             Ceeccccchhhc
Q psy6139          20 DTCAICRVQVMG   31 (69)
Q Consensus        20 d~CaICr~~~~g   31 (69)
                      |.|+||...|..
T Consensus         1 d~C~IC~~~~~~   12 (44)
T PF13639_consen    1 DECPICLEEFED   12 (44)
T ss_dssp             -CETTTTCBHHT
T ss_pred             CCCcCCChhhcC
Confidence            689999999975


No 11 
>cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1. Malic enzyme (ME), a member of the amino acid dehydrogenase (DH)-like domain family, catalyzes the oxidative decarboxylation of L-malate to pyruvate in the presence of cations (typically  Mg++ or Mn++) with the concomitant reduction of cofactor NAD+ or NADP+.  ME has been found in all organisms, and plays important roles in diverse metabolic pathways such as photosynthesis and lipogenesis. This enzyme generally forms homotetramers. The conversion of malate to pyruvate by ME typically involves oxidation of malate to produce oxaloacetate, followed by decarboxylation of oxaloacetate to produce pyruvate and CO2.  This subfamily consists of eukaryotic and bacterial ME.  Amino acid DH-like NAD(P)-binding domains are members of the Rossmann fold superfamily and include glutamate, leucine, and phenylalanine DHs, methylene tetrahydrofolate DH, methylene-tetrahydromethanopterin DH, methylene-tetrahydropholate DH
Probab=70.60  E-value=2.3  Score=30.98  Aligned_cols=30  Identities=37%  Similarity=0.585  Sum_probs=23.9

Q ss_pred             cccchh-hccCCCCCCCCchhhHHhhhcccc
Q psy6139          24 ICRVQV-MGTATVYPEPEDKLAFVKSFVYDY   53 (69)
Q Consensus        24 ICr~~~-~g~a~~~p~P~D~~~~V~~~~Y~~   53 (69)
                      +.+..+ +|+|...++|.|.++||+++||++
T Consensus       249 Va~~A~~~gla~~~~~~~~~~~~i~~~~w~P  279 (279)
T cd05312         249 VAKYAYEEGLATRYPPPEDLEEYVKSQMWEP  279 (279)
T ss_pred             HHHHHHHcCCCCCCCCHHHHHHHHHhCccCC
Confidence            344455 478888888899999999999974


No 12 
>PF02132 RecR:  RecR protein;  InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []. It may act with RecF and RecO.  RecR's structure consists of a N-terminal helix-hairpin-helix (HhH) motif, followed by a Cys4 zinc-finger motif, a Toprim domain and a Walker B motif []. This entry represents the C4-type zinc finger.; PDB: 1VDD_D 2V1C_B.
Probab=59.53  E-value=3  Score=21.73  Aligned_cols=11  Identities=45%  Similarity=0.881  Sum_probs=7.5

Q ss_pred             CCCeeccccch
Q psy6139          18 ECDTCAICRVQ   28 (69)
Q Consensus        18 ~~d~CaICr~~   28 (69)
                      .++.|.||+++
T Consensus        28 e~~~C~IC~d~   38 (41)
T PF02132_consen   28 EEDPCEICSDP   38 (41)
T ss_dssp             SSSS-HHHH-T
T ss_pred             CCCcCcCCCCC
Confidence            57899999875


No 13 
>PRK15202 type III secretion chaperone protein SigE; Provisional
Probab=55.78  E-value=7.8  Score=25.10  Aligned_cols=27  Identities=15%  Similarity=0.338  Sum_probs=22.2

Q ss_pred             hhhccCCCCCCCCchhhHHhhhcccccCC
Q psy6139          28 QVMGTATVYPEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus        28 ~~~g~a~~~p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      .++-+||.||-|+|...++  +.-+.+|.
T Consensus        39 ~lem~CPf~~LPdn~~~Lq--~~LsLNYa   65 (117)
T PRK15202         39 TLEMCCPFMPLPDNILTLQ--HFLSLNYT   65 (117)
T ss_pred             chhccCCcccCCccHHHHH--HHHhhccc
Confidence            4677899999999999887  56677775


No 14 
>COG0295 Cdd Cytidine deaminase [Nucleotide transport and metabolism]
Probab=54.13  E-value=3.7  Score=27.07  Aligned_cols=16  Identities=19%  Similarity=0.470  Sum_probs=13.6

Q ss_pred             CCeeccccchhhccCC
Q psy6139          19 CDTCAICRVQVMGTAT   34 (69)
Q Consensus        19 ~d~CaICr~~~~g~a~   34 (69)
                      .--||.||+-+.+.+.
T Consensus        85 ~sPCG~CRQ~i~Ef~~  100 (134)
T COG0295          85 VSPCGACRQVLAEFCG  100 (134)
T ss_pred             cCCcHHHHHHHHHhcC
Confidence            4679999999998883


No 15 
>PRK08298 cytidine deaminase; Validated
Probab=51.80  E-value=4.7  Score=26.32  Aligned_cols=14  Identities=14%  Similarity=0.589  Sum_probs=11.9

Q ss_pred             CeeccccchhhccC
Q psy6139          20 DTCAICRVQVMGTA   33 (69)
Q Consensus        20 d~CaICr~~~~g~a   33 (69)
                      --||+||+-+.+..
T Consensus        87 sPCG~CRQvl~Ef~  100 (136)
T PRK08298         87 SPCGVCQERLFYWG  100 (136)
T ss_pred             CCChhHHHHHHHhC
Confidence            47999999998873


No 16 
>PHA02565 49 recombination endonuclease VII; Provisional
Probab=47.67  E-value=7.2  Score=26.48  Aligned_cols=15  Identities=20%  Similarity=0.740  Sum_probs=12.2

Q ss_pred             CCCeeccccchhhcc
Q psy6139          18 ECDTCAICRVQVMGT   32 (69)
Q Consensus        18 ~~d~CaICr~~~~g~   32 (69)
                      +...|+||+.+|.+.
T Consensus        19 Q~G~CaiC~~~l~~~   33 (157)
T PHA02565         19 QNGICPLCKRELDGD   33 (157)
T ss_pred             hCCcCCCCCCccCCC
Confidence            578899999998653


No 17 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=46.98  E-value=7.3  Score=17.40  Aligned_cols=12  Identities=25%  Similarity=0.628  Sum_probs=9.2

Q ss_pred             eeccccchhhcc
Q psy6139          21 TCAICRVQVMGT   32 (69)
Q Consensus        21 ~CaICr~~~~g~   32 (69)
                      .|.||...|.+.
T Consensus         2 ~C~~C~~~f~s~   13 (25)
T PF12874_consen    2 YCDICNKSFSSE   13 (25)
T ss_dssp             EETTTTEEESSH
T ss_pred             CCCCCCCCcCCH
Confidence            589998888653


No 18 
>COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=46.95  E-value=7.3  Score=27.35  Aligned_cols=39  Identities=31%  Similarity=0.505  Sum_probs=32.2

Q ss_pred             CCCeeccccchhhccCCCC--CCCCchhhHHhhhcccccCC
Q psy6139          18 ECDTCAICRVQVMGTATVY--PEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus        18 ~~d~CaICr~~~~g~a~~~--p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      ..|.|.||.++-.+-...|  -.|.|..++=+.+.|+--|+
T Consensus        65 e~d~C~ICsd~~Rd~~~icVVe~p~Dv~a~E~~~~f~G~Yh  105 (198)
T COG0353          65 ESDPCDICSDESRDKSQLCVVEEPKDVLALEKTGEFRGLYH  105 (198)
T ss_pred             CCCcCcCcCCcccCCceEEEEcchHHHHHHHHhcccCeeEE
Confidence            5789999998887766655  57999999999999998885


No 19 
>PRK12411 cytidine deaminase; Provisional
Probab=45.76  E-value=6.5  Score=25.39  Aligned_cols=16  Identities=19%  Similarity=0.532  Sum_probs=13.2

Q ss_pred             CCeeccccchhhccCC
Q psy6139          19 CDTCAICRVQVMGTAT   34 (69)
Q Consensus        19 ~d~CaICr~~~~g~a~   34 (69)
                      .--||.||+-+.+.+.
T Consensus        83 ~sPCG~CRQ~l~Ef~~   98 (132)
T PRK12411         83 VPPCGACRQVMVELCK   98 (132)
T ss_pred             cCCchhHHHHHHHhCC
Confidence            3589999999998754


No 20 
>COG4357 Zinc finger domain containing protein (CHY type) [Function unknown]
Probab=45.50  E-value=11  Score=23.96  Aligned_cols=22  Identities=23%  Similarity=0.569  Sum_probs=17.1

Q ss_pred             Ceeccccchh-------hccCCCCCCCCc
Q psy6139          20 DTCAICRVQV-------MGTATVYPEPED   41 (69)
Q Consensus        20 d~CaICr~~~-------~g~a~~~p~P~D   41 (69)
                      -.||.||+.|       -+.|+.|..|=|
T Consensus        63 iiCGvC~~~LT~~EY~~~~~Cp~C~spFN   91 (105)
T COG4357          63 IICGVCRKLLTRAEYGMCGSCPYCQSPFN   91 (105)
T ss_pred             EEhhhhhhhhhHHHHhhcCCCCCcCCCCC
Confidence            5799999988       466888877755


No 21 
>PF10886 DUF2685:  Protein of unknown function (DUF2685);  InterPro: IPR024362 This is a family of uncharacterised bacteriophage proteins. Their function in unknown.
Probab=41.59  E-value=12  Score=21.25  Aligned_cols=13  Identities=15%  Similarity=0.733  Sum_probs=10.2

Q ss_pred             CCeeccccchhhc
Q psy6139          19 CDTCAICRVQVMG   31 (69)
Q Consensus        19 ~d~CaICr~~~~g   31 (69)
                      ++.|+.|++++..
T Consensus         1 m~~CvVCKqpi~~   13 (54)
T PF10886_consen    1 MEICVVCKQPIDD   13 (54)
T ss_pred             CCeeeeeCCccCc
Confidence            3679999998865


No 22 
>PRK13844 recombination protein RecR; Provisional
Probab=40.88  E-value=8.8  Score=26.81  Aligned_cols=39  Identities=23%  Similarity=0.330  Sum_probs=31.5

Q ss_pred             CCCeeccccchhhccCCCC--CCCCchhhHHhhhcccccCC
Q psy6139          18 ECDTCAICRVQVMGTATVY--PEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus        18 ~~d~CaICr~~~~g~a~~~--p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      ++|.|.||+++-.+-...|  -.|.|..++=++..|+=-|+
T Consensus        68 e~~~C~IC~d~~Rd~~~iCVVE~~~Dv~aiE~t~~y~G~Yh  108 (200)
T PRK13844         68 EDDVCNICSNTNRDDTKLCIIESMLDMIAIEEAGIYRGKYF  108 (200)
T ss_pred             CCCCCCCCCCCCCCCCEEEEECCHHHHHHHHhhCccceEEE
Confidence            6789999999886554444  57899999999999988886


No 23 
>PRK13718 conjugal transfer protein TrbE; Provisional
Probab=40.39  E-value=35  Score=20.91  Aligned_cols=18  Identities=33%  Similarity=0.573  Sum_probs=14.0

Q ss_pred             EEEEEEEeEEEeEeecCC
Q psy6139           2 FTLKKWNAVAMWSWDVEC   19 (69)
Q Consensus         2 ~~i~~~~~v~~W~W~~~~   19 (69)
                      +++.=+++|-.|+||..-
T Consensus        19 vT~IViSPviywSWDtVK   36 (84)
T PRK13718         19 ITAIVISPVIYWSWDTVK   36 (84)
T ss_pred             eEEEEecceEEEEehhcc
Confidence            456678999999999643


No 24 
>TIGR00615 recR recombination protein RecR. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=38.46  E-value=10  Score=26.39  Aligned_cols=39  Identities=21%  Similarity=0.472  Sum_probs=32.0

Q ss_pred             CCCeeccccchhhccCCCC--CCCCchhhHHhhhcccccCC
Q psy6139          18 ECDTCAICRVQVMGTATVY--PEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus        18 ~~d~CaICr~~~~g~a~~~--p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      +++.|.||+++-.+....|  -.|.|..++=++..|+=-|+
T Consensus        64 e~~~C~IC~d~~Rd~~~iCVVE~~~Dv~aiE~~~~y~G~Yh  104 (195)
T TIGR00615        64 DQEVCNICSDERRDNSVICVVEDPKDVFALEKTKEFRGRYH  104 (195)
T ss_pred             CCCcCCCCCCCCCCCCEEEEECCHHHHHHHHhhCccceEEE
Confidence            6789999999987654444  57899999999999988886


No 25 
>KOG4265|consensus
Probab=38.33  E-value=11  Score=28.53  Aligned_cols=19  Identities=26%  Similarity=0.751  Sum_probs=12.5

Q ss_pred             CCCeeccccchhhccCCCC
Q psy6139          18 ECDTCAICRVQVMGTATVY   36 (69)
Q Consensus        18 ~~d~CaICr~~~~g~a~~~   36 (69)
                      ..++|-|||+++..+-..+
T Consensus       324 q~n~CPICRqpi~~ll~i~  342 (349)
T KOG4265|consen  324 QTNNCPICRQPIEELLEIY  342 (349)
T ss_pred             hhcCCCccccchHhhheec
Confidence            4567777777777665444


No 26 
>PRK00076 recR recombination protein RecR; Reviewed
Probab=37.34  E-value=12  Score=26.05  Aligned_cols=39  Identities=28%  Similarity=0.432  Sum_probs=31.8

Q ss_pred             CCCeeccccchhhccCCCC--CCCCchhhHHhhhcccccCC
Q psy6139          18 ECDTCAICRVQVMGTATVY--PEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus        18 ~~d~CaICr~~~~g~a~~~--p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      +++.|.||+++-.+-...|  -.|.|.-++=++..|+=-|+
T Consensus        64 e~~~C~IC~d~~Rd~~~icVVE~~~Dv~aiE~s~~y~G~Yh  104 (196)
T PRK00076         64 EQDPCEICSDPRRDQSLICVVESPADVLAIERTGEYRGLYH  104 (196)
T ss_pred             CCCcCCCCCCCCCCCCEEEEECCHHHHHHHHhhCcCceEEE
Confidence            6789999999987665544  57899999999999988775


No 27 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=36.93  E-value=11  Score=17.04  Aligned_cols=12  Identities=17%  Similarity=0.418  Sum_probs=9.4

Q ss_pred             eeccccchhhcc
Q psy6139          21 TCAICRVQVMGT   32 (69)
Q Consensus        21 ~CaICr~~~~g~   32 (69)
                      .|.+|...|...
T Consensus         3 ~C~~C~~~F~~~   14 (27)
T PF13912_consen    3 ECDECGKTFSSL   14 (27)
T ss_dssp             EETTTTEEESSH
T ss_pred             CCCccCCccCCh
Confidence            589999988654


No 28 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=36.12  E-value=16  Score=21.36  Aligned_cols=14  Identities=21%  Similarity=0.638  Sum_probs=12.1

Q ss_pred             CCCeeccccchhhc
Q psy6139          18 ECDTCAICRVQVMG   31 (69)
Q Consensus        18 ~~d~CaICr~~~~g   31 (69)
                      .+..|++|...|.+
T Consensus        77 ~~~~C~vC~k~l~~   90 (109)
T PF10367_consen   77 ESTKCSVCGKPLGN   90 (109)
T ss_pred             CCCCccCcCCcCCC
Confidence            47889999999976


No 29 
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=35.22  E-value=15  Score=22.08  Aligned_cols=14  Identities=36%  Similarity=0.764  Sum_probs=8.6

Q ss_pred             CCCeeccccchhhc
Q psy6139          18 ECDTCAICRVQVMG   31 (69)
Q Consensus        18 ~~d~CaICr~~~~g   31 (69)
                      +...|+||..++.+
T Consensus        21 q~~~C~iC~~~~~~   34 (81)
T PF02945_consen   21 QGGRCAICGKPLPG   34 (81)
T ss_dssp             TTTE-TTT-SEEET
T ss_pred             hCCcCcCCCCCccc
Confidence            56899999985543


No 30 
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=34.98  E-value=20  Score=18.70  Aligned_cols=12  Identities=33%  Similarity=0.811  Sum_probs=6.1

Q ss_pred             CCeeccccchhh
Q psy6139          19 CDTCAICRVQVM   30 (69)
Q Consensus        19 ~d~CaICr~~~~   30 (69)
                      ...|.|||.+++
T Consensus        37 ~~~CP~Cr~~i~   48 (50)
T PF13920_consen   37 KKKCPICRQPIE   48 (50)
T ss_dssp             TSBBTTTTBB-S
T ss_pred             CCCCCcCChhhc
Confidence            455666665554


No 31 
>PRK06848 hypothetical protein; Validated
Probab=33.81  E-value=12  Score=24.35  Aligned_cols=42  Identities=14%  Similarity=0.279  Sum_probs=24.7

Q ss_pred             CeeccccchhhccCCCCCCCCchhhHHhhh--cccccCCCCCCCccccCCC
Q psy6139          20 DTCAICRVQVMGTATVYPEPEDKLAFVKSF--VYDYSYSEPSVPTSYSWPK   68 (69)
Q Consensus        20 d~CaICr~~~~g~a~~~p~P~D~~~~V~~~--~Y~~~Y~~s~lp~~y~wp~   68 (69)
                      --||.||+-|.+..+      |..-+|-+.  .-..... .+||..|..++
T Consensus        95 ~PCG~CRQvl~E~~~------~~~v~v~~~~~~~~~~l~-eLLP~~f~~~~  138 (139)
T PRK06848         95 SPCGACRELISDYGK------NTNVIVPYNDELVKVNIM-ELLPNKYTREV  138 (139)
T ss_pred             CCChhhHHHHHHhCC------CCEEEEECCCCeEEEEHH-HhCccccCCCC
Confidence            379999999988632      322222111  1123443 68888887765


No 32 
>COG2174 RPL34A Ribosomal protein L34E [Translation, ribosomal structure and biogenesis]
Probab=32.32  E-value=22  Score=22.26  Aligned_cols=19  Identities=26%  Similarity=0.417  Sum_probs=15.6

Q ss_pred             CCCeeccccchhhccCCCC
Q psy6139          18 ECDTCAICRVQVMGTATVY   36 (69)
Q Consensus        18 ~~d~CaICr~~~~g~a~~~   36 (69)
                      .--.||||-.+|+|....-
T Consensus        33 ~~p~C~~cg~pL~Gi~r~R   51 (93)
T COG2174          33 TIPKCAICGRPLGGIPRGR   51 (93)
T ss_pred             CCCcccccCCccCCccCCC
Confidence            4578999999999987653


No 33 
>PF11100 TrbE:  Conjugal transfer protein TrbE ;  InterPro: IPR020150 TrbE is encoded by the F-plasmid and is located between traN and traF. The product of trbE is a small, integral, inner membrane protein. Mutation of trbE by insertional mutagenesis suggests that TrbE is not essential for F transfer from Escherichia coli (strain K12) under standard mating conditions [].
Probab=31.81  E-value=33  Score=20.16  Aligned_cols=16  Identities=38%  Similarity=0.684  Sum_probs=12.6

Q ss_pred             EEEEEEeEEEeEeecC
Q psy6139           3 TLKKWNAVAMWSWDVE   18 (69)
Q Consensus         3 ~i~~~~~v~~W~W~~~   18 (69)
                      ++.=+++|-.||||..
T Consensus        12 T~IviSPvIywSWDaV   27 (66)
T PF11100_consen   12 TAIVISPVIYWSWDAV   27 (66)
T ss_pred             hheeecceEEEEeccc
Confidence            4556789999999964


No 34 
>PLN02182 cytidine deaminase
Probab=31.31  E-value=17  Score=27.43  Aligned_cols=16  Identities=19%  Similarity=0.405  Sum_probs=13.6

Q ss_pred             CCeeccccchhhccCC
Q psy6139          19 CDTCAICRVQVMGTAT   34 (69)
Q Consensus        19 ~d~CaICr~~~~g~a~   34 (69)
                      .--||.||+-+.+...
T Consensus       129 ~sPCG~CRQfm~Ef~~  144 (339)
T PLN02182        129 GTPCGHCLQFLMEMSN  144 (339)
T ss_pred             cCCCchhHHHHHHhCC
Confidence            3589999999999865


No 35 
>PF02928 zf-C5HC2:  C5HC2 zinc finger;  InterPro: IPR004198 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a predicted zinc finger with eight potential zinc ligand binding residues. This domain is found in Jumonji [], and may have a DNA binding function. The mouse jumonji protein is required for neural tube formation, and is essential for normal heart development. It also plays a role in the down-regulation of cell proliferation signalling. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005634 nucleus
Probab=31.29  E-value=27  Score=19.03  Aligned_cols=19  Identities=26%  Similarity=0.700  Sum_probs=11.8

Q ss_pred             eccccchhhccCCCCC-CCC
Q psy6139          22 CAICRVQVMGTATVYP-EPE   40 (69)
Q Consensus        22 CaICr~~~~g~a~~~p-~P~   40 (69)
                      |.+||...--.+..|+ .|+
T Consensus         1 C~~Ck~~~yLS~v~C~C~~~   20 (54)
T PF02928_consen    1 CSICKAYCYLSAVTCSCKPD   20 (54)
T ss_pred             CcccCCchhhcccccCCCCC
Confidence            5667766666666666 444


No 36 
>PF13832 zf-HC5HC2H_2:  PHD-zinc-finger like domain
Probab=31.27  E-value=20  Score=21.52  Aligned_cols=21  Identities=24%  Similarity=0.444  Sum_probs=17.8

Q ss_pred             CCeeccccchhhccCCCCCCCC
Q psy6139          19 CDTCAICRVQVMGTATVYPEPE   40 (69)
Q Consensus        19 ~d~CaICr~~~~g~a~~~p~P~   40 (69)
                      ...|.||+.. .|.+..|..|+
T Consensus        55 ~~~C~iC~~~-~G~~i~C~~~~   75 (110)
T PF13832_consen   55 KLKCSICGKS-GGACIKCSHPG   75 (110)
T ss_pred             CCcCcCCCCC-CceeEEcCCCC
Confidence            5789999999 88888887776


No 37 
>PHA02447 hypothetical protein
Probab=31.08  E-value=19  Score=21.65  Aligned_cols=14  Identities=43%  Similarity=0.907  Sum_probs=11.5

Q ss_pred             EEEeEeecCCCeec
Q psy6139          10 VAMWSWDVECDTCA   23 (69)
Q Consensus        10 v~~W~W~~~~d~Ca   23 (69)
                      .+.++|++++.+|+
T Consensus        41 agdfrwsvedntca   54 (86)
T PHA02447         41 AGDFRWSVEDNTCA   54 (86)
T ss_pred             ccceeeeeccchHH
Confidence            35688999999997


No 38 
>PF14570 zf-RING_4:  RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B.
Probab=30.64  E-value=17  Score=20.02  Aligned_cols=20  Identities=25%  Similarity=0.474  Sum_probs=9.0

Q ss_pred             Ceeccc----cchhhccCCCCCCC
Q psy6139          20 DTCAIC----RVQVMGTATVYPEP   39 (69)
Q Consensus        20 d~CaIC----r~~~~g~a~~~p~P   39 (69)
                      ..|.-|    +...+|.||.|.+|
T Consensus        23 ~IC~~C~~~i~~~~~g~CPgCr~~   46 (48)
T PF14570_consen   23 QICRFCYHDILENEGGRCPGCREP   46 (48)
T ss_dssp             ---HHHHHHHTTSS-SB-TTT--B
T ss_pred             cHHHHHHHHHHhccCCCCCCCCCC
Confidence            345555    44568888888876


No 39 
>PLN02402 cytidine deaminase
Probab=30.41  E-value=17  Score=26.95  Aligned_cols=14  Identities=21%  Similarity=0.449  Sum_probs=12.7

Q ss_pred             CeeccccchhhccC
Q psy6139          20 DTCAICRVQVMGTA   33 (69)
Q Consensus        20 d~CaICr~~~~g~a   33 (69)
                      .-||+||+-+.+.+
T Consensus       102 sPCG~CRQ~l~Ef~  115 (303)
T PLN02402        102 APCGHCRQFFQEIR  115 (303)
T ss_pred             CCCcccHHHHHHhc
Confidence            69999999999885


No 40 
>PRK05578 cytidine deaminase; Validated
Probab=30.25  E-value=14  Score=23.78  Aligned_cols=15  Identities=20%  Similarity=0.456  Sum_probs=12.8

Q ss_pred             CCeeccccchhhccC
Q psy6139          19 CDTCAICRVQVMGTA   33 (69)
Q Consensus        19 ~d~CaICr~~~~g~a   33 (69)
                      .--||.||+-|.+..
T Consensus        83 ~sPCG~CRQ~l~e~~   97 (131)
T PRK05578         83 LSPCGRCRQVLAEFG   97 (131)
T ss_pred             cCccHHHHHHHHHhC
Confidence            357999999999886


No 41 
>PF10146 zf-C4H2:  Zinc finger-containing protein ;  InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a family of proteins which appears to have a highly conserved zinc finger domain at the C-terminal end, described as -C-X2-CH-X3-H-X5-C-X2-C-. The structure is predicted to contain a coiled coil. Members of this family are annotated as being tumour-associated antigen HCA127 in humans, but this could not be confirmed.
Probab=28.13  E-value=21  Score=25.24  Aligned_cols=19  Identities=32%  Similarity=0.649  Sum_probs=17.0

Q ss_pred             CeeccccchhhccCCCCCC
Q psy6139          20 DTCAICRVQVMGTATVYPE   38 (69)
Q Consensus        20 d~CaICr~~~~g~a~~~p~   38 (69)
                      -+|--|.+.++.-||.||.
T Consensus       195 K~C~sC~qqIHRNAPiCPl  213 (230)
T PF10146_consen  195 KTCQSCHQQIHRNAPICPL  213 (230)
T ss_pred             chhHhHHHHHhcCCCCCcc
Confidence            3799999999999999984


No 42 
>PTZ00317 NADP-dependent malic enzyme; Provisional
Probab=27.33  E-value=46  Score=26.72  Aligned_cols=30  Identities=27%  Similarity=0.298  Sum_probs=20.7

Q ss_pred             cccchh-hccCCCCCCC---CchhhHHhhhcccc
Q psy6139          24 ICRVQV-MGTATVYPEP---EDKLAFVKSFVYDY   53 (69)
Q Consensus        24 ICr~~~-~g~a~~~p~P---~D~~~~V~~~~Y~~   53 (69)
                      +.+.++ +|+|...+.|   .|..+||+++||++
T Consensus       525 V~~~A~~~G~A~~~~~~~~~~~~~~~i~~~~w~P  558 (559)
T PTZ00317        525 VIEEAQEMGIAKNKDLPDNRDELLALVKDRMWVP  558 (559)
T ss_pred             HHHHHHHhCCCccCCCCCCHHHHHHHHHhcCcCC
Confidence            344444 4688764434   47799999999986


No 43 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=26.83  E-value=24  Score=15.21  Aligned_cols=11  Identities=27%  Similarity=0.727  Sum_probs=7.9

Q ss_pred             eeccccchhhc
Q psy6139          21 TCAICRVQVMG   31 (69)
Q Consensus        21 ~CaICr~~~~g   31 (69)
                      .|.+|...|..
T Consensus         2 ~C~~C~~~f~~   12 (23)
T PF00096_consen    2 KCPICGKSFSS   12 (23)
T ss_dssp             EETTTTEEESS
T ss_pred             CCCCCCCccCC
Confidence            47888877754


No 44 
>KOG1039|consensus
Probab=26.01  E-value=32  Score=25.85  Aligned_cols=17  Identities=24%  Similarity=0.454  Sum_probs=14.1

Q ss_pred             cCCCeeccccchhhccC
Q psy6139          17 VECDTCAICRVQVMGTA   33 (69)
Q Consensus        17 ~~~d~CaICr~~~~g~a   33 (69)
                      ..+.+||||.......+
T Consensus       159 s~~k~CGICme~i~ek~  175 (344)
T KOG1039|consen  159 SSEKECGICMETINEKA  175 (344)
T ss_pred             cccccceehhhhccccc
Confidence            36899999998887776


No 45 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=24.75  E-value=29  Score=17.92  Aligned_cols=11  Identities=27%  Similarity=0.591  Sum_probs=7.1

Q ss_pred             eccccchhhcc
Q psy6139          22 CAICRVQVMGT   32 (69)
Q Consensus        22 CaICr~~~~g~   32 (69)
                      |.||...|.+.
T Consensus         1 CpiC~~~~~~P   11 (42)
T PF15227_consen    1 CPICLDLFKDP   11 (42)
T ss_dssp             ETTTTSB-SSE
T ss_pred             CCccchhhCCc
Confidence            77888877653


No 46 
>TIGR01355 cyt_deam_dimer cytidine deaminase, homodimeric. This homodimeric zinc metalloprotein is found in Arabidopis and some Proteobacteria. A related, homotetrameric form with a much smaller subunit is found most bacteria and in animals. Both types may act on deoxycytidine as well as cytidine.
Probab=24.59  E-value=25  Score=25.70  Aligned_cols=16  Identities=19%  Similarity=0.403  Sum_probs=13.6

Q ss_pred             CCeeccccchhhccCC
Q psy6139          19 CDTCAICRVQVMGTAT   34 (69)
Q Consensus        19 ~d~CaICr~~~~g~a~   34 (69)
                      ..-||.||+-+.+.+.
T Consensus        98 ~~PCG~CRQ~l~Ef~~  113 (283)
T TIGR01355        98 YAPCGHCRQFLNEIRN  113 (283)
T ss_pred             eCCcchhHHHHHHhcC
Confidence            4589999999999864


No 47 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=23.72  E-value=28  Score=17.10  Aligned_cols=19  Identities=11%  Similarity=0.247  Sum_probs=12.1

Q ss_pred             CeeccccchhhccCCCCCC
Q psy6139          20 DTCAICRVQVMGTATVYPE   38 (69)
Q Consensus        20 d~CaICr~~~~g~a~~~p~   38 (69)
                      ..|+||.+.-.=.|+.|-.
T Consensus         3 ~~C~vC~~~~kY~Cp~C~~   21 (30)
T PF04438_consen    3 KLCSVCGNPAKYRCPRCGA   21 (30)
T ss_dssp             EEETSSSSEESEE-TTT--
T ss_pred             CCCccCcCCCEEECCCcCC
Confidence            5799999866666776644


No 48 
>COG4844 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.53  E-value=28  Score=20.95  Aligned_cols=34  Identities=12%  Similarity=0.285  Sum_probs=20.2

Q ss_pred             CeeccccchhhccCCCCCCCCchhhHHhhhcccc
Q psy6139          20 DTCAICRVQVMGTATVYPEPEDKLAFVKSFVYDY   53 (69)
Q Consensus        20 d~CaICr~~~~g~a~~~p~P~D~~~~V~~~~Y~~   53 (69)
                      -.||||.+++-.+-..=-.-|+.-+=...++|.+
T Consensus        38 t~Cg~Ca~~lfALVnGevV~Get~eeLv~NIY~~   71 (78)
T COG4844          38 THCGICAASLFALVNGEVVEGETPEELVENIYTF   71 (78)
T ss_pred             hhhhhHHHhHHHHhcCceecCCCHHHHHHHHHHH
Confidence            4699999998766654444444443333455543


No 49 
>PF07824 Chaperone_III:  Type III secretion chaperone domain;  InterPro: IPR013095 Type III secretion chaperones are involved in delivering virulence effector proteins from bacterial pathogens directly into eukaryotic cells. The chaperones may prevent aggregation and degradation of their substrates, may target the effector to the secretion apparatus, and may ensure a secretion-component unfolded conformation of their specific substrate. One member of this family, SigE (O30917 from SWISSPROT) forms homodimers in crystal. The monomers have a novel fold with an alpha-beta(3)-alpha-beta(2)-alpha topology []. ; PDB: 1K3S_B.
Probab=23.33  E-value=7  Score=25.15  Aligned_cols=27  Identities=15%  Similarity=0.263  Sum_probs=17.6

Q ss_pred             hhhccCCCCCCCCchhhHHhhhcccccCC
Q psy6139          28 QVMGTATVYPEPEDKLAFVKSFVYDYSYS   56 (69)
Q Consensus        28 ~~~g~a~~~p~P~D~~~~V~~~~Y~~~Y~   56 (69)
                      .++-+||.||-|+|...++  +.-+.+|.
T Consensus        38 ~lem~CPf~~LPd~i~~Lq--~~L~lNYs   64 (112)
T PF07824_consen   38 SLEMCCPFMPLPDNINTLQ--HFLSLNYS   64 (112)
T ss_dssp             EEEEEEEEEE---SHHHHH--HHHHHHHH
T ss_pred             ceeeecCcccCcchHHHHH--HHHhhccc
Confidence            3567899999999999876  44556664


No 50 
>PRK09027 cytidine deaminase; Provisional
Probab=22.88  E-value=28  Score=25.59  Aligned_cols=16  Identities=19%  Similarity=0.418  Sum_probs=13.8

Q ss_pred             CCeeccccchhhccCC
Q psy6139          19 CDTCAICRVQVMGTAT   34 (69)
Q Consensus        19 ~d~CaICr~~~~g~a~   34 (69)
                      ..-||.||+-+.+.+.
T Consensus       126 ~sPCG~CRQ~l~E~~~  141 (295)
T PRK09027        126 YTPCGHCRQFMNELNS  141 (295)
T ss_pred             ecCchhhHHHHHHhCC
Confidence            4589999999999875


No 51 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=22.76  E-value=29  Score=14.47  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=5.6

Q ss_pred             eeccccchhhc
Q psy6139          21 TCAICRVQVMG   31 (69)
Q Consensus        21 ~CaICr~~~~g   31 (69)
                      .|.+|...|..
T Consensus         2 ~C~~C~~~~~~   12 (24)
T PF13894_consen    2 QCPICGKSFRS   12 (24)
T ss_dssp             E-SSTS-EESS
T ss_pred             CCcCCCCcCCc
Confidence            47777766644


No 52 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=21.92  E-value=34  Score=16.39  Aligned_cols=16  Identities=25%  Similarity=0.507  Sum_probs=12.2

Q ss_pred             eeccccchhhcc-CCCC
Q psy6139          21 TCAICRVQVMGT-ATVY   36 (69)
Q Consensus        21 ~CaICr~~~~g~-a~~~   36 (69)
                      .|.+|+..++|. .=.|
T Consensus         2 ~C~~C~~~~~~~~~Y~C   18 (30)
T PF03107_consen    2 WCDVCRRKIDGFYFYHC   18 (30)
T ss_pred             CCCCCCCCcCCCEeEEe
Confidence            589999999887 4444


No 53 
>PRK08061 rpsN 30S ribosomal protein S14; Reviewed
Probab=21.82  E-value=29  Score=19.98  Aligned_cols=20  Identities=20%  Similarity=0.243  Sum_probs=16.6

Q ss_pred             eeccccchhhccCCCCCCCC
Q psy6139          21 TCAICRVQVMGTATVYPEPE   40 (69)
Q Consensus        21 ~CaICr~~~~g~a~~~p~P~   40 (69)
                      ..++||+.|.++|..--.||
T Consensus        36 ~fgl~R~~FRe~A~~G~ipG   55 (61)
T PRK08061         36 KFGLCRICFRELAYKGQIPG   55 (61)
T ss_pred             cCCccHHHHHHHHHcCcCCC
Confidence            45799999999998887776


No 54 
>TIGR01354 cyt_deam_tetra cytidine deaminase, homotetrameric. This small, homotetrameric zinc metalloprotein is found in humans and most bacteria. A related, homodimeric form with a much larger subunit is found in E. coli and in Arabidopsis. Both types may act on deoxycytidine as well as cytidine.
Probab=21.57  E-value=25  Score=22.22  Aligned_cols=15  Identities=27%  Similarity=0.567  Sum_probs=13.3

Q ss_pred             CCeeccccchhhccC
Q psy6139          19 CDTCAICRVQVMGTA   33 (69)
Q Consensus        19 ~d~CaICr~~~~g~a   33 (69)
                      .--||.||+-+...+
T Consensus        80 ~sPCG~Crq~l~e~~   94 (127)
T TIGR01354        80 VSPCGACRQVLAEFA   94 (127)
T ss_pred             cCccHHHHHHHHHhC
Confidence            468999999999987


No 55 
>KOG0833|consensus
Probab=21.01  E-value=26  Score=24.14  Aligned_cols=17  Identities=18%  Similarity=0.413  Sum_probs=13.7

Q ss_pred             CCCeeccccchhhccCC
Q psy6139          18 ECDTCAICRVQVMGTAT   34 (69)
Q Consensus        18 ~~d~CaICr~~~~g~a~   34 (69)
                      -..-||.||+.+.+...
T Consensus       101 f~tPCG~CRQfl~Ef~~  117 (173)
T KOG0833|consen  101 FTTPCGVCRQFLREFGN  117 (173)
T ss_pred             cCCCcHHHHHHHHHHhh
Confidence            36789999999977665


No 56 
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=20.99  E-value=32  Score=18.17  Aligned_cols=17  Identities=24%  Similarity=0.698  Sum_probs=12.4

Q ss_pred             eecCCCeeccccchhhc
Q psy6139          15 WDVECDTCAICRVQVMG   31 (69)
Q Consensus        15 W~~~~d~CaICr~~~~g   31 (69)
                      |..-++.|..|..++..
T Consensus        13 ~~ML~~~Cp~C~~PL~~   29 (41)
T PF06677_consen   13 WTMLDEHCPDCGTPLMR   29 (41)
T ss_pred             HhHhcCccCCCCCeeEE
Confidence            34567888888888765


No 57 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=20.75  E-value=38  Score=16.00  Aligned_cols=12  Identities=25%  Similarity=0.742  Sum_probs=9.1

Q ss_pred             eeccccchhhcc
Q psy6139          21 TCAICRVQVMGT   32 (69)
Q Consensus        21 ~CaICr~~~~g~   32 (69)
                      .|.+|...|.+.
T Consensus         5 ~C~~C~~~~~~~   16 (35)
T smart00451        5 YCKLCNVTFTDE   16 (35)
T ss_pred             EccccCCccCCH
Confidence            588998888743


No 58 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=20.69  E-value=37  Score=15.99  Aligned_cols=9  Identities=33%  Similarity=0.922  Sum_probs=7.0

Q ss_pred             eeccccchh
Q psy6139          21 TCAICRVQV   29 (69)
Q Consensus        21 ~CaICr~~~   29 (69)
                      .|+||...+
T Consensus         1 ~C~iC~~~~    9 (45)
T cd00162           1 ECPICLEEF    9 (45)
T ss_pred             CCCcCchhh
Confidence            488888877


No 59 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=20.13  E-value=26  Score=19.32  Aligned_cols=17  Identities=35%  Similarity=0.827  Sum_probs=8.8

Q ss_pred             eEeecCCCeeccccchh
Q psy6139          13 WSWDVECDTCAICRVQV   29 (69)
Q Consensus        13 W~W~~~~d~CaICr~~~   29 (69)
                      |.=+-+...|.+|+..|
T Consensus         3 W~~d~~~~~C~~C~~~F   19 (69)
T PF01363_consen    3 WVPDSEASNCMICGKKF   19 (69)
T ss_dssp             SSSGGG-SB-TTT--B-
T ss_pred             cCCCCCCCcCcCcCCcC
Confidence            44455678999999999


Done!