Diaphorina citri psyllid: psy6150


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MSTVHTWSTPSLDEVNLCCRGSVRFQSTSIDGVDHVWTQLTKKNAVYSRVARVCKSDKGGPHHFGDRWTTFLKSRLNCSVPGDYPFYFDEIRLPEDCVNLQDPYCAWDLKLRKDCVNLQDPYCAWDLKLRKCVPYQERTLELLFCFTQ
ccccccccccccccccEEEEEEEEccccccccccEEEEEEccccEEEEEEEEcccccccccccccccccEEEccEEccccccccccccEEECcccccccccccEEEECccccccccccccEEEEECcccccCECcccccEEEEEEEcc
******WSTPSLDEVNLCCRGSVRFQSTSIDGVDHVWTQLTKKNAVYSRVARVCKSDKGGPHHFGDRWTTFLKSRLNCSVPGDYPFYFDEIRLPEDCVNLQDPYCAWDLKLRKDCVNLQDPYCAWDLKLRKCVPYQERTLELLFCFTQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTVHTWSTPSLDEVNLCCRGSVRFQSTSIDGVDHVWTQLTKKNAVYSRVARVCKSDKGGPHHFGDRWTTFLKSRLNCSVPGDYPFYFDEIRLPEDCVNLQDPYCAWDLKLRKDCVNLQDPYCAWDLKLRKCVPYQERTLELLFCFTQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Semaphorin-1A Plays a role in growth cones guidance.confidentQ24322

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q47, chain A
Confidence level:very confident
Coverage over the Query: 6-141
View the alignment between query and template
View the model in PyMOL