BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6182
(323 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2CZR|A Chain A, Crystal Structure Of Tbp-interacting Protein (tk-tip26)
And Implications For Its Inhibition Mechanism Of The
Interaction Between Tbp And Tata-dna
Length = 226
Score = 29.6 bits (65), Expect = 2.5, Method: Compositional matrix adjust.
Identities = 19/61 (31%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
Query: 254 KKCLSILKTLRDRHLELPGNPVTNYHMKTLLLYECEKHPNELEWDESCLGDRINGILLQL 313
KK + ++ L D H E+ G+ +T H K+ + + N E D S G +NGI +
Sbjct: 18 KKVYTQVRYLDDYHWEIEGSTITGIHKKSNVKVVIDVAKNREEAD-SLAGKDVNGIHIVA 76
Query: 314 I 314
I
Sbjct: 77 I 77
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.137 0.420
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,227,924
Number of Sequences: 62578
Number of extensions: 354341
Number of successful extensions: 776
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 774
Number of HSP's gapped (non-prelim): 3
length of query: 323
length of database: 14,973,337
effective HSP length: 99
effective length of query: 224
effective length of database: 8,778,115
effective search space: 1966297760
effective search space used: 1966297760
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)