BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy6187
         (667 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2CZR|A Chain A, Crystal Structure Of Tbp-interacting Protein (tk-tip26)
           And Implications For Its Inhibition Mechanism Of The
           Interaction Between Tbp And Tata-dna
          Length = 226

 Score = 33.5 bits (75), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 1/64 (1%)

Query: 553 PGNPKCLSILKTLRDRHLELPGNPVTNYHMKTLLLYECEKHPNELEWDESCLGDRINGIL 612
           PG  K  + ++ L D H E+ G+ +T  H K+ +    +   N  E D S  G  +NGI 
Sbjct: 15  PGTKKVYTQVRYLDDYHWEIEGSTITGIHKKSNVKVVIDVAKNREEAD-SLAGKDVNGIH 73

Query: 613 LQLI 616
           +  I
Sbjct: 74  IVAI 77


>pdb|1PS0|A Chain A, Crystal Structure Of The Nadp(H)-Dependent Cinnamyl
           Alcohol Dehydrogenase From Saccharomyces Cerevisiae
 pdb|1Q1N|A Chain A, Apo And Holo Structures Of An Nadp(h)-dependent Cinnamyl
           Alcohol Dehydrogenase From Saccharomyces Cerevisiae
 pdb|1PIW|A Chain A, Apo And Holo Structures Of An Nadp(H)-Dependent Cinnamyl
           Alcohol Dehydrogenase From Saccharomyces Cerevisiae
 pdb|1PIW|B Chain B, Apo And Holo Structures Of An Nadp(H)-Dependent Cinnamyl
           Alcohol Dehydrogenase From Saccharomyces Cerevisiae
          Length = 360

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 16/23 (69%), Gaps = 1/23 (4%)

Query: 146 VGDRINGIFLQLISCLQCKRCPN 168
           VG R+ G+  Q+ SCL+C RC N
Sbjct: 87  VGQRV-GVGAQVFSCLECDRCKN 108


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.136    0.423 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 18,921,366
Number of Sequences: 62578
Number of extensions: 734060
Number of successful extensions: 1619
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 1617
Number of HSP's gapped (non-prelim): 8
length of query: 667
length of database: 14,973,337
effective HSP length: 105
effective length of query: 562
effective length of database: 8,402,647
effective search space: 4722287614
effective search space used: 4722287614
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 55 (25.8 bits)