Query         psy6193
Match_columns 122
No_of_seqs    120 out of 173
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 20:05:02 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6193.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6193hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3799|consensus               99.9 2.3E-25   5E-30  170.9   5.9   99   16-114     1-161 (169)
  2 PF02318 FYVE_2:  FYVE-type zin  99.9 3.2E-24   7E-29  154.9   4.9   63   23-85      1-117 (118)
  3 PF04810 zf-Sec23_Sec24:  Sec23  75.5    0.79 1.7E-05   27.6  -0.2   15   60-74     22-36  (40)
  4 PF13945 NST1:  Salt tolerance   71.2       6 0.00013   31.7   3.7   39   24-72    113-151 (190)
  5 COG1997 RPL43A Ribosomal prote  59.6     6.8 0.00015   28.3   1.8   28   43-70     25-61  (89)
  6 PRK10778 dksA RNA polymerase-b  58.7      30 0.00065   26.4   5.3   48   27-75     79-145 (151)
  7 PF01780 Ribosomal_L37ae:  Ribo  58.5     5.8 0.00012   28.5   1.3   40   43-86     25-73  (90)
  8 PRK12495 hypothetical protein;  57.6      19 0.00041   29.8   4.3   48   24-72      4-68  (226)
  9 PF04545 Sigma70_r4:  Sigma-70,  53.2     9.4  0.0002   22.9   1.5   25   22-46      2-26  (50)
 10 PF09776 Mitoc_L55:  Mitochondr  52.3      12 0.00026   28.0   2.2   16   20-35     72-87  (116)
 11 PF14156 AbbA_antirepres:  Anti  51.7      14  0.0003   25.2   2.2   20   23-42      7-26  (63)
 12 COG1150 HdrC Heterodisulfide r  47.5      17 0.00037   29.4   2.5   25   18-42      7-31  (195)
 13 PLN03131 hypothetical protein;  47.5      15 0.00032   34.8   2.4   30   41-70      4-51  (705)
 14 KOG1013|consensus               47.2     8.4 0.00018   33.8   0.8   23   62-87    185-207 (362)
 15 PRK09458 pspB phage shock prot  44.2      43 0.00093   23.4   3.8   24   23-46     34-57  (75)
 16 PLN03119 putative ADP-ribosyla  43.9      17 0.00038   34.0   2.3   30   41-70      4-51  (648)
 17 PF13274 DUF4065:  Protein of u  40.3      31 0.00068   22.9   2.6   28   20-47     66-93  (108)
 18 PF09098 Dehyd-heme_bind:  Quin  39.8      19 0.00042   28.5   1.7   36   24-59     50-104 (167)
 19 TIGR02890 spore_yteA sporulati  39.8      76  0.0016   24.4   4.9   48   26-74     53-119 (159)
 20 KOG1985|consensus               39.1      10 0.00022   36.8  -0.0   20   55-74    221-252 (887)
 21 PF06667 PspB:  Phage shock pro  38.2      61  0.0013   22.4   3.8   25   22-46     33-57  (75)
 22 PRK14890 putative Zn-ribbon RN  36.8      13 0.00027   25.0   0.2   19   55-73     28-47  (59)
 23 PF07295 DUF1451:  Protein of u  36.6      72  0.0016   24.3   4.3   21   20-40     28-48  (146)
 24 PF03754 DUF313:  Domain of unk  36.5      16 0.00034   26.9   0.7   16   18-33     46-61  (114)
 25 PHA02078 hypothetical protein   36.5      19 0.00041   23.9   1.0   28   21-48     26-53  (54)
 26 TIGR00280 L37a ribosomal prote  36.3      24 0.00051   25.4   1.5   29   54-86     37-73  (91)
 27 PF01586 Basic:  Myogenic Basic  35.6      12 0.00026   26.7  -0.1   15   56-72     68-82  (86)
 28 COG5028 Vesicle coat complex C  34.5      12 0.00027   36.0  -0.2   21   55-75    202-234 (861)
 29 PLN00162 transport protein sec  34.0      12 0.00027   34.9  -0.2   20   55-74     56-87  (761)
 30 COG1734 DksA DnaK suppressor p  33.7 1.2E+02  0.0026   22.5   5.0   57   19-76     41-115 (120)
 31 PTZ00255 60S ribosomal protein  33.5      27 0.00058   25.1   1.5   40   43-86     26-74  (90)
 32 PF08986 DUF1889:  Domain of un  32.9      12 0.00025   28.0  -0.5   26    3-37     31-57  (119)
 33 PF04829 PT-VENN:  Pre-toxin do  32.7      32  0.0007   22.3   1.6   16   21-36      1-16  (55)
 34 PRK03976 rpl37ae 50S ribosomal  32.2      30 0.00064   24.8   1.5   40   43-86     26-74  (90)
 35 PF13442 Cytochrome_CBB3:  Cyto  31.3      70  0.0015   19.7   3.0   19   19-37     48-67  (67)
 36 PRK14810 formamidopyrimidine-D  31.3      72  0.0016   26.0   3.8   16   55-70    247-272 (272)
 37 PF10335 DUF294_C:  Putative nu  30.8      90   0.002   22.9   3.9   32   16-47    110-141 (145)
 38 cd02406 CRS2 Chloroplast RNA s  28.8      84  0.0018   24.9   3.7   26   15-41    143-168 (191)
 39 PF13936 HTH_38:  Helix-turn-he  28.2      35 0.00077   20.4   1.2   17   23-39      3-19  (44)
 40 PF01921 tRNA-synt_1f:  tRNA sy  27.8      48   0.001   28.9   2.3   50   30-79    141-216 (360)
 41 PF10910 DUF2744:  Protein of u  27.7      41 0.00088   25.5   1.6   27   14-40     91-117 (125)
 42 TIGR03045 PS_II_C550 cytochrom  27.6      78  0.0017   24.5   3.2   27   16-42    123-149 (159)
 43 cd00729 rubredoxin_SM Rubredox  26.0      24 0.00052   20.5   0.1   10   62-71      2-11  (34)
 44 PF07649 C1_3:  C1-like domain;  25.7      25 0.00054   19.5   0.1   16   64-84      2-17  (30)
 45 PF01935 DUF87:  Domain of unkn  25.7      56  0.0012   24.7   2.1   22   18-39    206-227 (229)
 46 PF04120 Iron_permease:  Low af  25.6      93   0.002   23.5   3.3   26   17-42     87-112 (132)
 47 PF09862 DUF2089:  Protein of u  25.2      74  0.0016   23.5   2.6   33   18-50     27-59  (113)
 48 PF04959 ARS2:  Arsenite-resist  25.1      71  0.0015   25.9   2.7   24   60-83     75-106 (214)
 49 KOG0860|consensus               24.5      68  0.0015   24.0   2.3   19   30-48     46-64  (116)
 50 CHL00183 petJ cytochrome c553;  24.0 1.1E+02  0.0023   21.0   3.2   23   19-41     81-104 (108)
 51 PF08432 Vfa1:  AAA-ATPase Vps4  23.6      18  0.0004   27.9  -0.9   36   64-100    15-53  (182)
 52 PF13864 Enkurin:  Calmodulin-b  23.5 1.7E+02  0.0036   20.2   4.0   31   20-50     32-62  (98)
 53 PF11161 DUF2944:  Protein of u  23.4      30 0.00064   27.9   0.2   11   78-88     65-75  (187)
 54 PF03107 C1_2:  C1 domain;  Int  23.3      29 0.00062   19.4   0.1   10   63-72      1-10  (30)
 55 PF14445 Prok-RING_2:  Prokaryo  23.2      41 0.00088   22.4   0.8   22   54-77     24-45  (57)
 56 PF11686 DUF3283:  Protein of u  23.1      64  0.0014   21.8   1.7   14   21-34      1-14  (61)
 57 TIGR02420 dksA RNA polymerase-  23.1 2.2E+02  0.0048   20.0   4.7   43   27-70     48-109 (110)
 58 PF09332 Mcm10:  Mcm10 replicat  23.0      24 0.00051   30.6  -0.4   12   60-71    283-294 (344)
 59 smart00520 BASIC Basic domain   21.9      26 0.00055   25.4  -0.4   15   56-72     68-82  (91)
 60 KOG4275|consensus               21.8      46   0.001   29.1   1.1   22   19-40    240-264 (350)
 61 TIGR00447 pth peptidyl-tRNA hy  21.4 1.6E+02  0.0034   23.2   3.9   27   15-42    142-168 (188)
 62 PF04936 DUF658:  Protein of un  20.9 1.4E+02  0.0031   24.0   3.6   35   17-54    134-169 (186)
 63 cd08818 CARD_MDA5_1 Caspase ac  20.5 2.2E+02  0.0049   20.3   4.2   45   19-64     25-69  (88)
 64 cd01277 HINT_subgroup HINT (hi  20.1 1.2E+02  0.0027   19.9   2.7   24   18-41     44-67  (103)
 65 PRK13622 psbV cytochrome c-550  20.0 1.2E+02  0.0025   24.3   2.9   29   14-42    132-160 (180)
 66 PF10955 DUF2757:  Protein of u  20.0      54  0.0012   22.8   0.9   19   18-36     25-43  (76)

No 1  
>KOG3799|consensus
Probab=99.92  E-value=2.3e-25  Score=170.90  Aligned_cols=99  Identities=43%  Similarity=0.791  Sum_probs=87.2

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHhHHHHHHHHHHHHHhh----------------------------hhccc--------
Q psy6193          16 ADIIPDLSHLTLEERQIIESVMMRQKQEEERELEIMRSA----------------------------CQVYL--------   59 (122)
Q Consensus        16 ~~e~pdLS~LTeeEreiIl~VL~Rdk~le~~E~eRirrL----------------------------C~~C~--------   59 (122)
                      |.+||||||||+.||-.|.+|+.|++.++.++.+++++.                            |+||+        
T Consensus         1 ~~~~~d~sh~T~he~~qik~vf~rqk~ee~kq~ei~~~~~~e~~el~~Qi~erkEqqKKaGv~ddatC~IC~KTKFADG~   80 (169)
T KOG3799|consen    1 MDEMPDLSHLTPHERMQIKEVFIRQKIEEHKQFEIYKEQVKEMGELSQQIQERKEQQKKAGVGDDATCGICHKTKFADGC   80 (169)
T ss_pred             CccccchhhcCccchHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccCcCcchhhhhhccccccc
Confidence            578999999999999999999999999999887765433                            66666        


Q ss_pred             ------------------------ccccccchhhhhhhHhhhcccccccCCCCCC-CCccc-cccccccCCCccccchhh
Q psy6193          60 ------------------------MVIWVCILCRKKQELLSKTGQWINKGMNSTP-QGDAI-MRKIEADMMFEDKRPKLE  113 (122)
Q Consensus        60 ------------------------k~~W~C~vC~k~~eL~~kSGeWFye~~~~~~-~~~~~-~r~~~~~~~~~dk~~kl~  113 (122)
                                              |++|+|++|+++++|+++||.|||++++.+| ++|.. +|+++.+..|+||+|||-
T Consensus        81 GH~C~YCq~r~CARCGGrv~lrsNKv~wvcnlc~k~q~il~ksg~wf~~sgs~~~~~pd~~v~~~~~~~~~p~~k~p~~~  160 (169)
T KOG3799|consen   81 GHNCSYCQTRFCARCGGRVSLRSNKVMWVCNLCRKQQEILTKSGAWFYNSGSNTPQQPDQKVLRGLRNEEAPQEKKPKLH  160 (169)
T ss_pred             CcccchhhhhHHHhcCCeeeeccCceEEeccCCcHHHHHHHhcchHHHhcCCCCCCCcccccccchhcccCCcccccchh
Confidence                                    6899999999999999999999999999877 55544 999999999999999985


Q ss_pred             c
Q psy6193         114 R  114 (122)
Q Consensus       114 ~  114 (122)
                      .
T Consensus       161 ~  161 (169)
T KOG3799|consen  161 E  161 (169)
T ss_pred             h
Confidence            4


No 2  
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=99.90  E-value=3.2e-24  Score=154.90  Aligned_cols=63  Identities=40%  Similarity=0.730  Sum_probs=56.6

Q ss_pred             CCCCHHHHHHHHHHHHhHHHHHHHHHHHHHhh------------------------hhccc-------------------
Q psy6193          23 SHLTLEERQIIESVMMRQKQEEERELEIMRSA------------------------CQVYL-------------------   59 (122)
Q Consensus        23 S~LTeeEreiIl~VL~Rdk~le~~E~eRirrL------------------------C~~C~-------------------   59 (122)
                      ||||++||++|++||+||++++++|++||++|                        |++|.                   
T Consensus         1 s~Lt~eE~~~I~~Vl~R~~~l~~~E~~Ri~kLk~~L~~e~~r~~~~~~~~~~~~~~C~~C~~~fg~l~~~~~~C~~C~~~   80 (118)
T PF02318_consen    1 SHLTEEEREIILQVLQRDEELRKKEEERIRKLKQELQKEKMRREALGNSQKYGERHCARCGKPFGFLFNRGRVCVDCKHR   80 (118)
T ss_dssp             TTS-CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSCSTTHCCSB-TTTS-BCSCTSTTCEEETTTTEE
T ss_pred             CCCCHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccccCCcchhhhCCcccccCCCCCcCCcCCcc
Confidence            89999999999999999999999999999887                        55544                   


Q ss_pred             -----------ccccccchhhhhhhHhhhcccccccC
Q psy6193          60 -----------MVIWVCILCRKKQELLSKTGQWINKG   85 (122)
Q Consensus        60 -----------k~~W~C~vC~k~~eL~~kSGeWFye~   85 (122)
                                 +..|+|++|++.++|+++||+|||++
T Consensus        81 VC~~C~~~~~~~~~WlC~vC~k~rel~~~sG~Wf~~~  117 (118)
T PF02318_consen   81 VCKKCGVYSKKEPIWLCKVCQKQRELKKKSGEWFYEE  117 (118)
T ss_dssp             EETTSEEETSSSCCEEEHHHHHHHHHHHHCSHHHHCC
T ss_pred             ccCccCCcCCCCCCEEChhhHHHHHHHHHhhhHHhcc
Confidence                       46999999999999999999999986


No 3  
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=75.54  E-value=0.79  Score=27.57  Aligned_cols=15  Identities=33%  Similarity=0.893  Sum_probs=9.4

Q ss_pred             ccccccchhhhhhhH
Q psy6193          60 MVIWVCILCRKKQEL   74 (122)
Q Consensus        60 k~~W~C~vC~k~~eL   74 (122)
                      ...|.|++|....+|
T Consensus        22 ~~~w~C~~C~~~N~l   36 (40)
T PF04810_consen   22 GKTWICNFCGTKNPL   36 (40)
T ss_dssp             TTEEEETTT--EEE-
T ss_pred             CCEEECcCCCCcCCC
Confidence            358999999876544


No 4  
>PF13945 NST1:  Salt tolerance down-regulator
Probab=71.20  E-value=6  Score=31.67  Aligned_cols=39  Identities=18%  Similarity=0.335  Sum_probs=21.6

Q ss_pred             CCCHHHHHHHHHHHHhHHHHHHHHHHHHHhhhhcccccccccchhhhhh
Q psy6193          24 HLTLEERQIIESVMMRQKQEEERELEIMRSACQVYLMVIWVCILCRKKQ   72 (122)
Q Consensus        24 ~LTeeEreiIl~VL~Rdk~le~~E~eRirrLC~~C~k~~W~C~vC~k~~   72 (122)
                      .|+|+||.-|+.| ..+.-|+.+-++-    ++-|-     |+||+..+
T Consensus       113 SL~eeERr~LVkI-EKe~VLkkmKeqq----~h~C~-----C~vCgr~~  151 (190)
T PF13945_consen  113 SLSEEERRSLVKI-EKEAVLKKMKEQQ----KHSCS-----CSVCGRKR  151 (190)
T ss_pred             ccCHHHHHHHHHh-hHHHHHHHHHHHh----ccCcc-----cHHHhchh
Confidence            4777777777775 3443333332211    33344     88888765


No 5  
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=59.59  E-value=6.8  Score=28.26  Aligned_cols=28  Identities=25%  Similarity=0.428  Sum_probs=19.1

Q ss_pred             HHHHHHHHHHhh-hhccc--------ccccccchhhh
Q psy6193          43 EEERELEIMRSA-CQVYL--------MVIWVCILCRK   70 (122)
Q Consensus        43 le~~E~eRirrL-C~~C~--------k~~W~C~vC~k   70 (122)
                      ..++|.++..+. |..|.        ..+|.|.-|..
T Consensus        25 v~~ie~~~~~~~~Cp~C~~~~VkR~a~GIW~C~kCg~   61 (89)
T COG1997          25 VKEIEAQQRAKHVCPFCGRTTVKRIATGIWKCRKCGA   61 (89)
T ss_pred             HHHHHHHHhcCCcCCCCCCcceeeeccCeEEcCCCCC
Confidence            344554444333 99998        36999999975


No 6  
>PRK10778 dksA RNA polymerase-binding transcription factor; Provisional
Probab=58.72  E-value=30  Score=26.41  Aligned_cols=48  Identities=19%  Similarity=0.292  Sum_probs=28.9

Q ss_pred             HHHHHHHHHHHHhHHH-HHHHHHHHHHhh-------hhcccc-----------cccccchhhhhhhHh
Q psy6193          27 LEERQIIESVMMRQKQ-EEERELEIMRSA-------CQVYLM-----------VIWVCILCRKKQELL   75 (122)
Q Consensus        27 eeEreiIl~VL~Rdk~-le~~E~eRirrL-------C~~C~k-----------~~W~C~vC~k~~eL~   75 (122)
                      +.++.+.+..+.|+++ +.+++ .-+.|+       |-.|..           ..-.|.-|+...|.+
T Consensus        79 ~~~~~~~l~~~~r~~~~L~~I~-~AL~Ri~~gtYG~Ce~CGe~I~~~RL~A~P~A~~CI~CQe~~E~~  145 (151)
T PRK10778         79 EEEFSLELRNRDRERKLIKKIE-KTLKKVEDEDFGYCESCGVEIGIRRLEARPTADLCIDCKTLAEIR  145 (151)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH-HHHHHHhCCCCceeccCCCcccHHHHhcCCCccccHHHHHHHHHH
Confidence            3444455555666633 33333 333444       999982           466799999988754


No 7  
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=58.55  E-value=5.8  Score=28.48  Aligned_cols=40  Identities=20%  Similarity=0.353  Sum_probs=25.0

Q ss_pred             HHHHHHHHH-Hhhhhccc--------ccccccchhhhhhhHhhhcccccccCC
Q psy6193          43 EEERELEIM-RSACQVYL--------MVIWVCILCRKKQELLSKTGQWINKGM   86 (122)
Q Consensus        43 le~~E~eRi-rrLC~~C~--------k~~W~C~vC~k~~eL~~kSGeWFye~~   86 (122)
                      ..++|...- +..|..|.        ..+|.|.-|.+    .+..|+|-++..
T Consensus        25 vkkie~~q~~ky~Cp~Cgk~~vkR~a~GIW~C~~C~~----~~AGGAy~~~T~   73 (90)
T PF01780_consen   25 VKKIEISQHAKYTCPFCGKTSVKRVATGIWKCKKCGK----KFAGGAYTPSTP   73 (90)
T ss_dssp             HHHHHHHHHS-BEESSSSSSEEEEEETTEEEETTTTE----EEE-BSSSSS-H
T ss_pred             HHHHHHHHhCCCcCCCCCCceeEEeeeEEeecCCCCC----EEeCCCccccch
Confidence            344443332 23399998        36999999996    456788876653


No 8  
>PRK12495 hypothetical protein; Provisional
Probab=57.65  E-value=19  Score=29.82  Aligned_cols=48  Identities=19%  Similarity=0.203  Sum_probs=33.6

Q ss_pred             CCCHHHHHHHHHHHHhHHHHHHHHHHHHHhh-----------hhccc------ccccccchhhhhh
Q psy6193          24 HLTLEERQIIESVMMRQKQEEERELEIMRSA-----------CQVYL------MVIWVCILCRKKQ   72 (122)
Q Consensus        24 ~LTeeEreiIl~VL~Rdk~le~~E~eRirrL-----------C~~C~------k~~W~C~vC~k~~   72 (122)
                      |=.|-||+.+-+-..+|++-++.- ++|-.|           |..|.      .+.-+|.+|++..
T Consensus         4 FDkEaEREkLREKye~d~~~R~~~-~~ma~lL~~gatmsa~hC~~CG~PIpa~pG~~~Cp~CQ~~~   68 (226)
T PRK12495          4 FDKEAEREKLREKYEQDEQKREAT-ERMSELLLQGATMTNAHCDECGDPIFRHDGQEFCPTCQQPV   68 (226)
T ss_pred             hhHHHHHHHHHHHHhhhHHHHHHH-HHHHHHHHhhcccchhhcccccCcccCCCCeeECCCCCCcc
Confidence            446889999998887777655544 333222           99998      3466799999754


No 9  
>PF04545 Sigma70_r4:  Sigma-70, region 4;  InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  Region 4 of sigma-70 like sigma-factors is involved in binding to the -35 promoter element via a helix-turn-helix motif []. Due to the way Pfam works, the threshold has been set artificially high to prevent overlaps with other helix-turn-helix families. Therefore there are many false negatives.; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 2P7V_B 3IYD_F 1TLH_B 1KU7_A 1RIO_H 3N97_A 1KU3_A 1RP3_C 1SC5_A 1NR3_A ....
Probab=53.15  E-value=9.4  Score=22.86  Aligned_cols=25  Identities=28%  Similarity=0.295  Sum_probs=18.2

Q ss_pred             CCCCCHHHHHHHHHHHHhHHHHHHH
Q psy6193          22 LSHLTLEERQIIESVMMRQKQEEER   46 (122)
Q Consensus        22 LS~LTeeEreiIl~VL~Rdk~le~~   46 (122)
                      |+.|++.||++|.-+...+..++++
T Consensus         2 l~~L~~~er~vi~~~y~~~~t~~eI   26 (50)
T PF04545_consen    2 LDQLPPREREVIRLRYFEGLTLEEI   26 (50)
T ss_dssp             HCTS-HHHHHHHHHHHTST-SHHHH
T ss_pred             hhhCCHHHHHHHHHHhcCCCCHHHH
Confidence            5789999999999987666555554


No 10 
>PF09776 Mitoc_L55:  Mitochondrial ribosomal protein L55;  InterPro: IPR018615  Members of this family are involved in mitochondrial biogenesis and G2/M phase cell cycle progression. They form a component of the mitochondrial ribosome large subunit (39S) which comprises a 16S rRNA and about 50 distinct proteins. 
Probab=52.33  E-value=12  Score=27.99  Aligned_cols=16  Identities=38%  Similarity=0.345  Sum_probs=14.6

Q ss_pred             CCCCCCCHHHHHHHHH
Q psy6193          20 PDLSHLTLEERQIIES   35 (122)
Q Consensus        20 pdLS~LTeeEreiIl~   35 (122)
                      +||+.|||+||...+.
T Consensus        72 lDl~~LSeeERk~rl~   87 (116)
T PF09776_consen   72 LDLDTLSEEERKARLR   87 (116)
T ss_pred             cCcccCCHHHHHHHHH
Confidence            4999999999999887


No 11 
>PF14156 AbbA_antirepres:  Antirepressor AbbA
Probab=51.71  E-value=14  Score=25.16  Aligned_cols=20  Identities=25%  Similarity=0.501  Sum_probs=17.6

Q ss_pred             CCCCHHHHHHHHHHHHhHHH
Q psy6193          23 SHLTLEERQIIESVMMRQKQ   42 (122)
Q Consensus        23 S~LTeeEreiIl~VL~Rdk~   42 (122)
                      ..||+||++.+|.||.+|..
T Consensus         7 ~rlt~EE~~LLLdiLf~q~Y   26 (63)
T PF14156_consen    7 ERLTEEEKKLLLDILFQQNY   26 (63)
T ss_pred             HHhhHHHHHHHHHHHHHHHH
Confidence            45899999999999999854


No 12 
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]
Probab=47.53  E-value=17  Score=29.35  Aligned_cols=25  Identities=16%  Similarity=0.037  Sum_probs=18.6

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHhHHH
Q psy6193          18 IIPDLSHLTLEERQIIESVMMRQKQ   42 (122)
Q Consensus        18 e~pdLS~LTeeEreiIl~VL~Rdk~   42 (122)
                      ...|++.++.++++.+.++..-.+.
T Consensus         7 ~~~~~~~v~~e~~~~~ve~~~~~~~   31 (195)
T COG1150           7 EVIDGEDVSPEEKEEAVERTEEVKG   31 (195)
T ss_pred             hhhcccccChHHHHHHHHHHHHhcC
Confidence            3568889999999998887544433


No 13 
>PLN03131 hypothetical protein; Provisional
Probab=47.46  E-value=15  Score=34.81  Aligned_cols=30  Identities=30%  Similarity=0.634  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHHhh--------hhccc--cc--------ccccchhhh
Q psy6193          41 KQEEERELEIMRSA--------CQVYL--MV--------IWVCILCRK   70 (122)
Q Consensus        41 k~le~~E~eRirrL--------C~~C~--k~--------~W~C~vC~k   70 (122)
                      ++++++.+++|+.|        |++|.  .+        +.+|..|..
T Consensus         4 kkqqErnekiLreLlk~PgNk~CADCga~~P~WASiNlGIFICi~CSG   51 (705)
T PLN03131          4 RKEEERNEKIIRGLMKLPPNRRCINCNSLGPQFVCTNFWTFICMTCSG   51 (705)
T ss_pred             hHHHHHHHHHHHHHhhCcCCCccccCCCCCCCeeEeccceEEchhchh
Confidence            44555666667666        99999  33        457888875


No 14 
>KOG1013|consensus
Probab=47.17  E-value=8.4  Score=33.79  Aligned_cols=23  Identities=9%  Similarity=0.040  Sum_probs=20.7

Q ss_pred             ccccchhhhhhhHhhhcccccccCCC
Q psy6193          62 IWVCILCRKKQELLSKTGQWINKGMN   87 (122)
Q Consensus        62 ~W~C~vC~k~~eL~~kSGeWFye~~~   87 (122)
                      .|+|++|-.+.   ..++.|||.+.+
T Consensus       185 ~~lkKl~p~q~---k~f~~cl~~~lp  207 (362)
T KOG1013|consen  185 VSLKKLKPLQR---KSFNICLEKSLP  207 (362)
T ss_pred             hhhhccChhhc---chhhhhhhccCC
Confidence            69999998887   789999999987


No 15 
>PRK09458 pspB phage shock protein B; Provisional
Probab=44.19  E-value=43  Score=23.38  Aligned_cols=24  Identities=25%  Similarity=0.360  Sum_probs=21.5

Q ss_pred             CCCCHHHHHHHHHHHHhHHHHHHH
Q psy6193          23 SHLTLEERQIIESVMMRQKQEEER   46 (122)
Q Consensus        23 S~LTeeEreiIl~VL~Rdk~le~~   46 (122)
                      +.||++|.+.+.+...++++++++
T Consensus        34 ~~Ls~~d~~~L~~L~~~A~rm~~R   57 (75)
T PRK09458         34 QGLSQEEQQRLAQLTEKAERMRER   57 (75)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHH
Confidence            579999999999999999998766


No 16 
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=43.89  E-value=17  Score=34.03  Aligned_cols=30  Identities=37%  Similarity=0.635  Sum_probs=20.1

Q ss_pred             HHHHHHHHHHHHhh--------hhccc--c--------cccccchhhh
Q psy6193          41 KQEEERELEIMRSA--------CQVYL--M--------VIWVCILCRK   70 (122)
Q Consensus        41 k~le~~E~eRirrL--------C~~C~--k--------~~W~C~vC~k   70 (122)
                      ++++++.+++|+.|        |++|.  .        .+.+|..|..
T Consensus         4 KR~qERnekILreLlklPgNk~CADCgs~~P~WASiNlGIFICi~CSG   51 (648)
T PLN03119          4 KREEERNEKIIRGLMKLPPNRRCINCNSLGPQYVCTTFWTFVCMACSG   51 (648)
T ss_pred             hHHHHHHHHHHHHHhhCcCCCccccCCCCCCCceeeccceEEeccchh
Confidence            44556666666666        99999  2        3557887765


No 17 
>PF13274 DUF4065:  Protein of unknown function (DUF4065)
Probab=40.32  E-value=31  Score=22.86  Aligned_cols=28  Identities=32%  Similarity=0.461  Sum_probs=23.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHhHHHHHHHH
Q psy6193          20 PDLSHLTLEERQIIESVMMRQKQEEERE   47 (122)
Q Consensus        20 pdLS~LTeeEreiIl~VL~Rdk~le~~E   47 (122)
                      .+...|+++|+++|-.|+.+-......+
T Consensus        66 ~~~~~l~~~~~~~i~~V~~~~~~~s~~~   93 (108)
T PF13274_consen   66 FDLEELSEEEKEIIDEVINKYGDKSAWE   93 (108)
T ss_pred             cccccCCHHHHHHHHHHHHHHcCCCHHH
Confidence            6889999999999999999886554433


No 18 
>PF09098 Dehyd-heme_bind:  Quinohemoprotein amine dehydrogenase A, alpha subunit, haem binding;  InterPro: IPR015182 Quinohemoprotein amine dehydrogenases (QHNDH) 1.4.99 from EC) are enzymes produced in the periplasmic space of certain Gram-negative bacteria, such as Paracoccus denitrificans and Pseudomonas putida, in response to primary amines, including n-butylamine and benzylamine. QHNDH catalyses the oxidative deamination of a wide range of aliphatic and aromatic amines through formation of a Schiff-base intermediate involving one of the quinone O atoms []. Catalysis requires the presence of a novel redox cofactor, cysteine tryptophylquinone (CTQ). CTQ is derived from the post-translational modification of specific residues, which involves the oxidation of the indole ring of a tryptophan residue to form tryptophylquinone, followed by covalent cross-linking with a cysteine residue []. There is one CTQ per subunit in QHNDH. In addition to CTQ, two haem c cofactors are present in QHNDH that mediate the transfer of the substrate-derived electrons from CTQ to an external electron acceptor, cytochrome c-550 [, ]. QHNDH is a heterotrimer of alpha, beta and gamma subunits. The alpha and beta subunits contain signal peptides necessary for the translocation of QHNDH to the periplasm. The alpha subunit is composed of four domains - domain 1 forming a dihaem cytochrome, and domains 2-4 forming antiparallel beta-barrel structures; the beta subunit is a 7-bladed beta-propeller that provides part of the active site; and the small, catalytic gamma subunit contains the novel cross-linked CTQ cofactor, in addition to additional thioester cross-links between Cys and Asp/Glu residues that encage CTQ. The gamma subunit assumes a globular secondary structure with two short alpha-helices having many turns and bends [].  This entry represents the dihaem cytochrome c domain of the QHNDH alpha subunit. The domain contain two cysteine residues that are involved in thioether linkages to haem []. ; PDB: 1PBY_A 1JJU_A 1JMZ_A 1JMX_A.
Probab=39.82  E-value=19  Score=28.53  Aligned_cols=36  Identities=14%  Similarity=0.167  Sum_probs=22.8

Q ss_pred             CCCHHHHHHHHHHHHhHHHHH-------------------HHHHHHHHhhhhccc
Q psy6193          24 HLTLEERQIIESVMMRQKQEE-------------------ERELEIMRSACQVYL   59 (122)
Q Consensus        24 ~LTeeEreiIl~VL~Rdk~le-------------------~~E~eRirrLC~~C~   59 (122)
                      .||++||..|...|....=+.                   ..+.+.|..+|++|+
T Consensus        50 ~Is~eer~avVkYLAd~~GLap~Et~~~ry~~er~~~~~e~~~~e~~~~~C~rCH  104 (167)
T PF09098_consen   50 PISPEERRAVVKYLADTQGLAPSETAPVRYALERRPNTVEQFPNEEITQMCARCH  104 (167)
T ss_dssp             ---HHHHHHHHHHHHHHT---CGGCTT-CCCCCT-TT-----SCHHHHHHHSSSS
T ss_pred             CCCHHHHHHHHHHHHHccCCCchhhcchhhhhhcCcchhhcccchHHHHHHHHhh
Confidence            589999999999998764333                   223355677799999


No 19 
>TIGR02890 spore_yteA sporulation protein, yteA family. Members of this predicted regulatory protein are found only in endospore-forming members of the Firmicutes group of bacteria, and in nearly every such species; Clostridium perfringens seems to be an exception. The member from Bacillus subtilis, the model system for the study of the sporulation program, has been designated both yteA and yzwB. Some (but not all) members of this family show a strong sequence match to PFAM family pfam01258 the C4-type zinc finger protein, DksA/TraR family, but only one of the four key Cys residues is conserved. All members of this protein family share an additional C-terminal domain. The function of proteins in this family is unknown. YteA was detected in mature spores of Bacillus subtilis by Kuwana, et al., and appears to be expressed under control of sigma-K.
Probab=39.80  E-value=76  Score=24.41  Aligned_cols=48  Identities=21%  Similarity=0.358  Sum_probs=32.3

Q ss_pred             CHHHHHHHHHHHHhHH-HHHHHHHHHHHhh-------hhccc-----------ccccccchhhhhhhH
Q psy6193          26 TLEERQIIESVMMRQK-QEEERELEIMRSA-------CQVYL-----------MVIWVCILCRKKQEL   74 (122)
Q Consensus        26 TeeEreiIl~VL~Rdk-~le~~E~eRirrL-------C~~C~-----------k~~W~C~vC~k~~eL   74 (122)
                      .+.|+++.+.++.|+. .+.+++.. +.|+       |-.|.           -..-.|.-|+...+.
T Consensus        53 ~~~e~~~~~~l~~~~~~~L~~Ie~A-L~Ri~~G~YG~Ce~CGe~I~~~RL~a~P~a~~Ci~Cq~~~E~  119 (159)
T TIGR02890        53 ELYEREKDIALREHEERELREIEHA-LQKIENGTYGICEVCGKPIPYERLEAIPTATTCVECQNRKEV  119 (159)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH-HHHHhCCCCCeecccCCcccHHHHhhCCCcchhHHHHHHhhh
Confidence            3557777777766653 35555533 3444       99999           247789999998877


No 20 
>KOG1985|consensus
Probab=39.06  E-value=10  Score=36.75  Aligned_cols=20  Identities=25%  Similarity=0.700  Sum_probs=17.2

Q ss_pred             hhccc------------ccccccchhhhhhhH
Q psy6193          55 CQVYL------------MVIWVCILCRKKQEL   74 (122)
Q Consensus        55 C~~C~------------k~~W~C~vC~k~~eL   74 (122)
                      |.+|+            ...|.||+|....++
T Consensus       221 Cr~CRtYiNPFV~fid~gr~WrCNlC~~~Ndv  252 (887)
T KOG1985|consen  221 CRRCRTYINPFVEFIDQGRRWRCNLCGRVNDV  252 (887)
T ss_pred             ehhhhhhcCCeEEecCCCceeeechhhhhcCC
Confidence            99999            249999999998776


No 21 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=38.20  E-value=61  Score=22.38  Aligned_cols=25  Identities=24%  Similarity=0.330  Sum_probs=21.6

Q ss_pred             CCCCCHHHHHHHHHHHHhHHHHHHH
Q psy6193          22 LSHLTLEERQIIESVMMRQKQEEER   46 (122)
Q Consensus        22 LS~LTeeEreiIl~VL~Rdk~le~~   46 (122)
                      -+.||++|.+.+.+...+.+.++++
T Consensus        33 ~~gLs~~d~~~L~~L~~~a~rm~eR   57 (75)
T PF06667_consen   33 SQGLSEEDEQRLQELYEQAERMEER   57 (75)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHH
Confidence            3679999999999999999888765


No 22 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=36.79  E-value=13  Score=24.98  Aligned_cols=19  Identities=37%  Similarity=0.709  Sum_probs=16.3

Q ss_pred             hhccccc-ccccchhhhhhh
Q psy6193          55 CQVYLMV-IWVCILCRKKQE   73 (122)
Q Consensus        55 C~~C~k~-~W~C~vC~k~~e   73 (122)
                      |..|-.. +|.|..|+++..
T Consensus        28 CPnCG~~~I~RC~~CRk~~~   47 (59)
T PRK14890         28 CPNCGEVIIYRCEKCRKQSN   47 (59)
T ss_pred             CCCCCCeeEeechhHHhcCC
Confidence            8888876 999999999863


No 23 
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=36.64  E-value=72  Score=24.33  Aligned_cols=21  Identities=24%  Similarity=0.314  Sum_probs=19.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHhH
Q psy6193          20 PDLSHLTLEERQIIESVMMRQ   40 (122)
Q Consensus        20 pdLS~LTeeEreiIl~VL~Rd   40 (122)
                      ..++.||.+|-+.|...|+||
T Consensus        28 ~~~~elT~eEl~lv~~ylkRD   48 (146)
T PF07295_consen   28 VAAGELTREELALVSAYLKRD   48 (146)
T ss_pred             HHHhhcCHHHHHHHHHHHHHH
Confidence            357889999999999999999


No 24 
>PF03754 DUF313:  Domain of unknown function (DUF313) ;  InterPro: IPR005508 This is a family of proteins from Arabidopsis thaliana (Mouse-ear cress) with uncharacterised function.
Probab=36.55  E-value=16  Score=26.94  Aligned_cols=16  Identities=50%  Similarity=0.515  Sum_probs=13.9

Q ss_pred             CCCCCCCCCHHHHHHH
Q psy6193          18 IIPDLSHLTLEERQII   33 (122)
Q Consensus        18 e~pdLS~LTeeEreiI   33 (122)
                      ...+..|||++|.++|
T Consensus        46 qi~~~dFLt~eE~~~i   61 (114)
T PF03754_consen   46 QIIDNDFLTEEEKRII   61 (114)
T ss_pred             HhcccccCCHHHHHHH
Confidence            3558899999999999


No 25 
>PHA02078 hypothetical protein
Probab=36.48  E-value=19  Score=23.86  Aligned_cols=28  Identities=21%  Similarity=0.401  Sum_probs=21.6

Q ss_pred             CCCCCCHHHHHHHHHHHHhHHHHHHHHH
Q psy6193          21 DLSHLTLEERQIIESVMMRQKQEEEREL   48 (122)
Q Consensus        21 dLS~LTeeEreiIl~VL~Rdk~le~~E~   48 (122)
                      |+-.+-+.||+|.+..|..+-+++.+++
T Consensus        26 ~ienMmP~ER~Iylsll~k~lkE~n~~q   53 (54)
T PHA02078         26 ELENMMPWEREIYAALLIQYIQEKNKKQ   53 (54)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHHHhc
Confidence            3445668999999999999977666554


No 26 
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=36.28  E-value=24  Score=25.41  Aligned_cols=29  Identities=24%  Similarity=0.469  Sum_probs=22.1

Q ss_pred             hhhccc--------ccccccchhhhhhhHhhhcccccccCC
Q psy6193          54 ACQVYL--------MVIWVCILCRKKQELLSKTGQWINKGM   86 (122)
Q Consensus        54 LC~~C~--------k~~W~C~vC~k~~eL~~kSGeWFye~~   86 (122)
                      .|..|.        ..+|.|.-|.+.    +..|+|-++..
T Consensus        37 ~CpfCgk~~vkR~a~GIW~C~~C~~~----~AGGAy~p~T~   73 (91)
T TIGR00280        37 VCPFCGKKTVKRGSTGIWTCRKCGAK----FAGGAYTPVTP   73 (91)
T ss_pred             cCCCCCCCceEEEeeEEEEcCCCCCE----EeCCccccccc
Confidence            399996        369999999985    45788886553


No 27 
>PF01586 Basic:  Myogenic Basic domain;  InterPro: IPR002546 This basic domain is found in the MyoD family of muscle specific proteins that control muscle development. The bHLH region of the MyoD family includes the basic domain and the Helix-loop-helix (HLH) motif. The bHLH region mediates specific DNA binding []. With 12 residues of the basic domain involved in DNA binding []. The basic domain forms an extended alpha helix in the structure.; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0007517 muscle organ development, 0005634 nucleus; PDB: 1MDY_C.
Probab=35.65  E-value=12  Score=26.66  Aligned_cols=15  Identities=33%  Similarity=1.030  Sum_probs=0.9

Q ss_pred             hcccccccccchhhhhh
Q psy6193          56 QVYLMVIWVCILCRKKQ   72 (122)
Q Consensus        56 ~~C~k~~W~C~vC~k~~   72 (122)
                      ++|.  .|-|++|.++.
T Consensus        68 G~CL--~WACKaCKRKt   82 (86)
T PF01586_consen   68 GQCL--LWACKACKRKT   82 (86)
T ss_dssp             -------------S---
T ss_pred             Ccch--HHHhHhhhccC
Confidence            4577  99999998753


No 28 
>COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion]
Probab=34.49  E-value=12  Score=36.00  Aligned_cols=21  Identities=29%  Similarity=0.743  Sum_probs=17.7

Q ss_pred             hhccc------------ccccccchhhhhhhHh
Q psy6193          55 CQVYL------------MVIWVCILCRKKQELL   75 (122)
Q Consensus        55 C~~C~------------k~~W~C~vC~k~~eL~   75 (122)
                      |.+|+            ...|.||+|+-..++-
T Consensus       202 CrrCrsYiNPfv~fi~~g~kw~CNiC~~kN~vp  234 (861)
T COG5028         202 CRRCRSYINPFVQFIEQGRKWRCNICRSKNDVP  234 (861)
T ss_pred             hhhhHhhcCceEEEecCCcEEEEeeccccccCc
Confidence            99999            2389999999988764


No 29 
>PLN00162 transport protein sec23; Provisional
Probab=33.97  E-value=12  Score=34.92  Aligned_cols=20  Identities=25%  Similarity=0.928  Sum_probs=16.5

Q ss_pred             hhccc------------ccccccchhhhhhhH
Q psy6193          55 CQVYL------------MVIWVCILCRKKQEL   74 (122)
Q Consensus        55 C~~C~------------k~~W~C~vC~k~~eL   74 (122)
                      |.+|+            ...|.|++|....++
T Consensus        56 C~~CraylNPf~~~d~~~~~W~C~~C~~~N~~   87 (761)
T PLN00162         56 CRTCRAVLNPYCRVDFQAKIWICPFCFQRNHF   87 (761)
T ss_pred             cCCCcCEECCceEEecCCCEEEccCCCCCCCC
Confidence            88898            358999999987765


No 30 
>COG1734 DksA DnaK suppressor protein [Signal transduction mechanisms]
Probab=33.66  E-value=1.2e+02  Score=22.53  Aligned_cols=57  Identities=18%  Similarity=0.254  Sum_probs=34.9

Q ss_pred             CCCCCCCCHHHHHHHHHHHHhHHHHHHHHHHHHHhh-------hhcccc-----------cccccchhhhhhhHhh
Q psy6193          19 IPDLSHLTLEERQIIESVMMRQKQEEERELEIMRSA-------CQVYLM-----------VIWVCILCRKKQELLS   76 (122)
Q Consensus        19 ~pdLS~LTeeEreiIl~VL~Rdk~le~~E~eRirrL-------C~~C~k-----------~~W~C~vC~k~~eL~~   76 (122)
                      +.|..... .+++..+.+..|..++-.+=..-+.|+       |-.|..           +.-.|.-|+...+...
T Consensus        41 ~aD~a~~~-~~~~~~~~~~~r~r~~l~~i~~al~rIe~gtYG~Ce~cG~~Ip~~RL~A~P~A~~Ci~cQ~~~E~~~  115 (120)
T COG1734          41 PADRATQE-EERELELRLRDRERKLLRKIESALDRIEEGTYGICEECGEPIPEARLEARPTARLCIECQERAERRE  115 (120)
T ss_pred             hhhhhHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCccchhccCCcCCHHHHhhCcchHHHHHHHHHHHHHH
Confidence            44443333 778888888777755443322333443       988982           4667888888776654


No 31 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=33.51  E-value=27  Score=25.06  Aligned_cols=40  Identities=23%  Similarity=0.449  Sum_probs=26.2

Q ss_pred             HHHHHHHHH-Hhhhhccc--------ccccccchhhhhhhHhhhcccccccCC
Q psy6193          43 EEERELEIM-RSACQVYL--------MVIWVCILCRKKQELLSKTGQWINKGM   86 (122)
Q Consensus        43 le~~E~eRi-rrLC~~C~--------k~~W~C~vC~k~~eL~~kSGeWFye~~   86 (122)
                      ..++|...- ...|.-|.        ..+|.|.-|.+.    +..|+|-++..
T Consensus        26 v~kie~~q~a~y~CpfCgk~~vkR~a~GIW~C~~C~~~----~AGGAy~~~T~   74 (90)
T PTZ00255         26 IKKIEISQHAKYFCPFCGKHAVKRQAVGIWRCKGCKKT----VAGGAWTLSTP   74 (90)
T ss_pred             HHHHHHHHhCCccCCCCCCCceeeeeeEEEEcCCCCCE----EeCCccccccc
Confidence            344443332 23399995        369999999985    45788886554


No 32 
>PF08986 DUF1889:  Domain of unknown function (DUF1889);  InterPro: IPR015079 This family consist of hypothetical bacterial proteins. ; PDB: 2JN8_A 2ES9_A.
Probab=32.89  E-value=12  Score=28.05  Aligned_cols=26  Identities=23%  Similarity=0.166  Sum_probs=16.3

Q ss_pred             ccCccccc-CCCCCCCCCCCCCCCCHHHHHHHHHHH
Q psy6193           3 LTEGMVTS-MAQTNADIIPDLSHLTLEERQIIESVM   37 (122)
Q Consensus         3 ~~~~~~~~-~~~~~~~e~pdLS~LTeeEreiIl~VL   37 (122)
                      |.|||-+| ++|.+|++         ...+.|+.-|
T Consensus        31 FIggMntSas~P~sMdE---------STAKGi~KyL   57 (119)
T PF08986_consen   31 FIGGMNTSASVPHSMDE---------STAKGIFKYL   57 (119)
T ss_dssp             HHHTS-TT-SS--HCCC---------HHHHHHHHHH
T ss_pred             HhcccccCCCCCCccch---------HHHHHHHHHH
Confidence            67999998 77777765         4566776654


No 33 
>PF04829 PT-VENN:  Pre-toxin domain with VENN motif;  InterPro: IPR006914 This group of proteins, mainly from Neisseria meningitidis, may have haemagglutinin or haemolysin activity. A number of them have a second conserved domain, IPR006915 from INTERPRO, which is found in possible Pseudomonas aeruginosa haemagglutinins []. Filamentous haemagglutinin (FHA) is a major virulence attachment factor produced by certain bacterial species that functions as both a primary adhesin and an immunomodulator. Haemolysin is pore-forming toxin.
Probab=32.71  E-value=32  Score=22.31  Aligned_cols=16  Identities=44%  Similarity=0.530  Sum_probs=13.3

Q ss_pred             CCCCCCHHHHHHHHHH
Q psy6193          21 DLSHLTLEERQIIESV   36 (122)
Q Consensus        21 dLS~LTeeEreiIl~V   36 (122)
                      |-+.||++|++.|..+
T Consensus         1 d~~~Lte~eK~~v~~l   16 (55)
T PF04829_consen    1 DPSELTEEEKQKVSAL   16 (55)
T ss_pred             ChHhcCHHHHHHHHHH
Confidence            4578999999998865


No 34 
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=32.22  E-value=30  Score=24.84  Aligned_cols=40  Identities=23%  Similarity=0.407  Sum_probs=26.1

Q ss_pred             HHHHHHHHH-Hhhhhccc--------ccccccchhhhhhhHhhhcccccccCC
Q psy6193          43 EEERELEIM-RSACQVYL--------MVIWVCILCRKKQELLSKTGQWINKGM   86 (122)
Q Consensus        43 le~~E~eRi-rrLC~~C~--------k~~W~C~vC~k~~eL~~kSGeWFye~~   86 (122)
                      ..++|...- +..|..|.        ..+|.|.-|.+.    +..|+|-++..
T Consensus        26 v~kie~~q~a~y~CpfCgk~~vkR~a~GIW~C~~C~~~----~AGGAy~~~T~   74 (90)
T PRK03976         26 VADIEEKMRAKHVCPVCGRPKVKRVGTGIWECRKCGAK----FAGGAYTPETP   74 (90)
T ss_pred             HHHHHHHHhcCccCCCCCCCceEEEEEEEEEcCCCCCE----EeCCccccccc
Confidence            344443332 23399995        369999999874    45788876654


No 35 
>PF13442 Cytochrome_CBB3:  Cytochrome C oxidase, cbb3-type, subunit III ; PDB: 1KB0_A 2DGE_D 2CE1_A 2CE0_A 2V07_A 1W2L_A 2ZOO_A 2ZBO_G 1DVV_A 2EXV_A ....
Probab=31.31  E-value=70  Score=19.75  Aligned_cols=19  Identities=21%  Similarity=0.448  Sum_probs=14.1

Q ss_pred             CCCCC-CCCHHHHHHHHHHH
Q psy6193          19 IPDLS-HLTLEERQIIESVM   37 (122)
Q Consensus        19 ~pdLS-~LTeeEreiIl~VL   37 (122)
                      ||... .||++|++.|...|
T Consensus        48 Mp~~~~~ls~~e~~~l~~yi   67 (67)
T PF13442_consen   48 MPPFGGQLSDEEIEALAAYI   67 (67)
T ss_dssp             BSCTTTTSTHHHHHHHHHHH
T ss_pred             CCCCCCCCCHHHHHHHHHHC
Confidence            44444 79999999987754


No 36 
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=31.25  E-value=72  Score=26.05  Aligned_cols=16  Identities=25%  Similarity=0.457  Sum_probs=13.9

Q ss_pred             hhccc----------ccccccchhhh
Q psy6193          55 CQVYL----------MVIWVCILCRK   70 (122)
Q Consensus        55 C~~C~----------k~~W~C~vC~k   70 (122)
                      |.+|.          +..|.|..||+
T Consensus       247 CprCG~~I~~~~~~gR~t~~CP~CQ~  272 (272)
T PRK14810        247 CLNCKTPIRRVVVAGRSSHYCPHCQK  272 (272)
T ss_pred             CCCCCCeeEEEEECCCccEECcCCcC
Confidence            99998          56899999985


No 37 
>PF10335 DUF294_C:  Putative nucleotidyltransferase substrate binding domain;  InterPro: IPR018821  This entry is found associated with presumed nucleotidyltransferase domains and seems to be distantly related to other helical substrate binding domains. 
Probab=30.78  E-value=90  Score=22.86  Aligned_cols=32  Identities=19%  Similarity=0.114  Sum_probs=27.2

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHhHHHHHHHH
Q psy6193          16 ADIIPDLSHLTLEERQIIESVMMRQKQEEERE   47 (122)
Q Consensus        16 ~~e~pdLS~LTeeEreiIl~VL~Rdk~le~~E   47 (122)
                      ++..+|++.|+..||+.+-..+..-+.+++.-
T Consensus       110 ~~n~i~~~~Ls~~er~~Lk~al~~i~~lq~~l  141 (145)
T PF10335_consen  110 PDNYIDPDELSKLERRRLKEALRVIKRLQRLL  141 (145)
T ss_pred             CCCccCHHHCCHHHHHHHHHHHHHHHHHHHHH
Confidence            45688999999999999999998888877653


No 38 
>cd02406 CRS2 Chloroplast RNA splicing 2 (CRS2) is a nuclear-encoded protein required for the splicing of group II introns in the chloroplast. CRS2 forms stable complexes with two CRS2-associated factors, CAF1 and CAF2, which are required for the splicing of distinct subsets of CRS2-dependent introns. CRS2 is closely related to bacterial peptidyl-tRNA hydrolases (PTH).
Probab=28.77  E-value=84  Score=24.94  Aligned_cols=26  Identities=19%  Similarity=0.333  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHhHH
Q psy6193          15 NADIIPDLSHLTLEERQIIESVMMRQK   41 (122)
Q Consensus        15 ~~~e~pdLS~LTeeEreiIl~VL~Rdk   41 (122)
                      ...+.+ ||.++++|++.|..++.+..
T Consensus       143 ~v~~yV-L~~f~~~E~~~l~~~~~~a~  168 (191)
T cd02406         143 DPRAFL-LQKFSSEEREQIDTALEQGV  168 (191)
T ss_pred             chhhhh-cCCCCHHHHHHHHHHHHHHH
Confidence            445677 99999999999999988764


No 39 
>PF13936 HTH_38:  Helix-turn-helix domain; PDB: 2W48_A.
Probab=28.24  E-value=35  Score=20.41  Aligned_cols=17  Identities=47%  Similarity=0.663  Sum_probs=5.6

Q ss_pred             CCCCHHHHHHHHHHHHh
Q psy6193          23 SHLTLEERQIIESVMMR   39 (122)
Q Consensus        23 S~LTeeEreiIl~VL~R   39 (122)
                      .|||.+||..|...+..
T Consensus         3 ~~Lt~~eR~~I~~l~~~   19 (44)
T PF13936_consen    3 KHLTPEERNQIEALLEQ   19 (44)
T ss_dssp             ---------HHHHHHCS
T ss_pred             cchhhhHHHHHHHHHHc
Confidence            68999999999976543


No 40 
>PF01921 tRNA-synt_1f:  tRNA synthetases class I (K);  InterPro: IPR002904 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Lysyl-tRNA synthetase (6.1.1.6 from EC) is an alpha 2 homodimer that belong to both class I and class II. In eubacteria and eukaryota lysyl-tRNA synthetases belong to class II in the same family as aspartyl tRNA synthetase. The class Ic lysyl-tRNA synthetase family is present in archaea and in a number of bacterial groups that include the alphaproteobacteria and spirochaetes[]. A refined crystal structures shows that the active site of LysU is shaped to position the substrates for the nucleophilic attack of the lysine carboxylate on the ATP alpha-phosphate. No residues are directly involved in catalysis, but a number of highly conserved amino acids and three metal ions coordinate the substrates and stabilise the pentavalent transition state. A loop close to the catalytic pocket, disordered in the lysine-bound structure, becomes ordered upon adenine binding [].; GO: 0000166 nucleotide binding, 0004824 lysine-tRNA ligase activity, 0005524 ATP binding, 0006430 lysyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1IRX_A.
Probab=27.76  E-value=48  Score=28.92  Aligned_cols=50  Identities=18%  Similarity=0.247  Sum_probs=31.9

Q ss_pred             HHHHHHHHHhHHHHHHHHHHHHHhh-----------hhccc---------------ccccccchhhhhhhHhhhcc
Q psy6193          30 RQIIESVMMRQKQEEERELEIMRSA-----------CQVYL---------------MVIWVCILCRKKQELLSKTG   79 (122)
Q Consensus        30 reiIl~VL~Rdk~le~~E~eRirrL-----------C~~C~---------------k~~W~C~vC~k~~eL~~kSG   79 (122)
                      .+.|+.+|++..+..++-.+..++-           |..|.               .+.+.|..|+...++-...|
T Consensus       141 ~~~i~~aL~~~~~I~~Il~~~~~~~~~~~y~Pf~piC~~cGri~tt~v~~~d~~~~~v~Y~c~~cG~~g~~~i~~g  216 (360)
T PF01921_consen  141 DEQIRTALENRDEIREILNEYRGRERPETYSPFLPICEKCGRIDTTEVTEYDPEGGTVTYRCEECGHEGEVDITGG  216 (360)
T ss_dssp             HHHHCHHHHTHHHHHHHHHHHHHHT--TT--SEEEEETTTEE--EEEEEEE--SSSEEEEE--TTS---EEETTTT
T ss_pred             HHHHHHHHHhHHHHHHHHHHhcCcCCCCCeeeeeeeccccCCcccceeeEeecCCCEEEEEecCCCCEEEEecCCC
Confidence            3567777777777776655554433           88888               35899999999988888775


No 41 
>PF10910 DUF2744:  Protein of unknown function (DUF2744);  InterPro: IPR021226 This entry is represented by Mycobacteriophage D29, Gp29. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=27.65  E-value=41  Score=25.55  Aligned_cols=27  Identities=26%  Similarity=0.342  Sum_probs=21.6

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHhH
Q psy6193          14 TNADIIPDLSHLTLEERQIIESVMMRQ   40 (122)
Q Consensus        14 ~~~~e~pdLS~LTeeEreiIl~VL~Rd   40 (122)
                      |.....||.+.||..|+..+++-|++.
T Consensus        91 p~p~~~~d~~~lt~~E~~a~l~ql~~~  117 (125)
T PF10910_consen   91 PEPVRIPDVSKLTQQEQRAMLEQLREL  117 (125)
T ss_pred             CCCCCCcCHHHHhHHHHHHHHHHHHHc
Confidence            334568999999999999999866654


No 42 
>TIGR03045 PS_II_C550 cytochrome c-550. Members of this protein family are cytochrome c-550, the PsbV extrinsic protein of photosystem II, from both Cyanobacteria and chloroplasts. A paralog to this protein, PsbV2, is found in some species in addition to PsbV itself.
Probab=27.55  E-value=78  Score=24.54  Aligned_cols=27  Identities=33%  Similarity=0.546  Sum_probs=22.7

Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHhHHH
Q psy6193          16 ADIIPDLSHLTLEERQIIESVMMRQKQ   42 (122)
Q Consensus        16 ~~e~pdLS~LTeeEreiIl~VL~Rdk~   42 (122)
                      ..-||.+..||++|.+.|-.-|-++.+
T Consensus       123 ~~~mP~~~~LsdeEL~avAaYIl~q~~  149 (159)
T TIGR03045       123 ADIFPKMRNLTDEDLRLIAGHILVQPK  149 (159)
T ss_pred             ccccCCcCCCCHHHHHHHHHHHHHhcc
Confidence            356899999999999999998877654


No 43 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=25.97  E-value=24  Score=20.53  Aligned_cols=10  Identities=40%  Similarity=1.255  Sum_probs=8.1

Q ss_pred             ccccchhhhh
Q psy6193          62 IWVCILCRKK   71 (122)
Q Consensus        62 ~W~C~vC~k~   71 (122)
                      .|+|.+|+..
T Consensus         2 ~~~C~~CG~i   11 (34)
T cd00729           2 VWVCPVCGYI   11 (34)
T ss_pred             eEECCCCCCE
Confidence            6999999754


No 44 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=25.71  E-value=25  Score=19.45  Aligned_cols=16  Identities=31%  Similarity=0.787  Sum_probs=4.9

Q ss_pred             ccchhhhhhhHhhhccccccc
Q psy6193          64 VCILCRKKQELLSKTGQWINK   84 (122)
Q Consensus        64 ~C~vC~k~~eL~~kSGeWFye   84 (122)
                      .|.+|++..     +|.|+|.
T Consensus         2 ~C~~C~~~~-----~~~~~Y~   17 (30)
T PF07649_consen    2 RCDACGKPI-----DGGWFYR   17 (30)
T ss_dssp             --TTTS---------S--EEE
T ss_pred             cCCcCCCcC-----CCCceEE
Confidence            466676655     4456664


No 45 
>PF01935 DUF87:  Domain of unknown function DUF87;  InterPro: IPR002789 The function of this domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=25.66  E-value=56  Score=24.71  Aligned_cols=22  Identities=45%  Similarity=0.588  Sum_probs=19.6

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHh
Q psy6193          18 IIPDLSHLTLEERQIIESVMMR   39 (122)
Q Consensus        18 e~pdLS~LTeeEreiIl~VL~R   39 (122)
                      -.+|||++.++.+.+|..+|-|
T Consensus       206 ~IiDLs~~~~~~~~~i~~~i~r  227 (229)
T PF01935_consen  206 VIIDLSGVDEEVQDIIVSVILR  227 (229)
T ss_pred             EEEECCCCCHHHHHHHHHHHHh
Confidence            3569999999999999999876


No 46 
>PF04120 Iron_permease:  Low affinity iron permease ;  InterPro: IPR007251  Although originally identified as a low-affinity iron(II) permease [, ], Fet4 has since been shown to import several other transition metal ions, including copper [, ] and zinc []. Copper, cobalt, and cadmium inhibit Fet4 [, ]. Fet4 is an integral protein of the plasma membrane [, ]. FET4 is not essential, not even in fet3 fet4 double mutants []. Over expression of FET4 improves growth under alkaline conditions [].   Transcription of FET4 is induced by Aft1 in response to low levels of iron [, , ] or by Zap1 in response to low zinc [, ], but not in response to low copper []. When the high-affinity iron permease component Fet3 is deleted, FET4 is induced by the addition of copper, zinc, cobalt, or manganese []. It is also induced under anaerobic conditions [, , ] and repressed by Rox1 in aerobic conditions [, ]. Rox1 attenuates the activation of FET4 by Aft1 or Zap1 []. ; GO: 0055085 transmembrane transport
Probab=25.64  E-value=93  Score=23.51  Aligned_cols=26  Identities=27%  Similarity=0.261  Sum_probs=20.6

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhHHH
Q psy6193          17 DIIPDLSHLTLEERQIIESVMMRQKQ   42 (122)
Q Consensus        17 ~e~pdLS~LTeeEreiIl~VL~Rdk~   42 (122)
                      .+++|+.+|+++|.+.|..-+++...
T Consensus        87 n~li~iE~l~~~el~~~~~~~~~~~~  112 (132)
T PF04120_consen   87 NELIDIEDLTEEELEEIRKRYERLAE  112 (132)
T ss_pred             HHhCCcccCCHHHHHHHHHHHHHHHH
Confidence            46899999999999998886555443


No 47 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=25.20  E-value=74  Score=23.54  Aligned_cols=33  Identities=21%  Similarity=0.296  Sum_probs=28.5

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHhHHHHHHHHHHH
Q psy6193          18 IIPDLSHLTLEERQIIESVMMRQKQEEERELEI   50 (122)
Q Consensus        18 e~pdLS~LTeeEreiIl~VL~Rdk~le~~E~eR   50 (122)
                      +++.+..|++++.+.|..++.-...+.+.+.+.
T Consensus        27 ~l~~~~~L~~E~~~Fi~~Fi~~rGnlKe~e~~l   59 (113)
T PF09862_consen   27 ELPWFARLSPEQLEFIKLFIKNRGNLKEMEKEL   59 (113)
T ss_pred             ccchhhcCCHHHHHHHHHHHHhcCCHHHHHHHH
Confidence            467799999999999999999998888887543


No 48 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=25.08  E-value=71  Score=25.90  Aligned_cols=24  Identities=25%  Similarity=0.567  Sum_probs=14.2

Q ss_pred             ccccccchhhhh--------hhHhhhcccccc
Q psy6193          60 MVIWVCILCRKK--------QELLSKTGQWIN   83 (122)
Q Consensus        60 k~~W~C~vC~k~--------~eL~~kSGeWFy   83 (122)
                      +-.|+|.+|.|.        -.|..|=++|+-
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e~ve  106 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPEKVE  106 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HHHHH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHHHHH
Confidence            458999999972        345566677754


No 49 
>KOG0860|consensus
Probab=24.51  E-value=68  Score=24.05  Aligned_cols=19  Identities=26%  Similarity=0.370  Sum_probs=15.0

Q ss_pred             HHHHHHHHHhHHHHHHHHH
Q psy6193          30 RQIIESVMMRQKQEEEREL   48 (122)
Q Consensus        30 reiIl~VL~Rdk~le~~E~   48 (122)
                      |+-|..||+|+++|.+.++
T Consensus        46 r~NV~KVlER~ekL~~L~d   64 (116)
T KOG0860|consen   46 RENVEKVLERGEKLDELDD   64 (116)
T ss_pred             HHhHHHHHHhcchHHHHHH
Confidence            4557789999999888764


No 50 
>CHL00183 petJ cytochrome c553; Provisional
Probab=24.02  E-value=1.1e+02  Score=20.96  Aligned_cols=23  Identities=17%  Similarity=0.371  Sum_probs=18.2

Q ss_pred             CCCC-CCCCHHHHHHHHHHHHhHH
Q psy6193          19 IPDL-SHLTLEERQIIESVMMRQK   41 (122)
Q Consensus        19 ~pdL-S~LTeeEreiIl~VL~Rdk   41 (122)
                      ||-+ ..||++|++.|...|.-+.
T Consensus        81 MP~f~~~Ls~~ei~~i~aYi~~~~  104 (108)
T CHL00183         81 MPAFGGRLSDEDIEDVANYVLSQA  104 (108)
T ss_pred             cccccCCCCHHHHHHHHHHHHHhh
Confidence            6655 6899999999999876543


No 51 
>PF08432 Vfa1:  AAA-ATPase Vps4-associated protein 1;  InterPro: IPR013640 This is a family of fungal proteins of unknown function. 
Probab=23.56  E-value=18  Score=27.92  Aligned_cols=36  Identities=14%  Similarity=0.285  Sum_probs=17.1

Q ss_pred             ccchhhhhhh-Hhhh--cccccccCCCCCCCCcccccccc
Q psy6193          64 VCILCRKKQE-LLSK--TGQWINKGMNSTPQGDAIMRKIE  100 (122)
Q Consensus        64 ~C~vC~k~~e-L~~k--SGeWFye~~~~~~~~~~~~r~~~  100 (122)
                      -|.||.+-.- +++.  ..+|||-=.+-- .+.....|+.
T Consensus        15 ~C~IC~KpsttVL~t~~~~DfFY~C~~HL-~D~~F~~p~~   53 (182)
T PF08432_consen   15 ACFICYKPSTTVLITPDNKDFFYVCPSHL-KDRQFATPIY   53 (182)
T ss_pred             ceeEecCCCceEEecCCCCCeEEeCcccc-cCcccCCCCC
Confidence            4556665332 2221  379999533110 3333355555


No 52 
>PF13864 Enkurin:  Calmodulin-binding
Probab=23.50  E-value=1.7e+02  Score=20.24  Aligned_cols=31  Identities=26%  Similarity=0.321  Sum_probs=23.0

Q ss_pred             CCCCCCCHHHHHHHHHHHHhHHHHHHHHHHH
Q psy6193          20 PDLSHLTLEERQIIESVMMRQKQEEERELEI   50 (122)
Q Consensus        20 pdLS~LTeeEreiIl~VL~Rdk~le~~E~eR   50 (122)
                      +-..-|+++||..+|.-|...-..=..+.++
T Consensus        32 ~~~~~l~eeER~~lL~~Lk~~~~el~~ey~~   62 (98)
T PF13864_consen   32 PGMRLLSEEERQELLEGLKKNWDELNKEYQK   62 (98)
T ss_pred             cccccCCHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            5567899999999999988765544445444


No 53 
>PF11161 DUF2944:  Protein of unknown function (DUF2946);  InterPro: IPR021332  This family of proteins with unknown function appear to be restricted to Proteobacteria. 
Probab=23.41  E-value=30  Score=27.89  Aligned_cols=11  Identities=18%  Similarity=0.543  Sum_probs=10.0

Q ss_pred             cccccccCCCC
Q psy6193          78 TGQWINKGMNS   88 (122)
Q Consensus        78 SGeWFye~~~~   88 (122)
                      .|.|||.++|+
T Consensus        65 ~G~WfFQNGPQ   75 (187)
T PF11161_consen   65 DGRWFFQNGPQ   75 (187)
T ss_pred             CccEEEecCCE
Confidence            59999999997


No 54 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=23.35  E-value=29  Score=19.41  Aligned_cols=10  Identities=40%  Similarity=1.022  Sum_probs=7.5

Q ss_pred             cccchhhhhh
Q psy6193          63 WVCILCRKKQ   72 (122)
Q Consensus        63 W~C~vC~k~~   72 (122)
                      |.|.+|.+..
T Consensus         1 ~~C~~C~~~~   10 (30)
T PF03107_consen    1 FWCDVCRRKI   10 (30)
T ss_pred             CCCCCCCCCc
Confidence            6788887765


No 55 
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=23.21  E-value=41  Score=22.38  Aligned_cols=22  Identities=23%  Similarity=0.578  Sum_probs=16.2

Q ss_pred             hhhcccccccccchhhhhhhHhhh
Q psy6193          54 ACQVYLMVIWVCILCRKKQELLSK   77 (122)
Q Consensus        54 LC~~C~k~~W~C~vC~k~~eL~~k   77 (122)
                      .|.+|.  .|-|+.|.+.--...+
T Consensus        24 QCvlCG--RWaC~sCW~deYY~Ck   45 (57)
T PF14445_consen   24 QCVLCG--RWACNSCWQDEYYTCK   45 (57)
T ss_pred             HHhhhc--hhhhhhhhhhhHhHHH
Confidence            388887  8999999987644443


No 56 
>PF11686 DUF3283:  Protein of unknown function (DUF3283);  InterPro: IPR021700  This family of proteins with unknown function appears to be restricted to Proteobacteria. 
Probab=23.13  E-value=64  Score=21.83  Aligned_cols=14  Identities=50%  Similarity=0.581  Sum_probs=12.3

Q ss_pred             CCCCCCHHHHHHHH
Q psy6193          21 DLSHLTLEERQIIE   34 (122)
Q Consensus        21 dLS~LTeeEreiIl   34 (122)
                      |||.|+.+|++.|.
T Consensus         1 NLslLp~~EKnkIE   14 (61)
T PF11686_consen    1 NLSLLPPEEKNKIE   14 (61)
T ss_pred             CcccCCHHHHhHHH
Confidence            68999999999885


No 57 
>TIGR02420 dksA RNA polymerase-binding protein DksA. The model that is the basis for this family describes a small, pleiotropic protein, DksA (DnaK suppressor A), originally named as a multicopy suppressor of temperature sensitivity of dnaKJ mutants. DksA mutants are defective in quorum sensing, virulence, etc. DksA is now understood to bind RNA polymerase directly and modulate its response to small molecules to control the level of transcription of rRNA. Nearly all members of this family are in the Proteobacteria. Whether the closest homologs outside the Proteobacteria function equivalently is unknown. The low value set for the noise cutoff allows identification of possible DksA proteins from outside the proteobacteria. TIGR02419 describes a closely related family of short sequences usually found in prophage regions of proteobacterial genomes or in known phage.
Probab=23.08  E-value=2.2e+02  Score=20.01  Aligned_cols=43  Identities=19%  Similarity=0.322  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHhHHH-HHHHHHHHHHhh-------hhcccc-----------cccccchhhh
Q psy6193          27 LEERQIIESVMMRQKQ-EEERELEIMRSA-------CQVYLM-----------VIWVCILCRK   70 (122)
Q Consensus        27 eeEreiIl~VL~Rdk~-le~~E~eRirrL-------C~~C~k-----------~~W~C~vC~k   70 (122)
                      +.++++-+..+.|+.. +.+++.. +.|+       |-.|.+           ..-.|.-|+.
T Consensus        48 ~~~~~~~~~~~~~~~~~l~~i~~A-L~ri~~g~yG~C~~Cge~I~~~RL~a~P~a~~Cv~Cq~  109 (110)
T TIGR02420        48 EEERALELRTRDRERKLIKKIDEA-LKRIEDGEYGYCEECGEEIGLRRLEARPTATLCIDCKT  109 (110)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH-HHHHhCCCCCchhccCCcccHHHHhhCCCccccHHhHc
Confidence            4455555555555533 4455432 2233       888883           3455766654


No 58 
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=22.99  E-value=24  Score=30.61  Aligned_cols=12  Identities=17%  Similarity=0.526  Sum_probs=5.4

Q ss_pred             ccccccchhhhh
Q psy6193          60 MVIWVCILCRKK   71 (122)
Q Consensus        60 k~~W~C~vC~k~   71 (122)
                      +.-|.|.-|...
T Consensus       283 KRFFkC~~C~~R  294 (344)
T PF09332_consen  283 KRFFKCKDCGNR  294 (344)
T ss_dssp             -EEEE-T-TS-E
T ss_pred             eeeEECCCCCCe
Confidence            346777777765


No 59 
>smart00520 BASIC Basic domain in HLH proteins of MYOD family.
Probab=21.90  E-value=26  Score=25.41  Aligned_cols=15  Identities=33%  Similarity=0.915  Sum_probs=11.5

Q ss_pred             hcccccccccchhhhhh
Q psy6193          56 QVYLMVIWVCILCRKKQ   72 (122)
Q Consensus        56 ~~C~k~~W~C~vC~k~~   72 (122)
                      ++|.  .|-|++|.++.
T Consensus        68 g~CL--~WACk~CkrK~   82 (91)
T smart00520       68 GQCL--PWACKACKRKS   82 (91)
T ss_pred             CccH--HHHHHHhcccC
Confidence            4576  99999997643


No 60 
>KOG4275|consensus
Probab=21.81  E-value=46  Score=29.11  Aligned_cols=22  Identities=23%  Similarity=0.360  Sum_probs=14.5

Q ss_pred             CCCCCCCCHHH---HHHHHHHHHhH
Q psy6193          19 IPDLSHLTLEE---RQIIESVMMRQ   40 (122)
Q Consensus        19 ~pdLS~LTeeE---reiIl~VL~Rd   40 (122)
                      ++|++.|+++|   +..+++++.++
T Consensus       240 lsd~edl~d~Eg~~v~qLke~l~~d  264 (350)
T KOG4275|consen  240 LSDLEDLLDEEGLTVRQLKEILDDD  264 (350)
T ss_pred             cCccccccccccchHHHhhhhhhcc
Confidence            66777777766   45566666665


No 61 
>TIGR00447 pth peptidyl-tRNA hydrolase. The natural substrate for this enzyme may be peptidyl-tRNAs that drop off the ribosome during protein synthesis. Peptidyl-tRNA hydrolase is a bacterial protein; YHR189W from Saccharomyces cerevisiae appears to be orthologous and likely has the same function.
Probab=21.38  E-value=1.6e+02  Score=23.18  Aligned_cols=27  Identities=19%  Similarity=0.209  Sum_probs=21.9

Q ss_pred             CCCCCCCCCCCCHHHHHHHHHHHHhHHH
Q psy6193          15 NADIIPDLSHLTLEERQIIESVMMRQKQ   42 (122)
Q Consensus        15 ~~~e~pdLS~LTeeEreiIl~VL~Rdk~   42 (122)
                      ...+.+ ||-++++|++.|..++.+..+
T Consensus       142 ~v~~yV-L~~f~~~e~~~l~~~i~~~~~  168 (188)
T TIGR00447       142 KVVEFV-LSKFTKSELPLLEKALDKAVE  168 (188)
T ss_pred             chhhhc-cCCCCHHHHHHHHHHHHHHHH
Confidence            345667 999999999999999888643


No 62 
>PF04936 DUF658:  Protein of unknown function (DUF658);  InterPro: IPR007020 This entry is represented by Bacteriophage r1t, Orf18. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. These are proteins of unknown function found in Lactococcus lactis and in their associated bacteriophage. 
Probab=20.93  E-value=1.4e+02  Score=24.02  Aligned_cols=35  Identities=26%  Similarity=0.331  Sum_probs=21.8

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhH-HHHHHHHHHHHHhh
Q psy6193          17 DIIPDLSHLTLEERQIIESVMMRQ-KQEEERELEIMRSA   54 (122)
Q Consensus        17 ~e~pdLS~LTeeEreiIl~VL~Rd-k~le~~E~eRirrL   54 (122)
                      ..+|.||.|.|.|..-+-+   ++ ++-|.+|+.|++|.
T Consensus       134 kRfP~lst~~e~e~~E~k~---k~rrK~e~k~err~rr~  169 (186)
T PF04936_consen  134 KRFPKLSTLSEEELIETKE---KYRRKHETKEERRLRRN  169 (186)
T ss_pred             hcCccccccccHHHHHHhh---HHHhhhhHHHHHHHHHH
Confidence            3589999999999844333   22 23344566666553


No 63 
>cd08818 CARD_MDA5_1 Caspase activation and recruitment domain found in MDA5, first repeat. Caspase activation and recruitment domain (CARD) found in MDA5 (melanoma-differentiation-associated gene 5), first repeat.  MDA5, also known as IFIH1, contains two N-terminal CARD domains and a C-terminal RNA helicase domain. MDA5 is a cytoplasmic DEAD box RNA helicase that plays an important role in host antiviral response by sensing incoming viral RNA. Upon activation, the signal is transferred to downstream pathways via the adaptor molecule IPS-1 (MAVS, VISA, CARDIF), leading to the induction of type I interferons. Although very similar in sequence, MDA5 recognizes different sets of viruses compared to RIG-I, a related RNA helicase. MDA5 associates with IPS-1 through a CARD-CARD interaction. In general, CARDs are death domains (DDs) found associated with caspases. They are known to be important in the signaling pathways for apoptosis, inflammation, and host-defense mechanisms. DDs are protein-
Probab=20.49  E-value=2.2e+02  Score=20.32  Aligned_cols=45  Identities=13%  Similarity=0.128  Sum_probs=26.4

Q ss_pred             CCCCCCCCHHHHHHHHHHHHhHHHHHHHHHHHHHhhhhcccccccc
Q psy6193          19 IPDLSHLTLEERQIIESVMMRQKQEEERELEIMRSACQVYLMVIWV   64 (122)
Q Consensus        19 ~pdLS~LTeeEreiIl~VL~Rdk~le~~E~eRirrLC~~C~k~~W~   64 (122)
                      ++.|.+|++++++.|+.=.......+..+ -.+..+|..++.+.|.
T Consensus        25 L~~l~~L~~e~ke~I~a~~~~~Gn~~AA~-~LL~~l~~~~~~~GWf   69 (88)
T cd08818          25 LDYLTFLEAEVKERIRAAAATRGNIAAAE-LLLSTLEKGTWDPGWF   69 (88)
T ss_pred             hhhcccCCHHHHHHHHHHHHccCcHHHHH-HHHHHHHHhccCCchH
Confidence            45678999999999987544333333332 3344454434455554


No 64 
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.
Probab=20.10  E-value=1.2e+02  Score=19.87  Aligned_cols=24  Identities=17%  Similarity=0.026  Sum_probs=19.7

Q ss_pred             CCCCCCCCCHHHHHHHHHHHHhHH
Q psy6193          18 IIPDLSHLTLEERQIIESVMMRQK   41 (122)
Q Consensus        18 e~pdLS~LTeeEreiIl~VL~Rdk   41 (122)
                      ...+++.|+++|+..+..++.+-.
T Consensus        44 H~~~~~~l~~~e~~~l~~~~~~v~   67 (103)
T cd01277          44 HYENLLDLDPEELAELILAAKKVA   67 (103)
T ss_pred             ccCChhhCCHHHHHHHHHHHHHHH
Confidence            356899999999999999876653


No 65 
>PRK13622 psbV cytochrome c-550; Provisional
Probab=20.04  E-value=1.2e+02  Score=24.26  Aligned_cols=29  Identities=24%  Similarity=0.306  Sum_probs=23.8

Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHhHHH
Q psy6193          14 TNADIIPDLSHLTLEERQIIESVMMRQKQ   42 (122)
Q Consensus        14 ~~~~e~pdLS~LTeeEreiIl~VL~Rdk~   42 (122)
                      ..++.+|.+..|||+|.+.|-..+.++.+
T Consensus       132 ~~~~~~p~~~~LsdeEI~~VA~yIl~qa~  160 (180)
T PRK13622        132 QLLSEYPRLRNLTDEDLKLIAGYILVQAK  160 (180)
T ss_pred             hhccccccccCCCHHHHHHHHHHHHhCcc
Confidence            34667898889999999999998877754


No 66 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=20.03  E-value=54  Score=22.84  Aligned_cols=19  Identities=42%  Similarity=0.298  Sum_probs=15.3

Q ss_pred             CCCCCCCCCHHHHHHHHHH
Q psy6193          18 IIPDLSHLTLEERQIIESV   36 (122)
Q Consensus        18 e~pdLS~LTeeEreiIl~V   36 (122)
                      +..-|.+||++||+-|+.+
T Consensus        25 ~~LGf~~Lt~eEr~dmI~~   43 (76)
T PF10955_consen   25 EQLGFHHLTPEERQDMISY   43 (76)
T ss_pred             hhcCcccCCHHHHhhheEE
Confidence            4455899999999988874


Done!