RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy6198
(111 letters)
>gnl|CDD|175994 cd04028, C2B_RIM1alpha, C2 domain second repeat contained in
Rab3-interacting molecule (RIM) proteins. RIMs are
believed to organize specialized sites of the plasma
membrane called active zones. They also play a role in
controlling neurotransmitter release, plasticity
processes, as well as memory and learning. RIM contains
an N-terminal zinc finger domain, a PDZ domain, and two
C-terminal C2 domains (C2A, C2B). C2 domains fold into
an 8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. Members here have a type-I
topology and do not bind Ca2+.
Length = 146
Score = 85.1 bits (211), Expect = 2e-22
Identities = 33/51 (64%), Positives = 38/51 (74%)
Query: 61 LGPGQVVGRQVLGLPSKGEVQLSLNNVKGCLVVEVIRAKNLQPKPDSKTLP 111
LGPGQ+VGRQVL PS G++QL L + KG L VEVIRA+ L KP SK LP
Sbjct: 1 LGPGQLVGRQVLASPSMGDIQLGLYDKKGQLEVEVIRARGLVQKPGSKVLP 51
>gnl|CDD|175997 cd04031, C2A_RIM1alpha, C2 domain first repeat contained in
Rab3-interacting molecule (RIM) proteins. RIMs are
believed to organize specialized sites of the plasma
membrane called active zones. They also play a role in
controlling neurotransmitter release, plasticity
processes, as well as memory and learning. RIM contains
an N-terminal zinc finger domain, a PDZ domain, and two
C-terminal C2 domains (C2A, C2B). C2 domains fold into
an 8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. Members here have a type-I
topology and do not bind Ca2+.
Length = 125
Score = 33.4 bits (77), Expect = 0.008
Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 2/32 (6%)
Query: 78 GEVQLSL--NNVKGCLVVEVIRAKNLQPKPDS 107
G +Q+ L + V L+V V++A++L P+ D
Sbjct: 3 GRIQIQLWYDKVTSQLIVTVLQARDLPPRDDG 34
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in
Synaptotagmin. Synaptotagmin is a membrane-trafficking
protein characterized by a N-terminal transmembrane
region, a linker, and 2 C-terminal C2 domains. There are
several classes of Synaptotagmins. Previously all
synaptotagmins were thought to be calcium sensors in the
regulation of neurotransmitter release and hormone
secretion, but it has been shown that not all of them
bind calcium. Of the 17 identified synaptotagmins only
8 bind calcium (1-3, 5-7, 9, 10). The function of the
two C2 domains that bind calcium are: regulating the
fusion step of synaptic vesicle exocytosis (C2A) and
binding to phosphatidyl-inositol-3,4,5-triphosphate
(PIP3) in the absence of calcium ions and to
phosphatidylinositol bisphosphate (PIP2) in their
presence (C2B). C2B also regulates also the recycling
step of synaptic vesicles. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-I topology.
Length = 134
Score = 30.6 bits (70), Expect = 0.075
Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 2/35 (5%)
Query: 78 GEVQLSLNN--VKGCLVVEVIRAKNLQPKPDSKTL 110
GE+ LSL+ L V V++A+NL P
Sbjct: 1 GELLLSLSYLPTAERLTVVVLKARNLPPSDGKGLS 35
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13
(mammalian uncoordinated)-like proteins. C2-like
domains are thought to be involved in phospholipid
binding in a Ca2+ independent manner in both Unc13 and
Munc13. Caenorabditis elegans Unc13 has a central domain
with sequence similarity to PKC, which includes C1 and
C2-related domains. Unc13 binds phorbol esters and DAG
with high affinity in a phospholipid manner. Mutations
in Unc13 results in abnormal neuronal connections and
impairment in cholinergic neurotransmission in the
nematode. Munc13 is the mammalian homolog which are
expressed in the brain. There are 3 isoforms (Munc13-1,
-2, -3) and are thought to play a role in
neurotransmitter release and are hypothesized to be
high-affinity receptors for phorbol esters. Unc13 and
Munc13 contain both C1 and C2 domains. There are two C2
related domains present, one central and one at the
carboxyl end. Munc13-1 contains a third C2-like domain.
Munc13 interacts with syntaxin, synaptobrevin, and
synaptotagmin suggesting a role for these as scaffolding
proteins. C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the third C2
repeat, C2C, and has a type-II topology.
Length = 133
Score = 29.5 bits (67), Expect = 0.21
Identities = 10/28 (35%), Positives = 15/28 (53%), Gaps = 1/28 (3%)
Query: 80 VQLSLNNVKGCLVVEVIRAKNLQPKPDS 107
V+ + L VE++ A+NL P DS
Sbjct: 7 VKAYYRASEQSLRVEILNARNLLP-LDS 33
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in
Synaptotagmin 8. Synaptotagmin is a
membrane-trafficking protein characterized by a
N-terminal transmembrane region, a linker, and 2
C-terminal C2 domains. Previously all synaptotagmins
were thought to be calcium sensors in the regulation of
neurotransmitter release and hormone secretion, but it
has been shown that not all of them bind calcium. Of
the 17 identified synaptotagmins only 8 bind calcium
(1-3, 5-7, 9, 10). The function of the two C2 domains
that bind calcium are: regulating the fusion step of
synaptic vesicle exocytosis (C2A) and binding to
phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
absence of calcium ions and to phosphatidylinositol
bisphosphate (PIP2) in their presence (C2B). C2B also
regulates also the recycling step of synaptic vesicles.
C2 domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the first C2
repeat, C2A, and has a type-I topology.
Length = 124
Score = 28.9 bits (65), Expect = 0.32
Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 2/36 (5%)
Query: 76 SKGEVQLSL--NNVKGCLVVEVIRAKNLQPKPDSKT 109
++GE+ SL + G L V++I+A+NLQP+ S T
Sbjct: 1 TRGELHFSLEYDKDMGILNVKLIQARNLQPRDFSGT 36
>gnl|CDD|131624 TIGR02573, LcrG_PcrG, type III secretion protein LcrG. This
protein is found in type III secretion operons, along
with LcrR, H and V. Also known as PcrG in Pseudomonas,
the protein is believed to make a 1:1 complex with PcrV
(LcrV). Mutants of LcrG cause premature secretion of
effector proteins into the medium.
Length = 90
Score = 27.4 bits (61), Expect = 0.88
Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 4/50 (8%)
Query: 54 LSEFIEGLGPGQVVGRQVLGLPSKGEVQLSLNNVKGCLVVEVIRAKNLQP 103
L E +GLG G V G + G + +Q + + L+ EV R ++ QP
Sbjct: 25 LQEMWQGLGLGPVAGEVLFGGLNAELMQ----HAEQELLEEVQRRRSQQP 70
>gnl|CDD|238934 cd01974, Nitrogenase_MoFe_beta, Nitrogenase_MoFe_beta: Nitrogenase
MoFe protein, beta subunit. The nitrogenase enzyme
catalyzes the ATP-dependent reduction of dinitrogen to
ammonia. The Molybdenum (Mo-) nitrogenase is the most
widespread and best characterized of these systems.
Mo-nitrogenase consists of the MoFe protein (component
1) and the Fe protein (component 2). MoFe is an
alpha2beta2 tetramer. This group contains the beta
subunit of the MoFe protein. Each alphabeta pair of MoFe
contains one P-cluster (at the alphabeta interface) and,
one molecule of iron molybdenum cofactor (FeMoco)
contained within the alpha subunit. The Fe protein
contains a single [4Fe-4S] cluster. Electrons are
transferred from the [4Fe-4S] cluster of the Fe protein
to the P-cluster of the MoFe and in turn to FeMoCo, the
site of substrate reduction.
Length = 435
Score = 28.0 bits (63), Expect = 0.88
Identities = 10/28 (35%), Positives = 14/28 (50%)
Query: 22 FINKSKGPNISPCGTPISFSWTPTLKGS 49
FI +K P P+ F+ TP+ GS
Sbjct: 107 FIKNAKNKGSIPADFPVPFANTPSFVGS 134
>gnl|CDD|212055 cd11486, SLC5sbd_SGLT1, Na(+)/glucose cotransporter SGLT1;solute
binding domain. Human SGLT1 (hSGLT1) is a
high-affinity/low-capacity glucose transporter, which
can also transport galactose. In the transport
mechanism, two Na+ ions first bind to the extracellular
side of the transporter and induce a conformational
change in the glucose binding site. This results in an
increased affinity for glucose. A second conformational
change in the transporter follows, bringing the Na+ and
glucose binding sites to the inner surface of the
membrane. Glucose is then released, followed by the Na+
ions. In the process, hSGLT1 is also able to transport
water and urea and may be a major pathway for transport
of these across the intestinal brush-border membrane.
hSGLT1 is encoded by the SLC5A1 gene and expressed
mostly in the intestine, but also in the trachea,
kidney, heart, brain, testis, and prostate. The
WHO/UNICEF oral rehydration solution (ORS) for the
treatment of secretory diarrhea contains salt and
glucose. The glucose, along with sodium ions, is
transported by hSGLT1 and water is either co-transported
along with these or follows by osmosis. Mutations in
SGLT1 are associated with intestinal glucose galactose
malabsorption (GGM). Up-regulation of intestinal SGLT1
may protect against enteric infections. SGLT1 is
expressed in colorectal, head and neck, and prostate
tumors. Epidermal growth factor receptor (EGFR)
functions in cell survival by stabilizing SGLT1, and
thereby maintaining intracellular glucose levels. SGLT1
is predicted to have 14 membrane-spanning regions. This
subgroup belongs to the solute carrier 5
(SLC5)transporter family.
Length = 635
Score = 27.9 bits (62), Expect = 1.2
Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 4/30 (13%)
Query: 38 ISFSWTPTLKGSDSGQLSEFIEG----LGP 63
IS +W P ++ + SGQL ++I+ LGP
Sbjct: 410 ISIAWVPIVQSAQSGQLFDYIQSITSYLGP 439
>gnl|CDD|181109 PRK07769, PRK07769, long-chain-fatty-acid--CoA ligase; Validated.
Length = 631
Score = 27.8 bits (62), Expect = 1.4
Identities = 12/19 (63%), Positives = 13/19 (68%)
Query: 73 GLPSKGEVQLSLNNVKGCL 91
GLP GE L L+NVKG L
Sbjct: 294 GLPKDGEPPLDLSNVKGLL 312
>gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in
Synaptotagmin 15. Synaptotagmin is a
membrane-trafficking protein characterized by a
N-terminal transmembrane region, a linker, and 2
C-terminal C2 domains. It is thought to be involved in
the trafficking and exocytosis of secretory vesicles in
non-neuronal tissues and is Ca2+ independent. Human
synaptotagmin 15 has 2 alternatively spliced forms that
encode proteins with different C-termini. The larger,
SYT15a, contains a N-terminal TM region, a putative
fatty-acylation site, and 2 tandem C terminal C2
domains. The smaller, SYT15b, lacks the C-terminal
portion of the second C2 domain. Unlike most other
synaptotagmins it is nearly absent in the brain and
rather is found in the heart, lungs, skeletal muscle,
and testis. Previously all synaptotagmins were thought
to be calcium sensors in the regulation of
neurotransmitter release and hormone secretion, but it
has been shown that not all of them bind calcium. Of
the 17 identified synaptotagmins only 8 bind calcium
(1-3, 5-7, 9, 10). The function of the two C2 domains
that bind calcium are: regulating the fusion step of
synaptic vesicle exocytosis (C2A) and binding to
phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
absence of calcium ions and to phosphatidylinositol
bisphosphate (PIP2) in their presence (C2B). C2B also
regulates also the recycling step of synaptic vesicles.
C2 domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-I topology.
Length = 137
Score = 26.9 bits (60), Expect = 1.5
Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 2/28 (7%)
Query: 78 GEVQLSL--NNVKGCLVVEVIRAKNLQP 103
G++Q+SL N L V V+RA+ L+
Sbjct: 2 GDIQISLTYNPTLNRLTVVVLRARGLRQ 29
>gnl|CDD|215765 pfam00168, C2, C2 domain.
Length = 85
Score = 26.5 bits (59), Expect = 1.6
Identities = 10/21 (47%), Positives = 10/21 (47%), Gaps = 1/21 (4%)
Query: 91 LVVEVIRAKNLQPKPDSKTLP 111
L V VI AKNL P D
Sbjct: 1 LRVTVISAKNL-PPKDLNGKS 20
>gnl|CDD|175989 cd04022, C2A_MCTP_PRT_plant, C2 domain first repeat found in
Multiple C2 domain and Transmembrane region Proteins
(MCTP); plant subset. MCTPs are involved in Ca2+
signaling at the membrane. Plant-MCTPs are composed of
a variable N-terminal sequence, four C2 domains, two
transmembrane regions (TMRs), and a short C-terminal
sequence. It is one of four protein classes that are
anchored to membranes via a transmembrane region; the
others being synaptotagmins, extended synaptotagmins,
and ferlins. MCTPs are the only membrane-bound C2 domain
proteins that contain two functional TMRs. MCTPs are
unique in that they bind Ca2+ but not phospholipids. C2
domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the first C2
repeat, C2A, and has a type-II topology.
Length = 127
Score = 26.5 bits (59), Expect = 1.9
Identities = 9/14 (64%), Positives = 12/14 (85%)
Query: 91 LVVEVIRAKNLQPK 104
LVVEV+ A++L PK
Sbjct: 2 LVVEVVDAQDLMPK 15
>gnl|CDD|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase
adapter protein beta. Protein Kinase family,
STE20-related kinase adapter protein (STRAD) beta
subfamily, pseudokinase domain. The STRAD-beta subfamily
is part of a larger superfamily that includes the
catalytic domains of serine/threonine kinases (STKs),
protein tyrosine kinases, RIO kinases, aminoglycoside
phosphotransferase, choline kinase, and phosphoinositide
3-kinase. The pseudokinase domain shows similarity to
protein kinases but lacks crucial residues for catalytic
activity. STRAD forms a complex with the scaffolding
protein MO25, and the STK, LKB1, resulting in the
activation of the kinase. In the complex, LKB1
phosphorylates and activates adenosine
monophosphate-activated protein kinases (AMPKs), which
regulate cell energy metabolism and cell polarity. LKB1
is a tumor suppressor linked to the rare inherited
disease, Peutz-Jeghers syndrome, which is characterized
by a predisposition to benign polyps and
hyperpigmentation of the buccal mucosa. There are two
forms of STRAD, alpha and beta, that complex with LKB1
and MO25. STRAD-beta is also referred to as ALS2CR2
(Amyotrophic lateral sclerosis 2 chromosomal region
candidate gene 2 protein), since the human gene encoding
it is located within the juvenile ALS2 critical region
on chromosome 2q33-q34. It is not linked to the
development of ALS2.
Length = 328
Score = 27.2 bits (60), Expect = 2.0
Identities = 24/84 (28%), Positives = 37/84 (44%), Gaps = 4/84 (4%)
Query: 12 PYQILLRSRVFINKSKGPNISPCGTPISFSWTPTLKGSDSGQ---LSEFIEGLGPGQVVG 68
P+Q +LR+++ + K KGP SP +K S SG + E + G Q +
Sbjct: 209 PFQDMLRTQMLLQKLKGPPYSPLDITTFPCEESRMKNSQSGVDSGIGESVVAAGMTQTMT 268
Query: 69 RQVLGLPSKGEVQLSLNN-VKGCL 91
+ L PS + N V+ CL
Sbjct: 269 SERLRTPSSKTFSPAFQNLVELCL 292
>gnl|CDD|212058 cd11489, SLC5sbd_SGLT5, Na(+)/glucose cotransporter SGLT5 and
related proteins; solute-binding domain. Human SGLT5 is
a glucose transporter, which also transports galactose.
It is encoded by the SLC5A10 gene, and is exclusively
expressed in the renal cortex. This subgroup belongs to
the solute carrier 5 (SLC5) transporter family.
Length = 604
Score = 27.2 bits (60), Expect = 2.1
Identities = 10/22 (45%), Positives = 15/22 (68%)
Query: 38 ISFSWTPTLKGSDSGQLSEFIE 59
+S W P L+ S+SGQL +I+
Sbjct: 407 VSVVWIPILQSSNSGQLYIYIQ 428
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present
in Synaptotagmins 15 and 17. Synaptotagmin is a
membrane-trafficking protein characterized by a
N-terminal transmembrane region, a linker, and 2
C-terminal C2 domains. It is thought to be involved in
the trafficking and exocytosis of secretory vesicles in
non-neuronal tissues and is Ca2+ independent. Human
synaptotagmin 15 has 2 alternatively spliced forms that
encode proteins with different C-termini. The larger,
SYT15a, contains a N-terminal TM region, a putative
fatty-acylation site, and 2 tandem C terminal C2
domains. The smaller, SYT15b, lacks the C-terminal
portion of the second C2 domain. Unlike most other
synaptotagmins it is nearly absent in the brain and
rather is found in the heart, lungs, skeletal muscle,
and testis. Synaptotagmin 17 is located in the brain,
kidney, and prostate and is thought to be a peripheral
membrane protein. Previously all synaptotagmins were
thought to be calcium sensors in the regulation of
neurotransmitter release and hormone secretion, but it
has been shown that not all of them bind calcium. Of
the 17 identified synaptotagmins only 8 bind calcium
(1-3, 5-7, 9, 10). The function of the two C2 domains
that bind calcium are: regulating the fusion step of
synaptic vesicle exocytosis (C2A) and binding to
phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
absence of calcium ions and to phosphatidylinositol
bisphosphate (PIP2) in their presence (C2B). C2B also
regulates also the recycling step of synaptic vesicles.
C2 domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the first C2
repeat, C2A, and has a type-I topology.
Length = 123
Score = 26.5 bits (59), Expect = 2.5
Identities = 7/15 (46%), Positives = 11/15 (73%)
Query: 91 LVVEVIRAKNLQPKP 105
L V +I+A+NL P+
Sbjct: 16 LTVSLIKARNLPPRT 30
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in
Rabphilin and Double C2 domain. Rabphilin is found
neurons and in neuroendrocrine cells, while Doc2 is
found not only in the brain but in tissues, including
mast cells, chromaffin cells, and osteoblasts.
Rabphilin and Doc2s share highly homologous tandem C2
domains, although their N-terminal structures are
completely different: rabphilin contains an N-terminal
Rab-binding domain (RBD),7 whereas Doc2 contains an
N-terminal Munc13-1-interacting domain (MID). C2 domains
fold into an 8-standed beta-sandwich that can adopt 2
structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-I topology.
Length = 133
Score = 26.2 bits (58), Expect = 2.9
Identities = 9/25 (36%), Positives = 12/25 (48%)
Query: 79 EVQLSLNNVKGCLVVEVIRAKNLQP 103
V L N + L+V +IR NL
Sbjct: 3 LVSLMYNTQRRGLIVGIIRCVNLAA 27
>gnl|CDD|219336 pfam07216, LcrG, LcrG protein. This family consists of several
bacterial LcrG proteins. Yersiniae are equipped with the
Yop virulon, an apparatus that allows extracellular
bacteria to deliver toxic Yop proteins inside the host
cell cytosol in order to sabotage the communication
networks of the host cell or even to cause cell death.
LcrG is a component of the Yop virulon involved in the
regulation of secretion of the Yops.
Length = 93
Score = 25.5 bits (56), Expect = 3.4
Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 4/50 (8%)
Query: 54 LSEFIEGLGPGQVVGRQVLGLPSKGEVQLSLNNVKGCLVVEVIRAKNLQP 103
L E + GLG G V G + G S +Q + L+ E+ R + QP
Sbjct: 28 LQEMLAGLGLGPVAGELLFGGASPELMQHAEQE----LLAEIQRRRQQQP 73
>gnl|CDD|175973 cd00030, C2, C2 domain. The C2 domain was first identified in PKC.
C2 domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions.
Length = 102
Score = 25.5 bits (56), Expect = 3.8
Identities = 8/19 (42%), Positives = 10/19 (52%)
Query: 91 LVVEVIRAKNLQPKPDSKT 109
L V VI A+NL K +
Sbjct: 1 LRVTVIEARNLPAKDLNGK 19
>gnl|CDD|227622 COG5306, COG5306, Uncharacterized conserved protein [Function
unknown].
Length = 621
Score = 26.0 bits (57), Expect = 4.6
Identities = 9/28 (32%), Positives = 12/28 (42%), Gaps = 2/28 (7%)
Query: 14 QILLRSRVFINKSKGPNISPCG--TPIS 39
I RVF N + P + G T I+
Sbjct: 190 FIKWGYRVFTNIDEFPPYTWQGYRTNIT 217
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in
class II phosphatidylinositol 3-kinases (PI3Ks). There
are 3 classes of PI3Ks based on structure, regulation,
and specificity. All classes contain a N-terminal C2
domain, a PIK domain, and a kinase catalytic domain.
Unlike class I and class III, class II PI3Ks have
additionally a PX domain and a C-terminal C2 domain
containing a nuclear localization signal both of which
bind phospholipids though in a slightly different
fashion. PI3Ks (AKA phosphatidylinositol (PtdIns)
3-kinases) regulate cell processes such as cell growth,
differentiation, proliferation, and motility. PI3Ks work
on phosphorylation of phosphatidylinositol,
phosphatidylinositide (4)P (PtdIns (4)P),2 or
PtdIns(4,5)P2. Specifically they phosphorylate the D3
hydroxyl group of phosphoinositol lipids on the inositol
ring. C2 domains fold into an 8-standed beta-sandwich
that can adopt 2 structural arrangements: Type I and
Type II, distinguished by a circular permutation
involving their N- and C-terminal beta strands. Many C2
domains are Ca2+-dependent membrane-targeting modules
that bind a wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a single
C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin which
only have a single C2 domain. C2 domains with a calcium
binding region have negatively charged residues,
primarily aspartates, that serve as ligands for calcium
ions. This cd contains the second C2 repeat, C2B, and
has a type-I topology.
Length = 122
Score = 25.3 bits (56), Expect = 5.0
Identities = 12/27 (44%), Positives = 17/27 (62%)
Query: 77 KGEVQLSLNNVKGCLVVEVIRAKNLQP 103
G+V+LS++ G L V V+ AKNL
Sbjct: 1 GGQVKLSISYKNGTLFVMVMHAKNLPL 27
>gnl|CDD|212057 cd11488, SLC5sbd_SGLT4, Na(+)/glucose cotransporter SGLT4 and
related proteins; solute-binding domain. Human SGLT4
(hSGLT4) has been reported to be a low-affinity glucose
transporter with unusual sugar selectivity: it
transports D-mannose but not galactose or
3-O-methyl-D-glucoside. It is encoded by the SLC5A9 gene
and is expressed in intestine, kidney, liver, brain,
lung, trachea, uterus, and pancreas. hSLGT4 is predicted
to contain 14 membrane-spanning regions. This subgroup
belongs to the solute carrier 5 (SLC5 )transporter
family.
Length = 605
Score = 26.0 bits (57), Expect = 5.5
Identities = 9/24 (37%), Positives = 17/24 (70%)
Query: 38 ISFSWTPTLKGSDSGQLSEFIEGL 61
IS W P ++ ++SGQL ++I+ +
Sbjct: 404 ISILWIPIIQSANSGQLFDYIQAV 427
>gnl|CDD|212056 cd11487, SLC5sbd_SGLT2, Na(+)/glucose cotransporter SGLT2 and
related proteins; solute-binding domain. Human SGLT2
(hSGLT2) is a high-capacity, low-affinity glucose
transporter, that plays an important role in renal
glucose reabsorption. It is encoded by the SLC5A2 gene
and expressed almost exclusively in renal proximal
tubule cells. Mutations in hSGLT2 cause Familial Renal
Glucosuria (FRG), a rare autosomal defect in glucose
transport. hSGLT2 is a major drug target for regulating
blood glucose levels in diabetes. hSGLT2 is predicted to
have 14 membrane-spanning regions. This subgroup belongs
to the solute carrier 5 (SLC5) transporter family.
Length = 583
Score = 26.0 bits (57), Expect = 5.8
Identities = 8/28 (28%), Positives = 17/28 (60%)
Query: 34 CGTPISFSWTPTLKGSDSGQLSEFIEGL 61
C +S +W P ++ + GQL ++I+ +
Sbjct: 409 CIVAVSVAWIPVVQAAQGGQLFDYIQSV 436
>gnl|CDD|176058 cd08676, C2A_Munc13-like, C2 domain first repeat in Munc13
(mammalian uncoordinated)-like proteins. C2-like
domains are thought to be involved in phospholipid
binding in a Ca2+ independent manner in both Unc13 and
Munc13. Caenorabditis elegans Unc13 has a central domain
with sequence similarity to PKC, which includes C1 and
C2-related domains. Unc13 binds phorbol esters and DAG
with high affinity in a phospholipid manner. Mutations
in Unc13 results in abnormal neuronal connections and
impairment in cholinergic neurotransmission in the
nematode. Munc13 is the mammalian homolog which are
expressed in the brain. There are 3 isoforms (Munc13-1,
-2, -3) and are thought to play a role in
neurotransmitter release and are hypothesized to be
high-affinity receptors for phorbol esters. Unc13 and
Munc13 contain both C1 and C2 domains. There are two C2
related domains present, one central and one at the
carboxyl end. Munc13-1 contains a third C2-like domain.
Munc13 interacts with syntaxin, synaptobrevin, and
synaptotagmin suggesting a role for these as scaffolding
proteins. C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-II topology.
Length = 153
Score = 25.4 bits (56), Expect = 5.9
Identities = 8/15 (53%), Positives = 8/15 (53%)
Query: 90 CLVVEVIRAKNLQPK 104
L V VI AK L K
Sbjct: 29 VLKVTVIEAKGLLAK 43
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC)
alpha and gamma. A single C2 domain is found in PKC
alpha and gamma. The PKC family of serine/threonine
kinases regulates apoptosis, proliferation, migration,
motility, chemo-resistance, and differentiation. There
are 3 groups: group 1(alpha, betaI, beta II, gamma)
which require phospholipids and calcium, group 2 (delta,
epsilon, theta, eta) which do not require calcium for
activation, and group 3 (xi, iota/lambda) which are
atypical and can be activated in the absence of
diacylglycerol and calcium. C2 domains fold into an
8-standed beta-sandwich that can adopt 2 structural
arrangements: Type I and Type II, distinguished by a
circular permutation involving their N- and C-terminal
beta strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. Members here have a type-I
topology.
Length = 131
Score = 24.9 bits (55), Expect = 7.7
Identities = 11/27 (40%), Positives = 15/27 (55%)
Query: 77 KGEVQLSLNNVKGCLVVEVIRAKNLQP 103
+G + L ++ L VEV AKNL P
Sbjct: 1 RGRIYLKISVKDNKLTVEVREAKNLIP 27
>gnl|CDD|176078 cd08696, C2_Dock-C, C2 domains found in Dedicator Of CytoKinesis
(Dock) class C proteins. Dock-C is one of 4 classes of
Dock family proteins. The members here include:
Dock6/Zir1, Dock7/Zir2, and Dock8/Zir3. Dock-C members
are GEFs for both Rac and Cdc42. In addition to the C2
domain (AKA Dock homology region (DHR)-1, CED-5,
Dock180, MBC-zizimin homology (CZH) 1) and the DHR-2
(AKA CZH2, or Docker), which all Dock180-related
proteins have, Dock-C members contain a functionally
uncharacterized domain upstream of the C2 domain. DHR-2
has the catalytic activity for Rac and/or Cdc42, but is
structurally unrelated to the DH domain. The C2/DHR-1
domains of Dock180 and Dock4 have been shown to bind
phosphatidylinositol-3, 4, 5-triphosphate
(PtdIns(3,4,5)P3). The C2 domain was first identified in
PKC. C2 domains fold into an 8-standed beta-sandwich
that can adopt 2 structural arrangements: Type I and
Type II, distinguished by a circular permutation
involving their N- and C-terminal beta strands. Many C2
domains are Ca2+-dependent membrane-targeting modules
that bind a wide variety of substances including bind
phospholipids, inositol polyphosphates, and
intracellular proteins. Most C2 domain proteins are
either signal transduction enzymes that contain a single
C2 domain, such as protein kinase C, or membrane
trafficking proteins which contain at least two C2
domains, such as synaptotagmin 1. However, there are a
few exceptions to this including RIM isoforms and some
splice variants of piccolo/aczonin and intersectin which
only have a single C2 domain. C2 domains with a calcium
binding region have negatively charged residues,
primarily aspartates, that serve as ligands for calcium
ions.
Length = 179
Score = 25.0 bits (55), Expect = 8.5
Identities = 11/35 (31%), Positives = 16/35 (45%), Gaps = 1/35 (2%)
Query: 23 INKSKGPNISPCGTPISFSWTPTLKGSDSGQLSEF 57
I+ K TPI ++W P L+ + Q EF
Sbjct: 94 ISCQKKQEGGSVETPIGYTWLPLLR-NGRLQSGEF 127
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in
Synaptotagmin-like proteins. All Slp members basically
share an N-terminal Slp homology domain (SHD) and
C-terminal tandem C2 domains (named the C2A domain and
the C2B domain) with the SHD and C2 domains being
separated by a linker sequence of various length.
Slp1/JFC1 and Slp2/exophilin 4 promote granule docking
to the plasma membrane. Additionally, their C2A domains
are both Ca2+ independent, unlike the case in Slp3 and
Slp4/granuphilin in which their C2A domains are Ca2+
dependent. It is thought that SHD (except for the
Slp4-SHD) functions as a specific Rab27A/B-binding
domain. In addition to Slps, rabphilin, Noc2, and
Munc13-4 also function as Rab27-binding proteins. It has
been demonstrated that Slp3 and Slp4/granuphilin promote
dense-core vesicle exocytosis. Slp5 mRNA has been shown
to be restricted to human placenta and liver suggesting
a role in Rab27A-dependent membrane trafficking in
specific tissues. C2 domains fold into an 8-standed
beta-sandwich that can adopt 2 structural arrangements:
Type I and Type II, distinguished by a circular
permutation involving their N- and C-terminal beta
strands. Many C2 domains are Ca2+-dependent
membrane-targeting modules that bind a wide variety of
substances including bind phospholipids, inositol
polyphosphates, and intracellular proteins. Most C2
domain proteins are either signal transduction enzymes
that contain a single C2 domain, such as protein kinase
C, or membrane trafficking proteins which contain at
least two C2 domains, such as synaptotagmin 1. However,
there are a few exceptions to this including RIM
isoforms and some splice variants of piccolo/aczonin and
intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the first
C2 repeat, C2A, and has a type-I topology.
Length = 123
Score = 24.9 bits (55), Expect = 9.2
Identities = 10/26 (38%), Positives = 14/26 (53%), Gaps = 2/26 (7%)
Query: 78 GEVQLSL--NNVKGCLVVEVIRAKNL 101
GE++ SL N G L V + +NL
Sbjct: 1 GEIEFSLSYNYKTGSLEVHIKECRNL 26
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in
Synaptotagmin 7. Synaptotagmin is a
membrane-trafficking protein characterized by a
N-terminal transmembrane region, a linker, and 2
C-terminal C2 domains. Synaptotagmin 7, a member of
class 2 synaptotagmins, is located in presynaptic plasma
membranes in neurons, dense-core vesicles in endocrine
cells, and lysosomes in fibroblasts. It has been shown
to play a role in regulation of Ca2+-dependent lysosomal
exocytosis in fibroblasts and may also function as a
vesicular Ca2+-sensor. It is distinguished from the
other synaptotagmins by having over 12 splice forms.
Previously all synaptotagmins were thought to be calcium
sensors in the regulation of neurotransmitter release
and hormone secretion, but it has been shown that not
all of them bind calcium. Of the 17 identified
synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10).
The function of the two C2 domains that bind calcium
are: regulating the fusion step of synaptic vesicle
exocytosis (C2A) and binding to
phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the
absence of calcium ions and to phosphatidylinositol
bisphosphate (PIP2) in their presence (C2B). C2B also
regulates also the recycling step of synaptic vesicles.
C2 domains fold into an 8-standed beta-sandwich that can
adopt 2 structural arrangements: Type I and Type II,
distinguished by a circular permutation involving their
N- and C-terminal beta strands. Many C2 domains are
Ca2+-dependent membrane-targeting modules that bind a
wide variety of substances including bind phospholipids,
inositol polyphosphates, and intracellular proteins.
Most C2 domain proteins are either signal transduction
enzymes that contain a single C2 domain, such as protein
kinase C, or membrane trafficking proteins which contain
at least two C2 domains, such as synaptotagmin 1.
However, there are a few exceptions to this including
RIM isoforms and some splice variants of piccolo/aczonin
and intersectin which only have a single C2 domain. C2
domains with a calcium binding region have negatively
charged residues, primarily aspartates, that serve as
ligands for calcium ions. This cd contains the second C2
repeat, C2B, and has a type-I topology.
Length = 136
Score = 24.7 bits (54), Expect = 9.7
Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%)
Query: 78 GEVQLSL--NNVKGCLVVEVIRAKNLQPK 104
GE+ LSL N + V +I+A+NL+
Sbjct: 2 GELLLSLCYNPTANRITVNIIKARNLKAM 30
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.314 0.135 0.406
Gapped
Lambda K H
0.267 0.0648 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 5,445,796
Number of extensions: 448810
Number of successful extensions: 246
Number of sequences better than 10.0: 1
Number of HSP's gapped: 246
Number of HSP's successfully gapped: 32
Length of query: 111
Length of database: 10,937,602
Length adjustment: 75
Effective length of query: 36
Effective length of database: 7,611,052
Effective search space: 273997872
Effective search space used: 273997872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 53 (24.4 bits)