Query         psy62
Match_columns 262
No_of_seqs    225 out of 1108
Neff          5.3 
Searched_HMMs 46136
Date          Fri Aug 16 20:13:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy62.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/62hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0704|consensus              100.0 4.7E-70   1E-74  506.3  14.5  210    1-219    21-231 (386)
  2 COG5347 GTPase-activating prot 100.0 1.1E-37 2.3E-42  291.3  10.5  104    1-104    22-125 (319)
  3 KOG0706|consensus              100.0 1.3E-34 2.9E-39  276.5   7.0   99    1-101    25-123 (454)
  4 PLN03114 ADP-ribosylation fact 100.0 9.5E-34 2.1E-38  265.5   8.8  100    1-101    24-123 (395)
  5 smart00105 ArfGap Putative GTP 100.0 1.4E-33 3.1E-38  227.5   8.0  105    1-109     5-109 (112)
  6 PF01412 ArfGap:  Putative GTPa 100.0 2.2E-33 4.7E-38  227.6   4.6  102    1-107    15-116 (116)
  7 KOG0703|consensus              100.0   5E-32 1.1E-36  248.6   5.4   70    1-70     27-96  (287)
  8 PLN03131 hypothetical protein;  99.9   1E-27 2.2E-32  236.6   8.9  105    1-112    25-129 (705)
  9 PLN03119 putative ADP-ribosyla  99.9 3.7E-27 8.1E-32  231.0  10.1  107    1-114    25-131 (648)
 10 KOG0705|consensus               99.8 4.2E-21 9.1E-26  188.7   4.7   69    1-69    515-583 (749)
 11 KOG0521|consensus               99.8 6.9E-20 1.5E-24  188.4   1.6  104    1-110   428-534 (785)
 12 KOG0818|consensus               99.7 1.3E-18 2.7E-23  169.2   1.3   70    1-70     10-79  (669)
 13 KOG1117|consensus               99.6   6E-16 1.3E-20  157.6   2.3   71    1-71    300-372 (1186)
 14 KOG0702|consensus               99.2   2E-11 4.3E-16  119.2   6.0  106    1-111    27-133 (524)
 15 KOG0521|consensus               91.9   0.031 6.6E-07   59.0  -1.4   66    1-68    632-698 (785)
 16 PF00643 zf-B_box:  B-box zinc   80.0     1.6 3.4E-05   28.5   2.2   31    1-31      5-36  (42)
 17 PRK00085 recO DNA repair prote  77.2     1.1 2.3E-05   40.0   1.0   27    1-27    151-178 (247)
 18 KOG0704|consensus               76.6    0.95 2.1E-05   43.8   0.5   37  192-228   247-293 (386)
 19 TIGR00613 reco DNA repair prot  71.0     2.7 5.8E-05   37.3   1.9   28    1-28    149-177 (241)
 20 PF08271 TF_Zn_Ribbon:  TFIIB z  69.1     3.3 7.1E-05   27.7   1.6   25    1-26      2-26  (43)
 21 COG1381 RecO Recombinational D  63.4     3.2   7E-05   37.9   0.9   26    1-26    156-182 (251)
 22 PF10764 Gin:  Inhibitor of sig  57.0     6.4 0.00014   27.2   1.3   26    1-27      1-26  (46)
 23 COG1997 RPL43A Ribosomal prote  55.7     8.2 0.00018   30.4   1.8   26    1-28     37-62  (89)
 24 PF00320 GATA:  GATA zinc finge  54.1     8.6 0.00019   24.9   1.5   30    2-31      1-32  (36)
 25 PF14471 DUF4428:  Domain of un  54.0     4.1 8.9E-05   28.7  -0.1   43    1-44      1-45  (51)
 26 PF01286 XPA_N:  XPA protein N-  52.4     4.6 9.9E-05   26.4  -0.1   26    1-26      5-31  (34)
 27 PF11781 RRN7:  RNA polymerase   47.1      14  0.0003   24.2   1.6   21    2-25     11-31  (36)
 28 PRK12495 hypothetical protein;  40.4      14  0.0003   33.8   1.1   24    1-28     44-67  (226)
 29 smart00401 ZnF_GATA zinc finge  37.2      26 0.00056   24.5   1.8   34    1-34      5-40  (52)
 30 smart00290 ZnF_UBP Ubiquitin C  34.3      26 0.00057   23.4   1.5   16    1-16      1-16  (50)
 31 PF01258 zf-dskA_traR:  Prokary  34.2     5.5 0.00012   25.6  -1.8   29    1-29      5-34  (36)
 32 COG2158 Uncharacterized protei  33.9      26 0.00057   28.7   1.6   31    2-34     45-77  (112)
 33 PF07282 OrfB_Zn_ribbon:  Putat  33.5      25 0.00054   25.3   1.3   23    1-25     30-52  (69)
 34 PF12156 ATPase-cat_bd:  Putati  32.4      25 0.00053   27.2   1.2   32    1-32      2-39  (88)
 35 PTZ00255 60S ribosomal protein  30.8      33 0.00071   27.2   1.7   25    1-27     38-62  (90)
 36 PF10310 DUF2413:  Protein of u  30.7      31 0.00066   34.6   1.9   30  195-224   117-148 (444)
 37 PRK00423 tfb transcription ini  30.7      33 0.00072   32.2   2.0   28    1-29     13-40  (310)
 38 smart00659 RPOLCX RNA polymera  30.6      22 0.00048   24.2   0.6   22    1-25      4-25  (44)
 39 PF14376 Haem_bd:  Haem-binding  30.0      24 0.00052   29.4   0.9   38    1-48     43-84  (137)
 40 PF08274 PhnA_Zn_Ribbon:  PhnA   30.0      26 0.00056   22.2   0.8   24    1-27      4-27  (30)
 41 PTZ00074 60S ribosomal protein  25.3      37  0.0008   28.8   1.2   26    1-26     43-85  (135)
 42 cd07162 NR_DBD_PXR DNA-binding  24.6      49  0.0011   25.5   1.6   27    1-30      1-27  (87)
 43 PF14803 Nudix_N_2:  Nudix N-te  23.7      38 0.00082   22.0   0.7   27    2-29      3-32  (34)
 44 PRK14714 DNA polymerase II lar  23.0      40 0.00086   38.0   1.2   28   81-108   844-871 (1337)
 45 PF01780 Ribosomal_L37ae:  Ribo  22.9      52  0.0011   26.0   1.5   24    1-26     37-60  (90)
 46 cd07156 NR_DBD_VDR_like The DN  22.7      54  0.0012   24.2   1.5   27    2-31      1-27  (72)
 47 cd07170 NR_DBD_ERR DNA-binding  22.5      45 0.00098   26.4   1.1   27    1-30      6-32  (97)
 48 smart00399 ZnF_C4 c4 zinc fing  22.1      48   0.001   24.2   1.2   27    1-30      1-27  (70)
 49 cd06966 NR_DBD_CAR DNA-binding  21.4      47   0.001   26.0   1.0   28    1-31      2-29  (94)
 50 PHA02540 61 DNA primase; Provi  21.3      56  0.0012   31.6   1.7   56    1-60     29-92  (337)
 51 cd07165 NR_DBD_DmE78_like DNA-  21.1      49  0.0011   25.1   1.0   27    2-31      1-27  (81)
 52 PF06827 zf-FPG_IleRS:  Zinc fi  21.1      40 0.00086   20.6   0.4   27    1-27      3-29  (30)
 53 cd07157 2DBD_NR_DBD1 The first  21.0      47   0.001   25.6   0.9   28    1-31      2-29  (86)
 54 cd00202 ZnF_GATA Zinc finger D  20.4      59  0.0013   23.0   1.3   34    1-34      1-36  (54)

No 1  
>KOG0704|consensus
Probab=100.00  E-value=4.7e-70  Score=506.31  Aligned_cols=210  Identities=49%  Similarity=0.855  Sum_probs=174.7

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCCCCchhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQ   80 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~~~~~I~   80 (262)
                      +||||+++|||||||+|||||||+|+|+||+||||||||||||||+|++.||++|++|||.++++||+.++++++.++|+
T Consensus        21 ~CfeC~a~NPQWvSvsyGIfICLECSG~HRgLGVhiSFVRSVTMD~wkeiel~kMeaGGN~~~~eFL~s~~~~~e~~~i~  100 (386)
T KOG0704|consen   21 KCFECGAPNPQWVSVSYGIFICLECSGKHRGLGVHISFVRSVTMDKWKEIELKKMEAGGNERFREFLSSQGIYKETWPIR  100 (386)
T ss_pred             ceeecCCCCCCeEeecccEEEEEecCCcccccceeeEEEEeeecccccHHHHHHHHhccchhHHHHHhhCccccccccHH
Confidence            69999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhccHHHHHHHHHHhcccCCCCcccCCCCCCCCC-CCCcccccCCCCCCCCCCCCCCCCCCCcchhhhhHHHHhhhhhc
Q psy62            81 QKYNTKAAALYRDKVSSSYMFNTFTTKGIFDFSQS-GGSTVTSSYQGGGGGYQSGGGGGMVNSASFQSEKEAFFSRKQQE  159 (262)
Q Consensus        81 ~KY~~~aa~~yr~kl~~~~~gr~~~~~~~~~~~~s-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~Fa~~g~~  159 (262)
                      +||++++|+.||+||.++++||+|..++....+.+ ..-++.....  ..+....  ....+....+..+|.||++++.+
T Consensus       101 eKYns~aAa~yRdki~~laegr~w~d~~~~k~~~p~~syt~a~~~~--~~ss~~~--~~~sq~~~~~~~ke~~fa~~~~~  176 (386)
T KOG0704|consen  101 EKYNSRAAALYRDKIAALAEGREWNDPPYLKEDNPAQSYTSAAQLG--SKSSETI--YTISQLSNSAAGKESYFAKRLSE  176 (386)
T ss_pred             HhhccHHHHHHHHHHHHHhcCCcccccccccccCcccccccCCCcC--CCcCCcc--cccccchhhhcchhHHHHHhccc
Confidence            99999999999999999999999977665543321 1111100000  0000000  01122334567788999999999


Q ss_pred             ccCCCCCCCCCCCCccccccCCCCCCCCCCCCccccccchhhhhhhhhhHHHHHHHHHHH
Q psy62           160 NLSRPDHLPPSQGGRYAGFGNSVESPPPRSVSSQELFGGAVSSLTSGWSMFSSSATKLAS  219 (262)
Q Consensus       160 N~sRp~~lpPsQggkY~GFGnt~~~p~~~~~~~~~~~~~~~~~l~~Gw~~fs~~~~k~a~  219 (262)
                      |.+||++|||+|||||+|||+|+. |||+++ .+|   |+|++|+.||++||.+|+++|+
T Consensus       177 n~srpd~lppsQggkY~GFGst~~-~ppqs~-~~~---~~~s~ls~Gws~~s~~as~~a~  231 (386)
T KOG0704|consen  177 NQSRPDGLPPSQGGKYQGFGSTNA-PPPQSN-SQD---DAMSVLSSGWSRLSTGASSAAS  231 (386)
T ss_pred             ccCCCCCCCcccCCcccccCCCCC-CCCccc-ccc---chhhhhccccccccchhhhhhh
Confidence            999999999999999999999988 666654 333   8999999999999999999887


No 2  
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=100.00  E-value=1.1e-37  Score=291.29  Aligned_cols=104  Identities=39%  Similarity=0.753  Sum_probs=97.3

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCCCCchhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQ   80 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~~~~~I~   80 (262)
                      +|||||+++|+|+|++||||||++||||||+|||||||||||+||.|+++||++|+.+||.++++||+.+......++|+
T Consensus        22 ~CaDCga~~P~W~S~nlGvfiCi~CagvHRsLGvhiS~VKSitLD~wt~~~l~~m~~gGN~~a~~~~e~~~~~~~~~~~k  101 (319)
T COG5347          22 KCADCGAPNPTWASVNLGVFLCIDCAGVHRSLGVHISKVKSLTLDNWTEEELRRMEVGGNSNANRFYEKNLLDQLLLPIK  101 (319)
T ss_pred             ccccCCCCCCceEecccCeEEEeecchhhhccccceeeeeeeecccCCHHHHHHHHHhcchhhhhHhccCCCcccccccc
Confidence            69999999999999999999999999999999999999999999999999999999999999999999986643458999


Q ss_pred             hhhccHHHHHHHHHHhcccCCCCc
Q psy62            81 QKYNTKAAALYRDKVSSSYMFNTF  104 (262)
Q Consensus        81 ~KY~~~aa~~yr~kl~~~~~gr~~  104 (262)
                      +||++..++.|+.++..++....|
T Consensus       102 ~~yd~~v~~~y~~~ky~~~~~~~~  125 (319)
T COG5347         102 AKYDSSVAKKYIRKKYELKKFIDD  125 (319)
T ss_pred             cccCHHHHHHHHHHHHHhhhcccc
Confidence            999999999999999888777776


No 3  
>KOG0706|consensus
Probab=100.00  E-value=1.3e-34  Score=276.51  Aligned_cols=99  Identities=48%  Similarity=0.927  Sum_probs=93.1

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCCCCchhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQ   80 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~~~~~I~   80 (262)
                      +|||||+++|.|+||+||||||++|+++||.||||||||||++||.|+..||++|+.|||.+|+.||..|...  ...++
T Consensus        25 vCFDCgAknPtWaSVTYGIFLCiDCSAvHRnLGVHiSFVRSTnLDsWs~~qLR~M~~GGN~nA~~FFkqhg~~--t~d~~  102 (454)
T KOG0706|consen   25 VCFDCGAKNPTWASVTYGIFLCIDCSAVHRNLGVHISFVRSTNLDSWSWEQLRRMQVGGNANARVFFKQHGCV--TLDAN  102 (454)
T ss_pred             eecccCCCCCCceeecceEEEEEecchhhhccccceEEEeecccccCCHHHHhHhhhcCchhHHHHHHHcCCc--chhhh
Confidence            5999999999999999999999999999999999999999999999999999999999999999999998543  34899


Q ss_pred             hhhccHHHHHHHHHHhcccCC
Q psy62            81 QKYNTKAAALYRDKVSSSYMF  101 (262)
Q Consensus        81 ~KY~~~aa~~yr~kl~~~~~g  101 (262)
                      .||+++++.+||++|..++.+
T Consensus       103 aKY~SraA~~Yr~kl~~lv~k  123 (454)
T KOG0706|consen  103 AKYNSRAAKLYREKLKKLVQK  123 (454)
T ss_pred             hhhccHHHHHHHHHHHHHHHH
Confidence            999999999999999987654


No 4  
>PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional
Probab=100.00  E-value=9.5e-34  Score=265.46  Aligned_cols=100  Identities=46%  Similarity=0.936  Sum_probs=95.0

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCCCCchhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQ   80 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~~~~~I~   80 (262)
                      +|+|||+++|+|+|++||||||++|+|+||+||+|||+||||+||.|+++||++|+.+||.++++||+.+ ++.....|+
T Consensus        24 ~CaDCga~nPtWASvn~GIFLCl~CSGVHRsLGvHISfVRSltLD~Ws~eqL~~Mk~GGN~rA~~fF~qh-G~~~~~~~~  102 (395)
T PLN03114         24 ICFDCNAKNPTWASVTYGIFLCIDCSAVHRSLGVHISFVRSTNLDSWSSEQLKMMIYGGNNRAQVFFKQY-GWSDGGKTE  102 (395)
T ss_pred             cCccCCCCCCCceeeccceeehhhhhHhhccCCCCCceeecccCCCCCHHHHHHHHHhcCHHHHHHHHHc-CCCCCCCcc
Confidence            5999999999999999999999999999999999999999999999999999999999999999999986 455567899


Q ss_pred             hhhccHHHHHHHHHHhcccCC
Q psy62            81 QKYNTKAAALYRDKVSSSYMF  101 (262)
Q Consensus        81 ~KY~~~aa~~yr~kl~~~~~g  101 (262)
                      +||+++++++||++|.+++++
T Consensus       103 ~KY~S~aA~~Yre~L~keVa~  123 (395)
T PLN03114        103 AKYTSRAADLYKQILAKEVAK  123 (395)
T ss_pred             cccCCHHHHHHHHHHHHHHHH
Confidence            999999999999999998875


No 5  
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=100.00  E-value=1.4e-33  Score=227.53  Aligned_cols=105  Identities=37%  Similarity=0.736  Sum_probs=88.9

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCCCCchhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQ   80 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~~~~~I~   80 (262)
                      +|+|||+++|+|||++||||||++|+|+||.||+|||+||||+||+|+++||++|+.+||+++|+||+++.......+  
T Consensus         5 ~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~lg~his~VkSl~md~w~~~~i~~~~~~GN~~~n~~~e~~~~~~~~~~--   82 (112)
T smart00105        5 KCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISKVRSLTLDTWTEEELRLLQKGGNENANSIWESNLDDFSLKP--   82 (112)
T ss_pred             cccCCCCCCCCcEEeccceeEhHHhHHHHHhcCCCcCeeeecccCCCCHHHHHHHHHhhhHHHHHHHHhhCCccccCC--
Confidence            599999999999999999999999999999999999999999999999999999999999999999999754221111  


Q ss_pred             hhhccHHHHHHHHHHhcccCCCCcccCCC
Q psy62            81 QKYNTKAAALYRDKVSSSYMFNTFTTKGI  109 (262)
Q Consensus        81 ~KY~~~aa~~yr~kl~~~~~gr~~~~~~~  109 (262)
                        -.......|+++|+++|+.++|+.+..
T Consensus        83 --~~~~~~~~~~~fI~~KY~~k~f~~~~~  109 (112)
T smart00105       83 --PDSDDQQKYESFIAAKYEEKLFVPPES  109 (112)
T ss_pred             --CCCchHHHHHHHHHHHHHhhhcccccc
Confidence              111134567888888888888877654


No 6  
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=99.98  E-value=2.2e-33  Score=227.61  Aligned_cols=102  Identities=39%  Similarity=0.756  Sum_probs=77.7

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCCCCchhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQ   80 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~~~~~I~   80 (262)
                      +|+|||+++|+|||++||||||++|+|+||.||+|||+||||+||+|+++||++|+.+||.++|++|+++...  ...+ 
T Consensus        15 ~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~lg~~is~VkSi~~d~w~~~ev~~~~~~GN~~~n~~~e~~~~~--~~~~-   91 (116)
T PF01412_consen   15 VCADCGAPNPTWASLNYGIFLCLECAGIHRSLGVHISRVKSITMDNWSPEEVQRMREGGNKRANSIWEANSPP--PKKP-   91 (116)
T ss_dssp             B-TTT-SBS--EEETTTTEEE-HHHHHHHHHHTTTT--EEETTTS---HHHHHHHHHSHHHHHHHHHTTTSTT--TTTH-
T ss_pred             cCCCCCCCCCCEEEeecChhhhHHHHHHHHHhcccchhccccccCCCCHHHHHHHHHHChHHHHHHHHcCCCC--CCCC-
Confidence            5999999999999999999999999999999999999999999999999999999999999999999998211  1111 


Q ss_pred             hhhccHHHHHHHHHHhcccCCCCcccC
Q psy62            81 QKYNTKAAALYRDKVSSSYMFNTFTTK  107 (262)
Q Consensus        81 ~KY~~~aa~~yr~kl~~~~~gr~~~~~  107 (262)
                        -.......|+++|+++|+.+.|..+
T Consensus        92 --~~~~~~~~~~~fI~~KY~~k~f~~~  116 (116)
T PF01412_consen   92 --PPSSDQEKREQFIRAKYVEKAFISK  116 (116)
T ss_dssp             --CTTSHHHHHHHHHHHHHTTHTTS-C
T ss_pred             --CCCCcHHHHHHHHHHHHHhhhhccC
Confidence              1123355788899999999999753


No 7  
>KOG0703|consensus
Probab=99.97  E-value=5e-32  Score=248.62  Aligned_cols=70  Identities=43%  Similarity=0.935  Sum_probs=69.0

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhC
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQ   70 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~   70 (262)
                      .|+|||++.|.|||+|+|||||+.|+||||.||||||+||||+||.|++|||+.|...||.++|+|||++
T Consensus        27 ~CADC~a~~P~WaSwnlGvFiC~~C~giHR~lg~hiSkVkSv~LD~W~~eqv~~m~~~GN~~an~~~ea~   96 (287)
T KOG0703|consen   27 VCADCGAKGPRWASWNLGVFICLRCAGIHRSLGVHISKVKSVTLDEWTDEQVDFMISMGNAKANSYYEAK   96 (287)
T ss_pred             cccccCCCCCCeEEeecCeEEEeecccccccccchhheeeeeeccccCHHHHHHHHHHcchhhhhhcccc
Confidence            5999999999999999999999999999999999999999999999999999999999999999999997


No 8  
>PLN03131 hypothetical protein; Provisional
Probab=99.94  E-value=1e-27  Score=236.63  Aligned_cols=105  Identities=26%  Similarity=0.527  Sum_probs=88.8

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCCCCchhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQ   80 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~~~~~I~   80 (262)
                      +|+||++++|+|||++||||||++|+||||.|| |  |||||+||+|+++||+.|+.+||+++|+||+++.+.. ...+.
T Consensus        25 ~CADCga~~P~WASiNlGIFICi~CSGIHRsLg-h--RVKSVTLD~WtdeEV~~Mk~gGN~~AN~iyeanwd~~-r~~lP  100 (705)
T PLN03131         25 RCINCNSLGPQFVCTNFWTFICMTCSGIHREFT-H--RVKSVSMSKFTSQDVEALQNGGNQRAREIYLKDWDQQ-RQRLP  100 (705)
T ss_pred             ccccCCCCCCCeeEeccceEEchhchhhhcccC-c--ccccccCCCCCHHHHHHHHHhccHHHHHHHHhhcccc-cCCCC
Confidence            599999999999999999999999999999998 4  9999999999999999999999999999999875422 11222


Q ss_pred             hhhccHHHHHHHHHHhcccCCCCcccCCCCCC
Q psy62            81 QKYNTKAAALYRDKVSSSYMFNTFTTKGIFDF  112 (262)
Q Consensus        81 ~KY~~~aa~~yr~kl~~~~~gr~~~~~~~~~~  112 (262)
                      ...   .....+++|+.+|+.|+|..+.....
T Consensus       101 ~~s---d~ekrr~FIR~KYVeKRFa~~~s~d~  129 (705)
T PLN03131        101 DNS---KVDKIREFIKDIYVDKKYAGGKTHDK  129 (705)
T ss_pred             CCc---cHHHHHHHHHHHHhhhhhhcCCCCCC
Confidence            222   24457899999999999998875544


No 9  
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=99.94  E-value=3.7e-27  Score=231.05  Aligned_cols=107  Identities=28%  Similarity=0.550  Sum_probs=90.0

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCCCCchhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTIQ   80 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~~~~~I~   80 (262)
                      +|+|||+.+|+|||++||||||++|+||||.|| |  +||||+||+|+++||+.|+.+||+++|+||+++.+... ..+.
T Consensus        25 ~CADCgs~~P~WASiNlGIFICi~CSGIHRsLG-h--RVKSLSLDkWT~EEVe~Mk~gGN~~AN~iyeanw~~~~-~~~P  100 (648)
T PLN03119         25 RCINCNSLGPQYVCTTFWTFVCMACSGIHREFT-H--RVKSVSMSKFTSKEVEVLQNGGNQRAREIYLKNWDHQR-QRLP  100 (648)
T ss_pred             ccccCCCCCCCceeeccceEEeccchhhhccCC-c--eeeccccCCCCHHHHHHHHHhchHHHHHHHHhhccccc-CCCC
Confidence            599999999999999999999999999999998 4  99999999999999999999999999999999754221 1111


Q ss_pred             hhhccHHHHHHHHHHhcccCCCCcccCCCCCCCC
Q psy62            81 QKYNTKAAALYRDKVSSSYMFNTFTTKGIFDFSQ  114 (262)
Q Consensus        81 ~KY~~~aa~~yr~kl~~~~~gr~~~~~~~~~~~~  114 (262)
                      ...+   .+..+++|+.+|+.|+|..+...+..+
T Consensus       101 ~~sD---~e~lr~FIR~KYVeKRF~~~~~~d~p~  131 (648)
T PLN03119        101 ENSN---AERVREFIKNVYVQKKYAGANDADKPS  131 (648)
T ss_pred             CCcc---HHHHHHHHHHHHhhhhccCcCCCCCCc
Confidence            1122   345689999999999999887666544


No 10 
>KOG0705|consensus
Probab=99.82  E-value=4.2e-21  Score=188.74  Aligned_cols=69  Identities=43%  Similarity=0.885  Sum_probs=68.1

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNA   69 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~   69 (262)
                      .|+||++++|.|||+|+|+.||++|+|+||.||.|+|+||||.+|.|..|.+..|..+||+.+|.+||.
T Consensus       515 ~c~dc~~~n~~wAslnlg~l~cieCsgihr~lgt~lSrvr~LeLDdWPvEl~~Vm~aiGN~~AN~vWE~  583 (749)
T KOG0705|consen  515 HCVDCGTPNPKWASLNLGVLMCIECSGIHRNLGTHLSRVRSLELDDWPVELLKVMSAIGNDLANSVWEG  583 (749)
T ss_pred             eeeecCCCCcccccccCCeEEEEEchhhhhhhhhhhhhhhccccccCcHHHHHHHHHhhhhHHHHHhhh
Confidence            599999999999999999999999999999999999999999999999999999999999999999997


No 11 
>KOG0521|consensus
Probab=99.77  E-value=6.9e-20  Score=188.43  Aligned_cols=104  Identities=33%  Similarity=0.589  Sum_probs=84.7

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCC---CCc
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWD---DTM   77 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~---~~~   77 (262)
                      +|+|||++.|.|+|+|+||.+|++|+|+||.||||||+|||++||.|.++.+..|+.+||..+|.+||++....   ...
T Consensus       428 ~c~Dcg~p~ptw~S~NLgv~~CIecSGvhRslGvh~SkvrsLtLD~~~~~l~~l~~~lgn~~~N~i~e~~l~~~~~~~~~  507 (785)
T KOG0521|consen  428 QCCDCGAPEPTWASINLGVLLCIECSGVHRSLGVHISKVRSLTLDVWEPELLLLFKNLGNKYVNEIYEALLPSYDSSKPT  507 (785)
T ss_pred             hhhhcCCCCCchHhhhhchhhHhhccccccccCchhhhhhhhhhhccCcHHHHHHHHhCcchhhhhhhcccccccccCCC
Confidence            59999999999999999999999999999999999999999999999999999999999999999999863211   111


Q ss_pred             hhhhhhccHHHHHHHHHHhcccCCCCcccCCCC
Q psy62            78 TIQQKYNTKAAALYRDKVSSSYMFNTFTTKGIF  110 (262)
Q Consensus        78 ~I~~KY~~~aa~~yr~kl~~~~~gr~~~~~~~~  110 (262)
                      ....      ...-+.+|+++|..+.|....+.
T Consensus       508 ~~~~------~~~r~~~i~~kyve~~F~~k~~~  534 (785)
T KOG0521|consen  508 ASSS------RQAREAWIKAKYVERRFSVKEPQ  534 (785)
T ss_pred             Cccc------hhhhhHhhhcccceeeEeecccc
Confidence            1111      22345567777777777665543


No 12 
>KOG0818|consensus
Probab=99.71  E-value=1.3e-18  Score=169.19  Aligned_cols=70  Identities=33%  Similarity=0.694  Sum_probs=68.3

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhC
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQ   70 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~   70 (262)
                      .|.|||+++|.||||+-|+|||.+|..+||.||.|||.||+|....|.++.|++.....|..+|.+||+.
T Consensus        10 vC~DC~~~dp~WASvnrGt~lC~eCcsvHrsLGrhIS~vrhLR~s~W~pt~l~~V~tLn~~gaNsIWEh~   79 (669)
T KOG0818|consen   10 VCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLRHTPWPPTLLQMVETLNNNGANSIWEHS   79 (669)
T ss_pred             hhcccCCCCCcceeecCceEehHhhhHHHhhhcchHHHHHHhccCCCCHHHHHHHHHHHhcCcchhhhhh
Confidence            5999999999999999999999999999999999999999999999999999999999999999999984


No 13 
>KOG1117|consensus
Probab=99.57  E-value=6e-16  Score=157.60  Aligned_cols=71  Identities=38%  Similarity=0.733  Sum_probs=68.9

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCC--CCHHHHHhhhcCChHHHHHHHhhCC
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDK--WKDIELEKMKVGGNKAAHDFLNAQP   71 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~--W~~~el~~m~~gGN~~~n~f~e~~~   71 (262)
                      .|+|||++.|.|||+|+++.||-.|+|-||+||.-+|+|||++||.  |+.+-|+++-..||.++|+||..+.
T Consensus       300 ~cadC~ssrPdwasiNL~vvIck~caGqhrslgs~dSkvrslkmd~svwsneliElfivlgn~~an~Fwa~nl  372 (1186)
T KOG1117|consen  300 ECADCGSSRPDWASINLCVVICKPCAGQHRSLGSGDSKVRSLKMDPSVWSNELIELFIVLGNPRANRFWAGNL  372 (1186)
T ss_pred             cccccCCCCCcccccccceEEcccCCCccccCCCccccccccccCcccccchhhhhheeecCcccccccccCC
Confidence            4999999999999999999999999999999999999999999998  9999999999999999999999864


No 14 
>KOG0702|consensus
Probab=99.19  E-value=2e-11  Score=119.18  Aligned_cols=106  Identities=21%  Similarity=0.364  Sum_probs=88.8

Q ss_pred             CCCCCCCCCC-CeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHhhCCCCCCCchh
Q psy62             1 KCFECNAHNP-QWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLNAQPDWDDTMTI   79 (262)
Q Consensus         1 ~C~DCga~~P-~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e~~~~~~~~~~I   79 (262)
                      ||++|....+ .|++.+-|.|+|+.|+|..|+|.. -.+||||+|.+|++.|+..++.+||+..+++|-.-.|...+...
T Consensus        27 rC~nCnsl~~~t~~~~~~g~fv~~~~sg~ls~l~~-ahRvksiSmttft~qevs~lQshgNq~~k~i~fkl~D~q~S~vP  105 (524)
T KOG0702|consen   27 RCINCNSLVAATYVVYTVGSFVCTMCSGLLSGLNP-AHRVKSISMTTFTDQEVSFLQSHGNQVCKEIWFKLFDFQRSNVP  105 (524)
T ss_pred             ceeeccccccceEEEeeccceeeeccchhhccCCC-ccccceeeeeeccccchHHHhhcchhhhhhhhhcchhhhhccCC
Confidence            7999999888 999999999999999999999964 24999999999999999999999999999999976554433322


Q ss_pred             hhhhccHHHHHHHHHHhcccCCCCcccCCCCC
Q psy62            80 QQKYNTKAAALYRDKVSSSYMFNTFTTKGIFD  111 (262)
Q Consensus        80 ~~KY~~~aa~~yr~kl~~~~~gr~~~~~~~~~  111 (262)
                      -.+|    ...-|++++.+|++++|+.+.-..
T Consensus       106 D~rn----~~~~kef~q~~y~~kr~~v~~n~~  133 (524)
T KOG0702|consen  106 DSRN----PQKVKEFQQEKYVKKRYYVPKNQM  133 (524)
T ss_pred             Cccc----chhhHHHHhhhhccceeecCcccc
Confidence            2223    455699999999999999887543


No 15 
>KOG0521|consensus
Probab=91.88  E-value=0.031  Score=58.99  Aligned_cols=66  Identities=17%  Similarity=0.261  Sum_probs=54.0

Q ss_pred             CCCCCCC-CCCCeeEcccceeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCChHHHHHHHh
Q psy62             1 KCFECNA-HNPQWASVTYGIWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGNKAAHDFLN   68 (262)
Q Consensus         1 ~C~DCga-~~P~WaSv~~GifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN~~~n~f~e   68 (262)
                      .|++|++ ..-.|+++++.+-+|..|+++|+.++.|++..+++.+|...+  |.....-|+...+.-+.
T Consensus       632 ~~~~~~~~~~~~~~~~n~~~~~~~~~s~lh~a~~~~~~~~~e~ll~~ga~--vn~~d~~g~~plh~~~~  698 (785)
T KOG0521|consen  632 ECLPRIATALAHGCCENWPVVLCIGCSLLHVAVGTGDSGAVELLLQNGAD--VNALDSKGRTPLHHATA  698 (785)
T ss_pred             cchhhhhhhhcchhhhccchhhhcccchhhhhhccchHHHHHHHHhcCCc--chhhhccCCCcchhhhh
Confidence            3788887 457899999999999999999999999999999999998888  56565556555554433


No 16 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=79.95  E-value=1.6  Score=28.54  Aligned_cols=31  Identities=26%  Similarity=0.410  Sum_probs=25.8

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhh-hcC
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGK-HRG   31 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~Csgv-HR~   31 (262)
                      .|..|......+-+.+-.++||..|... |++
T Consensus         5 ~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~   36 (42)
T PF00643_consen    5 KCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG   36 (42)
T ss_dssp             B-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT
T ss_pred             cCccCCccceEEEecCCCCccCccCCCCCCCC
Confidence            3777777778889999999999999987 887


No 17 
>PRK00085 recO DNA repair protein RecO; Reviewed
Probab=77.24  E-value=1.1  Score=40.01  Aligned_cols=27  Identities=30%  Similarity=0.599  Sum_probs=23.4

Q ss_pred             CCCCCCCCCC-CeeEcccceeEehhhhh
Q psy62             1 KCFECNAHNP-QWASVTYGIWICLECSG   27 (262)
Q Consensus         1 ~C~DCga~~P-~WaSv~~GifiC~~Csg   27 (262)
                      .|+-||.+.. .|.++..|.++|..|..
T Consensus       151 ~C~~Cg~~~~~~~f~~~~gg~~c~~c~~  178 (247)
T PRK00085        151 HCAVCGAPGDHRYFSPKEGGAVCSECGD  178 (247)
T ss_pred             hHhcCCCCCCceEEecccCCcccccccC
Confidence            4999998755 78899999999999973


No 18 
>KOG0704|consensus
Probab=76.59  E-value=0.95  Score=43.81  Aligned_cols=37  Identities=14%  Similarity=0.357  Sum_probs=33.3

Q ss_pred             ccccccchhhhhh-h----h---hhHHHHHHHHHHHHH--hhhhhcc
Q psy62           192 SQELFGGAVSSLT-S----G---WSMFSSSATKLASKA--TENAIKY  228 (262)
Q Consensus       192 ~~~~~~~~~~~l~-~----G---w~~fs~~~~k~a~~~--~e~~~k~  228 (262)
                      +++|+++|+++|+ +    |   |++|+..+++.+..+  +++++++
T Consensus       247 l~~~~s~~v~~va~k~t~vG~r~W~~ls~~~sq~~e~fq~~~s~g~~  293 (386)
T KOG0704|consen  247 LDDFVSDPVGTVASKVTEVGTRGWGLLSAAVSQSVEDFQDSESVGGP  293 (386)
T ss_pred             hhhhcccchhhhhhhcccccccchhhhHHhhccccccccccCccCCc
Confidence            5889999999998 5    4   999999999999999  8888885


No 19 
>TIGR00613 reco DNA repair protein RecO. All proteins in this family for which functions are known are DNA binding proteins that are involved in the initiation of recombination or recombinational repair.
Probab=70.95  E-value=2.7  Score=37.29  Aligned_cols=28  Identities=36%  Similarity=0.772  Sum_probs=23.5

Q ss_pred             CCCCCCCCCC-CeeEcccceeEehhhhhh
Q psy62             1 KCFECNAHNP-QWASVTYGIWICLECSGK   28 (262)
Q Consensus         1 ~C~DCga~~P-~WaSv~~GifiC~~Csgv   28 (262)
                      .|+.||..++ .+.++..|.++|.+|...
T Consensus       149 ~C~~cg~~~~~~~fs~~~gg~~C~~c~~~  177 (241)
T TIGR00613       149 KCAVCGSKEDLIYFSMTYGGALCRQCGEK  177 (241)
T ss_pred             ccCCCCCcCCCceEchhcCeEEChhhCcc
Confidence            4999998554 788999999999999764


No 20 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=69.10  E-value=3.3  Score=27.67  Aligned_cols=25  Identities=24%  Similarity=0.595  Sum_probs=20.2

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECS   26 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~Cs   26 (262)
                      +|-.||+.. .-....-|-++|..|-
T Consensus         2 ~Cp~Cg~~~-~~~D~~~g~~vC~~CG   26 (43)
T PF08271_consen    2 KCPNCGSKE-IVFDPERGELVCPNCG   26 (43)
T ss_dssp             SBTTTSSSE-EEEETTTTEEEETTT-
T ss_pred             CCcCCcCCc-eEEcCCCCeEECCCCC
Confidence            599999976 4556788999999994


No 21 
>COG1381 RecO Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=63.40  E-value=3.2  Score=37.87  Aligned_cols=26  Identities=23%  Similarity=0.626  Sum_probs=23.6

Q ss_pred             CCCCCCCCCC-CeeEcccceeEehhhh
Q psy62             1 KCFECNAHNP-QWASVTYGIWICLECS   26 (262)
Q Consensus         1 ~C~DCga~~P-~WaSv~~GifiC~~Cs   26 (262)
                      +|+.||.+.+ ...|+..|-++|.+|+
T Consensus       156 ~Ca~cg~~~~~~~~s~~~~~~~C~~~~  182 (251)
T COG1381         156 SCARCGTPVDPVYFSPKSGGFLCSKCA  182 (251)
T ss_pred             HHhCcCCcCCCcceeeccCcccchhcc
Confidence            5999999865 7999999999999998


No 22 
>PF10764 Gin:  Inhibitor of sigma-G Gin;  InterPro: IPR019700  Gin allows sigma-F to delay late forespore transcription by preventing sigma-G to take over before the cell has reached a critical stage of development. Gin is also known as CsfB []. 
Probab=56.96  E-value=6.4  Score=27.24  Aligned_cols=26  Identities=31%  Similarity=0.841  Sum_probs=19.6

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSG   27 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~Csg   27 (262)
                      +|+=|+.+.+. .=.=+|.|||.+|-.
T Consensus         1 ~CiiC~~~~~~-GI~I~~~fIC~~CE~   26 (46)
T PF10764_consen    1 KCIICGKEKEE-GIHIYGKFICSDCEK   26 (46)
T ss_pred             CeEeCCCcCCC-CEEEECeEehHHHHH
Confidence            58889988776 334478999999943


No 23 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=55.74  E-value=8.2  Score=30.44  Aligned_cols=26  Identities=31%  Similarity=0.775  Sum_probs=20.5

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGK   28 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~Csgv   28 (262)
                      .|-.|+.+  .--=+..|||.|..|--.
T Consensus        37 ~Cp~C~~~--~VkR~a~GIW~C~kCg~~   62 (89)
T COG1997          37 VCPFCGRT--TVKRIATGIWKCRKCGAK   62 (89)
T ss_pred             cCCCCCCc--ceeeeccCeEEcCCCCCe
Confidence            48899987  555678899999999443


No 24 
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=54.10  E-value=8.6  Score=24.90  Aligned_cols=30  Identities=27%  Similarity=0.664  Sum_probs=21.6

Q ss_pred             CCCCCCC-CCCeeEccccee-EehhhhhhhcC
Q psy62             2 CFECNAH-NPQWASVTYGIW-ICLECSGKHRG   31 (262)
Q Consensus         2 C~DCga~-~P~WaSv~~Gif-iC~~CsgvHR~   31 (262)
                      |..|++. .|+|=....|-. ||-.|--.+|.
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk   32 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKK   32 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHH
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHH
Confidence            8899985 699998888888 99999765554


No 25 
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=53.96  E-value=4.1  Score=28.66  Aligned_cols=43  Identities=21%  Similarity=0.546  Sum_probs=26.0

Q ss_pred             CCCCCCCCCCCee--EcccceeEehhhhhhhcCCCCCccceeeccc
Q psy62             1 KCFECNAHNPQWA--SVTYGIWICLECSGKHRGLGVHLSFVRSISM   44 (262)
Q Consensus         1 ~C~DCga~~P~Wa--Sv~~GifiC~~CsgvHR~LGvhiS~VrSitm   44 (262)
                      +|+=||.+-.-.-  -+.=| +||-.|...-.++-.....++.+|+
T Consensus         1 ~C~iCg~kigl~~~~k~~DG-~iC~~C~~Kl~~~~~~~~~~~~~t~   45 (51)
T PF14471_consen    1 KCAICGKKIGLFKRFKIKDG-YICKDCLKKLSGFFSDVKIKKNLTL   45 (51)
T ss_pred             CCCccccccccccceeccCc-cchHHHHHHhcCcccchhhhhhccH
Confidence            5888888755443  34457 8999999765444322233344444


No 26 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=52.36  E-value=4.6  Score=26.41  Aligned_cols=26  Identities=23%  Similarity=0.599  Sum_probs=15.7

Q ss_pred             CCCCCCCC-CCCeeEcccceeEehhhh
Q psy62             1 KCFECNAH-NPQWASVTYGIWICLECS   26 (262)
Q Consensus         1 ~C~DCga~-~P~WaSv~~GifiC~~Cs   26 (262)
                      +|.+|+.+ .-.|..-+|+.-||..|.
T Consensus         5 ~C~eC~~~f~dSyL~~~F~~~VCD~CR   31 (34)
T PF01286_consen    5 KCDECGKPFMDSYLLNNFDLPVCDKCR   31 (34)
T ss_dssp             E-TTT--EES-SSCCCCTS-S--TTT-
T ss_pred             hHhHhCCHHHHHHHHHhCCcccccccc
Confidence            49999985 458999999999999994


No 27 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=47.06  E-value=14  Score=24.20  Aligned_cols=21  Identities=29%  Similarity=0.888  Sum_probs=18.8

Q ss_pred             CCCCCCCCCCeeEcccceeEehhh
Q psy62             2 CFECNAHNPQWASVTYGIWICLEC   25 (262)
Q Consensus         2 C~DCga~~P~WaSv~~GifiC~~C   25 (262)
                      |..|++.   |....=|-++|.+|
T Consensus        11 C~~C~~~---~~~~~dG~~yC~~c   31 (36)
T PF11781_consen   11 CPVCGSR---WFYSDDGFYYCDRC   31 (36)
T ss_pred             CCCCCCe---EeEccCCEEEhhhC
Confidence            8888887   88889999999998


No 28 
>PRK12495 hypothetical protein; Provisional
Probab=40.44  E-value=14  Score=33.79  Aligned_cols=24  Identities=25%  Similarity=0.451  Sum_probs=19.3

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGK   28 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~Csgv   28 (262)
                      .|.+||.|=|.   + -|+-+|..|..+
T Consensus        44 hC~~CG~PIpa---~-pG~~~Cp~CQ~~   67 (226)
T PRK12495         44 HCDECGDPIFR---H-DGQEFCPTCQQP   67 (226)
T ss_pred             hcccccCcccC---C-CCeeECCCCCCc
Confidence            49999999982   2 599999999643


No 29 
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=37.18  E-value=26  Score=24.53  Aligned_cols=34  Identities=24%  Similarity=0.535  Sum_probs=26.8

Q ss_pred             CCCCCCCC-CCCeeEcccce-eEehhhhhhhcCCCC
Q psy62             1 KCFECNAH-NPQWASVTYGI-WICLECSGKHRGLGV   34 (262)
Q Consensus         1 ~C~DCga~-~P~WaSv~~Gi-fiC~~CsgvHR~LGv   34 (262)
                      .|..|+.. .|+|=.-..|- +||-.|--..+..+.
T Consensus         5 ~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~   40 (52)
T smart00401        5 SCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGG   40 (52)
T ss_pred             CcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCC
Confidence            59999985 58998888886 999999776665444


No 30 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=34.31  E-value=26  Score=23.45  Aligned_cols=16  Identities=25%  Similarity=0.742  Sum_probs=11.0

Q ss_pred             CCCCCCCCCCCeeEcc
Q psy62             1 KCFECNAHNPQWASVT   16 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~   16 (262)
                      +|.+|+..+.-|+++.
T Consensus         1 ~C~~C~~~~~l~~CL~   16 (50)
T smart00290        1 RCSVCGTIENLWLCLT   16 (50)
T ss_pred             CcccCCCcCCeEEecC
Confidence            6999998775454444


No 31 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=34.23  E-value=5.5  Score=25.62  Aligned_cols=29  Identities=24%  Similarity=0.631  Sum_probs=15.4

Q ss_pred             CCCCCCCCCCC-eeEcccceeEehhhhhhh
Q psy62             1 KCFECNAHNPQ-WASVTYGIWICLECSGKH   29 (262)
Q Consensus         1 ~C~DCga~~P~-WaSv~~GifiC~~CsgvH   29 (262)
                      .|.+||.+=|. =.-+--+..+|.+|+..|
T Consensus         5 ~C~~CGe~I~~~Rl~~~p~~~~C~~C~~~~   34 (36)
T PF01258_consen    5 ICEDCGEPIPEERLVAVPGATLCVECQERR   34 (36)
T ss_dssp             B-TTTSSBEEHHHHHHCTTECS-HHHHHHH
T ss_pred             CccccCChHHHHHHHhCCCcEECHHHhCcc
Confidence            37888875331 111222677899998764


No 32 
>COG2158 Uncharacterized protein containing a Zn-finger-like domain [General function prediction only]
Probab=33.94  E-value=26  Score=28.66  Aligned_cols=31  Identities=32%  Similarity=0.766  Sum_probs=25.9

Q ss_pred             CCCCCCCCCCeeEcccc--eeEehhhhhhhcCCCC
Q psy62             2 CFECNAHNPQWASVTYG--IWICLECSGKHRGLGV   34 (262)
Q Consensus         2 C~DCga~~P~WaSv~~G--ifiC~~CsgvHR~LGv   34 (262)
                      |.||+--  .|++-.-|  |+-|.+|-=+||.-++
T Consensus        45 c~~~~~g--ewi~~~~G~~VwSC~dC~~iH~ke~~   77 (112)
T COG2158          45 CENEELG--EWISDSNGRKVWSCSDCHWIHRKEGA   77 (112)
T ss_pred             ccccccC--ceeEcCCCCEEeeccccceecccchH
Confidence            5666655  89999999  9999999999997655


No 33 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=33.46  E-value=25  Score=25.25  Aligned_cols=23  Identities=22%  Similarity=0.676  Sum_probs=19.2

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLEC   25 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~C   25 (262)
                      .|..||.....  ..+--+|.|..|
T Consensus        30 ~C~~CG~~~~~--~~~~r~~~C~~C   52 (69)
T PF07282_consen   30 TCPRCGHRNKK--RRSGRVFTCPNC   52 (69)
T ss_pred             CccCccccccc--ccccceEEcCCC
Confidence            48889988777  777889999998


No 34 
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=32.42  E-value=25  Score=27.22  Aligned_cols=32  Identities=22%  Similarity=0.548  Sum_probs=23.5

Q ss_pred             CCCCCCCCCCC---eeEcccc---eeEehhhhhhhcCC
Q psy62             1 KCFECNAHNPQ---WASVTYG---IWICLECSGKHRGL   32 (262)
Q Consensus         1 ~C~DCga~~P~---WaSv~~G---ifiC~~CsgvHR~L   32 (262)
                      .|+-||.+-|.   +...--|   .|-|..|.+|+..|
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~~~FCC~GC~~V~~~i   39 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEERPFCCPGCQAVYQLI   39 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCccccccHHHHHHHHHH
Confidence            59999998873   3333334   89999999998653


No 35 
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=30.78  E-value=33  Score=27.16  Aligned_cols=25  Identities=36%  Similarity=0.821  Sum_probs=19.1

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSG   27 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~Csg   27 (262)
                      .|.-||........+  |||-|..|--
T Consensus        38 ~CpfCgk~~vkR~a~--GIW~C~~C~~   62 (90)
T PTZ00255         38 FCPFCGKHAVKRQAV--GIWRCKGCKK   62 (90)
T ss_pred             cCCCCCCCceeeeee--EEEEcCCCCC
Confidence            488899777665544  9999999943


No 36 
>PF10310 DUF2413:  Protein of unknown function (DUF2413);  InterPro: IPR018814  This entry represents a family of proteins conserved in fungi. Their function is not known. 
Probab=30.72  E-value=31  Score=34.57  Aligned_cols=30  Identities=20%  Similarity=0.190  Sum_probs=21.4

Q ss_pred             cccchhhhhhhhh--hHHHHHHHHHHHHHhhh
Q psy62           195 LFGGAVSSLTSGW--SMFSSSATKLASKATEN  224 (262)
Q Consensus       195 ~~~~~~~~l~~Gw--~~fs~~~~k~a~~~~e~  224 (262)
                      -..+|.++++.||  |.++++|+++++++.+.
T Consensus       117 ~~~~p~~s~ggwWsWGs~~stAss~~~~a~kq  148 (444)
T PF10310_consen  117 EEPDPIASSGGWWSWGSIWSTASSAAEQAMKQ  148 (444)
T ss_pred             CCCCcccccCCcccccchhhHHHHHHHHHHHH
Confidence            4577788888887  68888888666555443


No 37 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=30.69  E-value=33  Score=32.22  Aligned_cols=28  Identities=21%  Similarity=0.439  Sum_probs=20.1

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKH   29 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvH   29 (262)
                      +|.+||..+. =....-|-.||.+|--|.
T Consensus        13 ~Cp~Cg~~~i-v~d~~~Ge~vC~~CG~Vl   40 (310)
T PRK00423         13 VCPECGSDKL-IYDYERGEIVCADCGLVI   40 (310)
T ss_pred             cCcCCCCCCe-eEECCCCeEeecccCCcc
Confidence            5999997432 223567999999996643


No 38 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=30.64  E-value=22  Score=24.24  Aligned_cols=22  Identities=32%  Similarity=0.597  Sum_probs=16.5

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLEC   25 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~C   25 (262)
                      +|.+||......   .....-|.+|
T Consensus         4 ~C~~Cg~~~~~~---~~~~irC~~C   25 (44)
T smart00659        4 ICGECGRENEIK---SKDVVRCREC   25 (44)
T ss_pred             ECCCCCCEeecC---CCCceECCCC
Confidence            599999965433   4577889999


No 39 
>PF14376 Haem_bd:  Haem-binding domain
Probab=30.00  E-value=24  Score=29.39  Aligned_cols=38  Identities=16%  Similarity=0.671  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCCee---EcccceeEehhhhhhhcCCCCCccc-eeecccCCCC
Q psy62             1 KCFECNAHNPQWA---SVTYGIWICLECSGKHRGLGVHLSF-VRSISMDKWK   48 (262)
Q Consensus         1 ~C~DCga~~P~Wa---Sv~~GifiC~~CsgvHR~LGvhiS~-VrSitmD~W~   48 (262)
                      .|.||++.+..|.   .+.-..+          -+..||.. .|.+.++.|.
T Consensus        43 ~CydCHSn~T~~PwYa~i~p~s~----------l~~~dI~~Gr~~lNfs~~~   84 (137)
T PF14376_consen   43 SCYDCHSNNTRYPWYANIAPASW----------LMEKDIKEGRRHLNFSEWG   84 (137)
T ss_pred             cccccCCCCCCCccceecCchHH----------HHHHHHHHHHHHhCcchhh
Confidence            4999999886665   3322222          12224332 4677778874


No 40 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=29.95  E-value=26  Score=22.22  Aligned_cols=24  Identities=25%  Similarity=0.641  Sum_probs=12.3

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSG   27 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~Csg   27 (262)
                      +|--|++... |  ..-.+|||.+|..
T Consensus         4 ~Cp~C~se~~-y--~D~~~~vCp~C~~   27 (30)
T PF08274_consen    4 KCPLCGSEYT-Y--EDGELLVCPECGH   27 (30)
T ss_dssp             --TTT------E--E-SSSEEETTTTE
T ss_pred             CCCCCCCcce-e--ccCCEEeCCcccc
Confidence            4777777654 3  5667999999953


No 41 
>PTZ00074 60S ribosomal protein L34; Provisional
Probab=25.33  E-value=37  Score=28.77  Aligned_cols=26  Identities=35%  Similarity=0.726  Sum_probs=18.2

Q ss_pred             CCCCCCCCC-------C----------CeeEcccceeEehhhh
Q psy62             1 KCFECNAHN-------P----------QWASVTYGIWICLECS   26 (262)
Q Consensus         1 ~C~DCga~~-------P----------~WaSv~~GifiC~~Cs   26 (262)
                      +|.|||.+-       |          .-++=.||-.+|..|-
T Consensus        43 kC~~cg~~L~GI~~~Rp~e~~rlsK~~KtvsRaYGG~lC~~CV   85 (135)
T PTZ00074         43 KCGDCGKVLAGIKALRPTEYKQLSRRERTVSRAYGGVLCHKCV   85 (135)
T ss_pred             CCCCCCCccCCccCCchHHHHHccccCCCccCCCccchhHHHH
Confidence            599999752       1          1245678888998884


No 42 
>cd07162 NR_DBD_PXR DNA-binding domain of pregnane X receptor (PXRs) is composed of two C4-type zinc fingers. DNA-binding domain (DBD)of pregnane X receptor (PXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PXR DBD interacts with the PXR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The pregnane X receptor (PXR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. PXR functions as a heterodimer with retinoic X receptor-alpha (RXRa) and binds to a variety of promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. Like other nuclear receptors, PXR has a central well conserved DNA-binding
Probab=24.58  E-value=49  Score=25.45  Aligned_cols=27  Identities=22%  Similarity=0.549  Sum_probs=21.7

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhc
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHR   30 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR   30 (262)
                      .|.=||.+...   ..||++.|..|++..|
T Consensus         1 ~C~VCg~~~~g---~hygv~sC~aC~~FFR   27 (87)
T cd07162           1 ICRVCGDRATG---YHFNAMTCEGCKGFFR   27 (87)
T ss_pred             CCcccCCcCcc---eEECcceehhhHHHHH
Confidence            47778876554   4899999999999876


No 43 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=23.71  E-value=38  Score=21.96  Aligned_cols=27  Identities=19%  Similarity=0.390  Sum_probs=13.8

Q ss_pred             CCCCCCCCCCeeEc---ccceeEehhhhhhh
Q psy62             2 CFECNAHNPQWASV---TYGIWICLECSGKH   29 (262)
Q Consensus         2 C~DCga~~P~WaSv---~~GifiC~~CsgvH   29 (262)
                      |-.||.+ -++.-+   +.--++|..|.-||
T Consensus         3 C~~CG~~-l~~~ip~gd~r~R~vC~~Cg~Ih   32 (34)
T PF14803_consen    3 CPQCGGP-LERRIPEGDDRERLVCPACGFIH   32 (34)
T ss_dssp             -TTT--B--EEE--TT-SS-EEEETTTTEEE
T ss_pred             cccccCh-hhhhcCCCCCccceECCCCCCEE
Confidence            6778876 233322   44567899998877


No 44 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=23.00  E-value=40  Score=38.02  Aligned_cols=28  Identities=21%  Similarity=0.247  Sum_probs=14.3

Q ss_pred             hhhccHHHHHHHHHHhcccCCCCcccCC
Q psy62            81 QKYNTKAAALYRDKVSSSYMFNTFTTKG  108 (262)
Q Consensus        81 ~KY~~~aa~~yr~kl~~~~~gr~~~~~~  108 (262)
                      .+|--+++.+.-+.|..-|-=.+|+.-+
T Consensus       844 a~yl~~va~fiDdLL~k~Ygl~~fYn~~  871 (1337)
T PRK14714        844 AEYLLKVAKFVDDLLEKFYGLPRFYNVE  871 (1337)
T ss_pred             HHHHHHHHHHHHHHHHHhhCCCcccCCC
Confidence            3555555555555555555544555433


No 45 
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=22.88  E-value=52  Score=26.03  Aligned_cols=24  Identities=33%  Similarity=0.845  Sum_probs=18.6

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECS   26 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~Cs   26 (262)
                      .|.-||....  --+..|||-|..|-
T Consensus        37 ~Cp~Cgk~~v--kR~a~GIW~C~~C~   60 (90)
T PF01780_consen   37 TCPFCGKTSV--KRVATGIWKCKKCG   60 (90)
T ss_dssp             EESSSSSSEE--EEEETTEEEETTTT
T ss_pred             cCCCCCCcee--EEeeeEEeecCCCC
Confidence            3888988763  44577999999994


No 46 
>cd07156 NR_DBD_VDR_like The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. The DNA-binding domain of vitamin D receptors (VDR) like nuclear receptor family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. This domain interacts with specific DNA site upstream of the target gene and modulates the rate of transcriptional initiation. This family includes three types of nuclear receptors: vitamin D receptors (VDR), constitutive androstane receptor (CAR) and pregnane X receptor (PXR). VDR regulates calcium metabolism, cellular proliferation and differentiation.  PXR and CAR function as sensors of toxic byproducts of cell metabolism and of exogenous chemicals, to facilitate their elimination. The DNA binding activity is regulated by their corresponding ligands. VDR is activated by Vitamin D; CAR and PXR respond to a diverse array of chemi
Probab=22.73  E-value=54  Score=24.21  Aligned_cols=27  Identities=22%  Similarity=0.538  Sum_probs=20.5

Q ss_pred             CCCCCCCCCCeeEcccceeEehhhhhhhcC
Q psy62             2 CFECNAHNPQWASVTYGIWICLECSGKHRG   31 (262)
Q Consensus         2 C~DCga~~P~WaSv~~GifiC~~CsgvHR~   31 (262)
                      |.=||.+.-.   ..||++.|..|.+..|-
T Consensus         1 C~VC~~~~~g---~hygv~sC~aC~~FFRR   27 (72)
T cd07156           1 CGVCGDRATG---YHFNAMTCEGCKGFFRR   27 (72)
T ss_pred             CCccCccCcc---cEECcceehhhhhhhch
Confidence            5557765543   58999999999998773


No 47 
>cd07170 NR_DBD_ERR DNA-binding domain of estrogen related receptors (ERR) is composed of two C4-type zinc fingers. DNA-binding domain of estrogen related receptors (ERRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. ERR interacts with the palindromic inverted repeat, 5'GGTCAnnnTGACC-3', upstream of the target gene and modulates the rate of transcriptional initiation. The estrogen receptor-related receptors (ERRs) are transcriptional regulators, which are closely related to the estrogen receptor (ER) family.  Although ERRs lack the ability to bind to estrogen and are so-called orphan receptors, they share target genes, co-regulators and promoters with the estrogen receptor (ER) family. By targeting the same set of genes, ERRs seem to interfere with the classic ER-mediated estrogen response in various ways. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription 
Probab=22.47  E-value=45  Score=26.37  Aligned_cols=27  Identities=22%  Similarity=0.620  Sum_probs=21.4

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhc
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHR   30 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR   30 (262)
                      .|.=||.+.-   ...||++.|..|.+..|
T Consensus         6 ~C~VCg~~a~---g~hyGv~sC~aCk~FFR   32 (97)
T cd07170           6 LCLVCGDIAS---GYHYGVASCEACKAFFK   32 (97)
T ss_pred             CCeecCCcCc---ceEECceeehhhhHHHH
Confidence            3677887553   45899999999999877


No 48 
>smart00399 ZnF_C4 c4 zinc finger in nuclear hormone receptors.
Probab=22.11  E-value=48  Score=24.16  Aligned_cols=27  Identities=26%  Similarity=0.732  Sum_probs=21.0

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhc
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHR   30 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR   30 (262)
                      .|.-||.+.-   ...||++.|..|.+..|
T Consensus         1 ~C~vC~~~~~---~~hygv~~C~aC~~FFR   27 (70)
T smart00399        1 LCCVCGDHAS---GFHFGVCSCRACKAFFR   27 (70)
T ss_pred             CCeEeCCcCc---ccEeCCcEechhhhhhh
Confidence            3667876654   34899999999999876


No 49 
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=21.35  E-value=47  Score=26.03  Aligned_cols=28  Identities=18%  Similarity=0.421  Sum_probs=21.5

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcC
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRG   31 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~   31 (262)
                      .|.=||.+.-   ...||++.|..|.+..|-
T Consensus         2 ~C~VCg~~a~---g~hyGv~sC~aC~~FFRR   29 (94)
T cd06966           2 ICGVCGDKAL---GYNFNAITCESCKAFFRR   29 (94)
T ss_pred             CCeeCCCcCc---ceEECcceeeeehheehh
Confidence            3677886543   458999999999998763


No 50 
>PHA02540 61 DNA primase; Provisional
Probab=21.32  E-value=56  Score=31.55  Aligned_cols=56  Identities=21%  Similarity=0.551  Sum_probs=40.9

Q ss_pred             CCCCCCCCCC------CeeEcccc--eeEehhhhhhhcCCCCCccceeecccCCCCHHHHHhhhcCCh
Q psy62             1 KCFECNAHNP------QWASVTYG--IWICLECSGKHRGLGVHLSFVRSISMDKWKDIELEKMKVGGN   60 (262)
Q Consensus         1 ~C~DCga~~P------~WaSv~~G--ifiC~~CsgvHR~LGvhiS~VrSitmD~W~~~el~~m~~gGN   60 (262)
                      +|.=|+...+      =|++..-+  +|-|..| |.|   |--|.||....-..|.+.--++.+..|+
T Consensus        29 ~CPf~~ds~~~~~kpsF~V~p~k~~~~yhCFgC-Ga~---Gd~i~Flme~e~lsf~Eav~~la~~~g~   92 (337)
T PHA02540         29 RCPICGDSQKDKNKARGWIYEKKDGGVFKCHNC-GYH---RPFGNFLKDYEPDLYREYIMERFKERGT   92 (337)
T ss_pred             cCCCCCCccccCcCCcEEEeccCCceEEEecCC-CCC---CCHHHHHHHhcCCChHHHHHHHHHHhCC
Confidence            4777887554      48888888  9999999 555   4557788887777787765556666664


No 51 
>cd07165 NR_DBD_DmE78_like DNA-binding domain of Drosophila ecdysone-induced protein 78 (E78) like is composed of two C4-type zinc fingers. DNA-binding domain of proteins similar to Drosophila ecdysone-induced protein 78 (E78) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which coordinates a single zinc atom. E78 interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation. Drosophila ecdysone-induced protein 78 (E78) is a transcription factor belonging to the nuclear receptor superfamily.  E78 is a product of the ecdysone-inducible gene found in an early late puff locus at position 78C during the onset of Drosophila metamorphosis. An E78 orthologue from the Platyhelminth Schistosoma mansoni (SmE78) has also been identified. It is the first E78 orthologue known outside of the molting animals--the Ecdysozoa. The SmE78 may be involved in transduction of an ecdysone signal in S. mansoni,
Probab=21.14  E-value=49  Score=25.08  Aligned_cols=27  Identities=30%  Similarity=0.694  Sum_probs=20.9

Q ss_pred             CCCCCCCCCCeeEcccceeEehhhhhhhcC
Q psy62             2 CFECNAHNPQWASVTYGIWICLECSGKHRG   31 (262)
Q Consensus         2 C~DCga~~P~WaSv~~GifiC~~CsgvHR~   31 (262)
                      |.=||.+.-   ...||++.|..|....|-
T Consensus         1 C~VCg~~~~---g~hyG~~sC~aC~~FFRR   27 (81)
T cd07165           1 CKVCGDKAS---GYHYGVTSCEGCKGFFRR   27 (81)
T ss_pred             CCccCccCc---ceEECchhhhhHHHHHHh
Confidence            556776553   458999999999998773


No 52 
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=21.11  E-value=40  Score=20.57  Aligned_cols=27  Identities=19%  Similarity=0.409  Sum_probs=15.0

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhh
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSG   27 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~Csg   27 (262)
                      +|.-|+..-+.=.--....++|..|..
T Consensus         3 ~C~rC~~~~~~~~~~~r~~~~C~rCq~   29 (30)
T PF06827_consen    3 KCPRCWNYIEDIGINGRSTYLCPRCQK   29 (30)
T ss_dssp             B-TTT--BBEEEEETTEEEEE-TTTCC
T ss_pred             cCccCCCcceEeEecCCCCeECcCCcC
Confidence            366677665554455667889988864


No 53 
>cd07157 2DBD_NR_DBD1 The first DNA-binding domain (DBD) of the 2DBD nuclear receptors is composed of two C4-type zinc fingers. The first DNA-binding domain (DBD) of the 2DBD nuclear receptors(NRs) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. NRs interact with specific DNA sites upstream of the target gene and modulate the rate of transcriptional initiation. Theses proteins contain two DBDs in tandem, probably resulted from an ancient recombination event. The 2DBD-NRs are found only in flatworm species, mollusks and arthropods.  Their biological function is unknown.
Probab=20.99  E-value=47  Score=25.58  Aligned_cols=28  Identities=18%  Similarity=0.501  Sum_probs=21.9

Q ss_pred             CCCCCCCCCCCeeEcccceeEehhhhhhhcC
Q psy62             1 KCFECNAHNPQWASVTYGIWICLECSGKHRG   31 (262)
Q Consensus         1 ~C~DCga~~P~WaSv~~GifiC~~CsgvHR~   31 (262)
                      .|.=||.+.-   ...||++.|..|.+..|-
T Consensus         2 ~C~VCg~~a~---g~hyGv~sC~aCk~FFRR   29 (86)
T cd07157           2 TCQVCGEPAA---GFHHGAYVCEACKKFFMR   29 (86)
T ss_pred             CCcccCCcCc---ccEECcceeeEeeeEEec
Confidence            3777887553   469999999999998763


No 54 
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=20.41  E-value=59  Score=22.96  Aligned_cols=34  Identities=26%  Similarity=0.599  Sum_probs=26.3

Q ss_pred             CCCCCCCC-CCCeeEcc-cceeEehhhhhhhcCCCC
Q psy62             1 KCFECNAH-NPQWASVT-YGIWICLECSGKHRGLGV   34 (262)
Q Consensus         1 ~C~DCga~-~P~WaSv~-~GifiC~~CsgvHR~LGv   34 (262)
                      .|..|+.. -|+|=.-. -+..||-.|--..+..|.
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~~   36 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHGV   36 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcCC
Confidence            59999985 58998755 788999999766666553


Done!