BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6200
(112 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1QF6|A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed
With Its Cognate Trna
Length = 642
Score = 26.6 bits (57), Expect = 3.8, Method: Composition-based stats.
Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 5/55 (9%)
Query: 6 IFQENECF-QSVLKSSQRKLLKASRDKSFLLDRLLEYEKPVWSDSSDGEATESSD 59
IF+E E F +S LK Q + +K F++DR+L + W + D T SS+
Sbjct: 273 IFRELEVFVRSKLKEYQYQEVKGP----FMMDRVLWEKTGHWDNYKDAMFTTSSE 323
>pdb|1EVK|A Chain A, Crystal Structure Of A Truncated Form Of Threonyl-Trna
Synthetase With The Ligand Threonine
pdb|1EVK|B Chain B, Crystal Structure Of A Truncated Form Of Threonyl-Trna
Synthetase With The Ligand Threonine
pdb|1EVL|A Chain A, Crystal Structure Of A Truncated Form Of Threonyl-Trna
Synthetase With A Threonyl Adenylate Analog
pdb|1EVL|B Chain B, Crystal Structure Of A Truncated Form Of Threonyl-Trna
Synthetase With A Threonyl Adenylate Analog
pdb|1EVL|C Chain C, Crystal Structure Of A Truncated Form Of Threonyl-Trna
Synthetase With A Threonyl Adenylate Analog
pdb|1EVL|D Chain D, Crystal Structure Of A Truncated Form Of Threonyl-Trna
Synthetase With A Threonyl Adenylate Analog
pdb|1FYF|A Chain A, Crystal Structure Of A Truncated Form Of Threonyl-Trna
Synthetase Complexed With A Seryl Adenylate Analog
pdb|1FYF|B Chain B, Crystal Structure Of A Truncated Form Of Threonyl-Trna
Synthetase Complexed With A Seryl Adenylate Analog
pdb|1KOG|A Chain A, Crystal Structure Of E. Coli Threonyl-Trna Synthetase
Interacting With The Essential Domain Of Its Mrna
Operator
pdb|1KOG|B Chain B, Crystal Structure Of E. Coli Threonyl-Trna Synthetase
Interacting With The Essential Domain Of Its Mrna
Operator
pdb|1KOG|C Chain C, Crystal Structure Of E. Coli Threonyl-Trna Synthetase
Interacting With The Essential Domain Of Its Mrna
Operator
pdb|1KOG|D Chain D, Crystal Structure Of E. Coli Threonyl-Trna Synthetase
Interacting With The Essential Domain Of Its Mrna
Operator
pdb|1KOG|E Chain E, Crystal Structure Of E. Coli Threonyl-Trna Synthetase
Interacting With The Essential Domain Of Its Mrna
Operator
pdb|1KOG|F Chain F, Crystal Structure Of E. Coli Threonyl-Trna Synthetase
Interacting With The Essential Domain Of Its Mrna
Operator
pdb|1KOG|G Chain G, Crystal Structure Of E. Coli Threonyl-Trna Synthetase
Interacting With The Essential Domain Of Its Mrna
Operator
pdb|1KOG|H Chain H, Crystal Structure Of E. Coli Threonyl-Trna Synthetase
Interacting With The Essential Domain Of Its Mrna
Operator
Length = 401
Score = 26.2 bits (56), Expect = 4.7, Method: Composition-based stats.
Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 5/55 (9%)
Query: 6 IFQENECF-QSVLKSSQRKLLKASRDKSFLLDRLLEYEKPVWSDSSDGEATESSD 59
IF+E E F +S LK Q + +K F++DR+L + W + D T SS+
Sbjct: 32 IFRELEVFVRSKLKEYQYQEVKGP----FMMDRVLWEKTGHWDNYKDAMFTTSSE 82
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.132 0.403
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,463,572
Number of Sequences: 62578
Number of extensions: 126091
Number of successful extensions: 297
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 297
Number of HSP's gapped (non-prelim): 2
length of query: 112
length of database: 14,973,337
effective HSP length: 76
effective length of query: 36
effective length of database: 10,217,409
effective search space: 367826724
effective search space used: 367826724
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)