Query         psy6200
Match_columns 112
No_of_seqs    26 out of 28
Neff          2.2 
Searched_HMMs 46136
Date          Fri Aug 16 20:18:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6200.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6200hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF10588 NADH-G_4Fe-4S_3:  NADH  64.5       3 6.5E-05   25.1   0.6   15   71-85      8-22  (41)
  2 PF13465 zf-H2C2_2:  Zinc-finge  48.1     5.8 0.00012   21.4  -0.1   13   74-86     12-24  (26)
  3 PF15186 TEX13:  Testis-express  45.3      31 0.00067   27.0   3.5   32   12-43    121-152 (152)
  4 PF06353 DUF1062:  Protein of u  44.6       9  0.0002   28.8   0.5   18   77-94     14-31  (142)
  5 PF13912 zf-C2H2_6:  C2H2-type   42.0       8 0.00017   20.0  -0.1   11   76-86      1-11  (27)
  6 COG1034 NuoG NADH dehydrogenas  41.4      13 0.00028   34.3   1.1   17   69-85     88-104 (693)
  7 PF09237 GAGA:  GAGA factor;  I  34.6      14 0.00031   24.6   0.2   13   72-84     20-32  (54)
  8 PHA00097 K protein K            33.1      42 0.00091   22.5   2.2   22    5-26     23-44  (56)
  9 PF04967 HTH_10:  HTH DNA bindi  30.0      44 0.00095   21.3   1.9   15   12-26     39-53  (53)
 10 PF11500 Cut12:  Spindle pole b  29.2      45 0.00097   25.7   2.1   14   74-89     61-74  (152)
 11 PF12283 Protein_K:  Bacterioph  28.3      60  0.0013   21.8   2.3   22    5-26     23-44  (56)
 12 PF00301 Rubredoxin:  Rubredoxi  28.0      49  0.0011   20.7   1.8   20   65-87     26-45  (47)
 13 PF14728 PHTB1_C:  PTHB1 C-term  26.7      87  0.0019   26.6   3.6   22   10-31    223-244 (377)
 14 PF14120 YhzD:  YhzD-like prote  25.5      16 0.00035   24.8  -0.8   28   55-82     22-52  (61)
 15 PF13719 zinc_ribbon_5:  zinc-r  24.9      28  0.0006   20.3   0.3   19   69-87     18-36  (37)
 16 PF07111 HCR:  Alpha helical co  24.8   2E+02  0.0044   27.5   5.8   33    9-41    633-665 (739)
 17 PF13695 zf-3CxxC:  Zinc-bindin  24.3      36 0.00078   23.2   0.8   14   77-90      6-19  (98)
 18 PF07818 HCNGP:  HCNGP-like pro  24.1      83  0.0018   22.0   2.5   20    7-26     71-90  (96)
 19 PF08614 ATG16:  Autophagy prot  23.5 1.7E+02  0.0036   21.9   4.2   31   11-41    154-184 (194)
 20 smart00355 ZnF_C2H2 zinc finge  23.2      41 0.00088   15.8   0.6   11   77-87      1-11  (26)
 21 PF14353 CpXC:  CpXC protein     22.7      42 0.00091   23.2   0.9   14   75-88     37-50  (128)
 22 PF13945 NST1:  Salt tolerance   21.9      29 0.00062   27.5  -0.1   15   73-87    138-152 (190)
 23 PF14803 Nudix_N_2:  Nudix N-te  21.8      44 0.00095   19.7   0.7   18   79-96      3-20  (34)
 24 PRK07569 bidirectional hydroge  21.6 1.7E+02  0.0037   22.4   4.0   65   14-85     78-154 (234)
 25 KOG4102|consensus               21.5 1.6E+02  0.0034   22.4   3.7   30   79-108    90-119 (121)
 26 PF12269 zf-CpG_bind_C:  CpG bi  21.4 2.4E+02  0.0051   23.2   5.0   35   14-48     35-69  (236)
 27 PF06970 RepA_N:  Replication i  21.3      51  0.0011   22.1   1.0   25    5-29     50-74  (76)
 28 TIGR01973 NuoG NADH-quinone ox  20.8      49  0.0011   28.5   1.1   17   69-85     86-102 (603)
 29 PF00096 zf-C2H2:  Zinc finger,  20.8      29 0.00062   17.2  -0.2   11   77-87      1-11  (23)
 30 PF13894 zf-C2H2_4:  C2H2-type   20.4      33 0.00071   16.2  -0.0   12   77-88      1-12  (24)
 31 PF09538 FYDLN_acid:  Protein o  20.2 1.1E+02  0.0023   22.0   2.5   19   72-90     22-40  (108)
 32 cd00730 rubredoxin Rubredoxin;  20.0      67  0.0015   20.3   1.3   19   67-88     28-46  (50)

No 1  
>PF10588 NADH-G_4Fe-4S_3:  NADH-ubiquinone oxidoreductase-G iron-sulfur binding region;  InterPro: IPR019574  NADH:ubiquinone oxidoreductase (complex I) (1.6.5.3 from EC) is a respiratory-chain enzyme that catalyses the transfer of two electrons from NADH to ubiquinone in a reaction that is associated with proton translocation across the membrane (NADH + ubiquinone = NAD+ + ubiquinol) []. Complex I is a major source of reactive oxygen species (ROS) that are predominantly formed by electron transfer from FMNH(2). Complex I is found in bacteria, cyanobacteria (as a NADH-plastoquinone oxidoreductase), archaea [], mitochondira, and in the hydrogenosome, a mitochondria-derived organelle. In general, the bacterial complex consists of 14 different subunits, while the mitochondrial complex contains homologues to these subunits in addition to approximately 31 additional proteins []. Mitochondrial complex I, which is located in the inner mitochondrial membrane, is the largest multimeric respiratory enzyme in the mitochondria, consisting of more than 40 subunits, one FMN co-factor and eight FeS clusters []. The assembly of mitochondrial complex I is an intricate process that requires the cooperation of the nuclear and mitochondrial genomes [, ]. Mitochondrial complex I can cycle between active and deactive forms that can be distinguished by the reactivity towards divalent cations and thiol-reactive agents. All redox prosthetic groups reside in the peripheral arm of the L-shaped structure. The NADH oxidation domain harbouring the FMN cofactor is connected via a chain of iron-sulphur clusters to the ubiquinone reduction site that is located in a large pocket formed by the PSST and 49kDa subunits of complex I []. This entry describes the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This family does not contain related subunits from formate dehydrogenase complexes.  This entry represents the iron-sulphur binding domain of the G subunit.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3M9S_C 2FUG_L 3IAS_L 2YBB_3 3IAM_3 3I9V_3.
Probab=64.52  E-value=3  Score=25.06  Aligned_cols=15  Identities=33%  Similarity=0.924  Sum_probs=7.5

Q ss_pred             cccCCCcccccCCCc
Q psy6200          71 FIQNHPHRCLQCGTS   85 (112)
Q Consensus        71 ~~~n~~h~~~~~~~~   85 (112)
                      -..||||-|..|.++
T Consensus         8 ll~~H~~dC~~C~~~   22 (41)
T PF10588_consen    8 LLANHPLDCPTCDKN   22 (41)
T ss_dssp             HHTT----TTT-TTG
T ss_pred             HHhCCCCcCcCCCCC
Confidence            357999999999864


No 2  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=48.07  E-value=5.8  Score=21.36  Aligned_cols=13  Identities=38%  Similarity=1.053  Sum_probs=10.1

Q ss_pred             CCCcccccCCCcc
Q psy6200          74 NHPHRCLQCGTSW   86 (112)
Q Consensus        74 n~~h~~~~~~~~~   86 (112)
                      .-||.|..||.+-
T Consensus        12 ~k~~~C~~C~k~F   24 (26)
T PF13465_consen   12 EKPYKCPYCGKSF   24 (26)
T ss_dssp             SSSEEESSSSEEE
T ss_pred             CCCCCCCCCcCee
Confidence            4579999999753


No 3  
>PF15186 TEX13:  Testis-expressed sequence 13 protein family
Probab=45.30  E-value=31  Score=26.98  Aligned_cols=32  Identities=22%  Similarity=0.206  Sum_probs=28.4

Q ss_pred             HHHHHHHHHHHHHHHHhhchhHHHHHHhhhcC
Q psy6200          12 CFQSVLKSSQRKLLKASRDKSFLLDRLLEYEK   43 (112)
Q Consensus        12 cfq~eLR~aQrKLLkvsRDKsFLLDRLLqYE~   43 (112)
                      --.-+|+-+|-.|-+|-+++..|--|||+.|.
T Consensus       121 eaa~qL~~~~a~L~~v~~ERD~Lr~kLlqae~  152 (152)
T PF15186_consen  121 EAAFQLQLTQAALQEVQKERDLLRWKLLQAEL  152 (152)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcC
Confidence            45567899999999999999999999999873


No 4  
>PF06353 DUF1062:  Protein of unknown function (DUF1062);  InterPro: IPR009412 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=44.56  E-value=9  Score=28.75  Aligned_cols=18  Identities=22%  Similarity=0.488  Sum_probs=13.7

Q ss_pred             cccccCCCcccccCCCCC
Q psy6200          77 HRCLQCGTSWANKGPTGT   94 (112)
Q Consensus        77 h~~~~~~~~~~~~~~~~t   94 (112)
                      +||..||+.|.+--=.++
T Consensus        14 YrC~~C~~TwN~ti~eR~   31 (142)
T PF06353_consen   14 YRCEKCDYTWNMTIFERV   31 (142)
T ss_pred             EEcccCcCccccceEeec
Confidence            689999999987544433


No 5  
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=42.04  E-value=8  Score=20.02  Aligned_cols=11  Identities=36%  Similarity=1.223  Sum_probs=8.8

Q ss_pred             CcccccCCCcc
Q psy6200          76 PHRCLQCGTSW   86 (112)
Q Consensus        76 ~h~~~~~~~~~   86 (112)
                      ||+|..|+..-
T Consensus         1 ~~~C~~C~~~F   11 (27)
T PF13912_consen    1 PFECDECGKTF   11 (27)
T ss_dssp             SEEETTTTEEE
T ss_pred             CCCCCccCCcc
Confidence            68999998754


No 6  
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]
Probab=41.39  E-value=13  Score=34.25  Aligned_cols=17  Identities=29%  Similarity=0.729  Sum_probs=13.7

Q ss_pred             cccccCCCcccccCCCc
Q psy6200          69 YLFIQNHPHRCLQCGTS   85 (112)
Q Consensus        69 ~~~~~n~~h~~~~~~~~   85 (112)
                      +.-.-||||.|..|+..
T Consensus        88 E~LLiNHPlDCpiCD~g  104 (693)
T COG1034          88 EFLLINHPLDCPVCDKG  104 (693)
T ss_pred             HHHHhcCCCCCCccCCC
Confidence            44456999999999875


No 7  
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=34.57  E-value=14  Score=24.60  Aligned_cols=13  Identities=31%  Similarity=0.846  Sum_probs=6.6

Q ss_pred             ccCCCcccccCCC
Q psy6200          72 IQNHPHRCLQCGT   84 (112)
Q Consensus        72 ~~n~~h~~~~~~~   84 (112)
                      ..++||.|..||.
T Consensus        20 ~S~~PatCP~C~a   32 (54)
T PF09237_consen   20 QSEQPATCPICGA   32 (54)
T ss_dssp             TTS--EE-TTT--
T ss_pred             ccCCCCCCCcchh
Confidence            3578999999986


No 8  
>PHA00097 K protein K
Probab=33.09  E-value=42  Score=22.52  Aligned_cols=22  Identities=41%  Similarity=0.353  Sum_probs=17.6

Q ss_pred             ehhhhhHHHHHHHHHHHHHHHH
Q psy6200           5 FIFQENECFQSVLKSSQRKLLK   26 (112)
Q Consensus         5 fLvYEnEcfq~eLR~aQrKLLk   26 (112)
                      .|+-|||-.|.+|.+..+-||.
T Consensus        23 gllveneeiqs~lk~le~lll~   44 (56)
T PHA00097         23 GLLVENEEIQSQLKKLEKLLLC   44 (56)
T ss_pred             cceeccHHHHHHHHHHHHHHhh
Confidence            4667899999999988876663


No 9  
>PF04967 HTH_10:  HTH DNA binding domain;  InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. This entry represents the HTH DNA binding domain found in Halobacterium salinarium (Halobacterium halobium) and described as a putative bacterio-opsin activator. 
Probab=29.98  E-value=44  Score=21.30  Aligned_cols=15  Identities=27%  Similarity=0.516  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHH
Q psy6200          12 CFQSVLKSSQRKLLK   26 (112)
Q Consensus        12 cfq~eLR~aQrKLLk   26 (112)
                      -|.+-||++++||++
T Consensus        39 t~~~~LRrae~kli~   53 (53)
T PF04967_consen   39 TVSEHLRRAERKLIE   53 (53)
T ss_pred             HHHHHHHHHHHHHhC
Confidence            367889999999974


No 10 
>PF11500 Cut12:  Spindle pole body formation-associated protein;  InterPro: IPR021589  This is the central coiled-coil region of cut12 also found in other fungi, barring S. cerevisiae. The full protein has two predicted coiled-coil regions, and one consensus phosphorylation site for p34cdc2 and two for MAP kinase. During Schizosaccharomyces japonicus yFS275 mitosis, the duplicated spindle pole bodies (SPBs) nucleate microtubule arrays that interdigitate to form the mitotic spindle. Cut12 is localised to the SPB throughout the cell cycle, predominantly around the inner face of the interphase SPB, adjacent to the nucleus []. Cut12 associates with Fin1 and is important in this context for the activity of Plo1 []. 
Probab=29.15  E-value=45  Score=25.70  Aligned_cols=14  Identities=43%  Similarity=0.933  Sum_probs=10.1

Q ss_pred             CCCcccccCCCccccc
Q psy6200          74 NHPHRCLQCGTSWANK   89 (112)
Q Consensus        74 n~~h~~~~~~~~~~~~   89 (112)
                      |-||  |++|.-|+..
T Consensus        61 ~eP~--SqSGkYWK~e   74 (152)
T PF11500_consen   61 NEPH--SQSGKYWKEE   74 (152)
T ss_pred             CCCc--ccccchHHHH
Confidence            4556  7779999853


No 11 
>PF12283 Protein_K:  Bacteriophage protein K;  InterPro: IPR020962  This family of proteins is found in the microviridae (isometric ssDNA phages) and are approximately 60 amino acids in length. The function of these proteins are unknown. In phi X174 site-directed mutagenesis of gene K produces small plaques on su- hosts. The mutant phage has an identical latent period, but a more reduced burst size than that of the wild-type phi X174. The reduced burst size in the gene K mutant suggests that the gene K protein, although not essential, has a role in increasing infectivity by increasing the burst size three to six fold [].
Probab=28.27  E-value=60  Score=21.83  Aligned_cols=22  Identities=41%  Similarity=0.437  Sum_probs=17.3

Q ss_pred             ehhhhhHHHHHHHHHHHHHHHH
Q psy6200           5 FIFQENECFQSVLKSSQRKLLK   26 (112)
Q Consensus         5 fLvYEnEcfq~eLR~aQrKLLk   26 (112)
                      .|+-|||-.|.+|.+..+-||+
T Consensus        23 gllvene~i~~~l~~le~lllr   44 (56)
T PF12283_consen   23 GLLVENEEIQSQLKQLEKLLLR   44 (56)
T ss_pred             ccccccHHHHHHHHHHHHHHhh
Confidence            4667899999999888776664


No 12 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=28.01  E-value=49  Score=20.73  Aligned_cols=20  Identities=25%  Similarity=0.381  Sum_probs=11.5

Q ss_pred             cCcccccccCCCcccccCCCccc
Q psy6200          65 VDFRYLFIQNHPHRCLQCGTSWA   87 (112)
Q Consensus        65 ~~~~~~~~~n~~h~~~~~~~~~~   87 (112)
                      +++.+++-+   .+|..||.+|.
T Consensus        26 t~F~~Lp~~---w~CP~C~a~K~   45 (47)
T PF00301_consen   26 TPFEDLPDD---WVCPVCGAPKS   45 (47)
T ss_dssp             --GGGS-TT----B-TTTSSBGG
T ss_pred             CCHHHCCCC---CcCcCCCCccc
Confidence            345577666   89999998874


No 13 
>PF14728 PHTB1_C:  PTHB1 C-terminus
Probab=26.72  E-value=87  Score=26.63  Aligned_cols=22  Identities=27%  Similarity=0.326  Sum_probs=19.2

Q ss_pred             hHHHHHHHHHHHHHHHHHhhch
Q psy6200          10 NECFQSVLKSSQRKLLKASRDK   31 (112)
Q Consensus        10 nEcfq~eLR~aQrKLLkvsRDK   31 (112)
                      -++...++|..||+||---|||
T Consensus       223 L~~~a~QfRaIQrrlL~r~kd~  244 (377)
T PF14728_consen  223 LDERAQQFRAIQRRLLTRFKDK  244 (377)
T ss_pred             HHHHHHHHHHHHHHHHHHhccC
Confidence            3567889999999999999998


No 14 
>PF14120 YhzD:  YhzD-like protein
Probab=25.51  E-value=16  Score=24.76  Aligned_cols=28  Identities=25%  Similarity=0.409  Sum_probs=19.1

Q ss_pred             ccCCcccccccCcc---cccccCCCcccccC
Q psy6200          55 TESSDEEHKRVDFR---YLFIQNHPHRCLQC   82 (112)
Q Consensus        55 T~SSd~e~~~~~~~---~~~~~n~~h~~~~~   82 (112)
                      +.++|++.+..-..   +-..-+|+|||-+.
T Consensus        22 eA~~D~eAK~~G~~~L~Ek~~~~~THR~v~~   52 (61)
T PF14120_consen   22 EAANDEEAKEIGEQKLKEKGYEEKTHRCVSS   52 (61)
T ss_pred             ecCCHHHHHHHHHHHHHHCChhhcceeeeCC
Confidence            44666666655444   66778999999754


No 15 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=24.93  E-value=28  Score=20.27  Aligned_cols=19  Identities=26%  Similarity=0.525  Sum_probs=12.5

Q ss_pred             cccccCCCcccccCCCccc
Q psy6200          69 YLFIQNHPHRCLQCGTSWA   87 (112)
Q Consensus        69 ~~~~~n~~h~~~~~~~~~~   87 (112)
                      .+....-.-||+.|+..|.
T Consensus        18 ~l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen   18 KLPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             HcccCCcEEECCCCCcEee
Confidence            3444445578999988763


No 16 
>PF07111 HCR:  Alpha helical coiled-coil rod protein (HCR);  InterPro: IPR009800 This family consists of several mammalian alpha helical coiled-coil rod HCR proteins. The function of HCR is unknown but it has been implicated in psoriasis in humans and is thought to affect keratinocyte proliferation [].; GO: 0030154 cell differentiation, 0005634 nucleus, 0005737 cytoplasm
Probab=24.76  E-value=2e+02  Score=27.48  Aligned_cols=33  Identities=27%  Similarity=0.402  Sum_probs=28.5

Q ss_pred             hhHHHHHHHHHHHHHHHHHhhchhHHHHHHhhh
Q psy6200           9 ENECFQSVLKSSQRKLLKASRDKSFLLDRLLEY   41 (112)
Q Consensus         9 EnEcfq~eLR~aQrKLLkvsRDKsFLLDRLLqY   41 (112)
                      ..|.+.++..+..++|=.+-|||+.+|-||+.-
T Consensus       633 q~e~~~~e~~rl~~rlqelerdkNl~l~rl~~~  665 (739)
T PF07111_consen  633 QEEARKEEGQRLTQRLQELERDKNLMLQRLLAV  665 (739)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhhHHHHHHHHh
Confidence            356777788889999999999999999999874


No 17 
>PF13695 zf-3CxxC:  Zinc-binding domain
Probab=24.35  E-value=36  Score=23.25  Aligned_cols=14  Identities=21%  Similarity=0.918  Sum_probs=11.4

Q ss_pred             cccccCCCcccccC
Q psy6200          77 HRCLQCGTSWANKG   90 (112)
Q Consensus        77 h~~~~~~~~~~~~~   90 (112)
                      ++|+.|+++|.+.-
T Consensus         6 F~C~~C~~~W~S~~   19 (98)
T PF13695_consen    6 FQCSKCSRGWTSAK   19 (98)
T ss_pred             EECCCCCCCCccCE
Confidence            57999999998764


No 18 
>PF07818 HCNGP:  HCNGP-like protein;  InterPro: IPR012479 This family comprises sequences bearing significant similarity to the mouse transcriptional regulator protein HCNGP (Q02614 from SWISSPROT). This protein is localised to the nucleus and is thought to be involved in the regulation of beta-2-microglobulin genes. 
Probab=24.09  E-value=83  Score=22.04  Aligned_cols=20  Identities=15%  Similarity=0.124  Sum_probs=16.5

Q ss_pred             hhhhHHHHHHHHHHHHHHHH
Q psy6200           7 FQENECFQSVLKSSQRKLLK   26 (112)
Q Consensus         7 vYEnEcfq~eLR~aQrKLLk   26 (112)
                      .|--|+|-++|+++|++...
T Consensus        71 ~~~~~~y~e~L~k~Qk~~~~   90 (96)
T PF07818_consen   71 GFPEEDYYEELAKAQKEEME   90 (96)
T ss_pred             CCCHHHHHHHHHHHHHHHHH
Confidence            35679999999999998753


No 19 
>PF08614 ATG16:  Autophagy protein 16 (ATG16);  InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells. In yeast, 15 Apg proteins coordinate the formation of autophagosomes. No molecule involved in autophagy has yet been identified in higher eukaryotes []. The pre-autophagosomal structure contains at least five Apg proteins: Apg1p, Apg2p, Apg5p, Aut7p/Apg8p and Apg16p. It is found in the vacuole []. The C-terminal glycine of Apg12p is conjugated to a lysine residue of Apg5p via an isopeptide bond. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. Auotphagy protein 16 (Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate []. Autophagy protein 5 (Apg5) is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway []. This entry represents auotphagy protein 16 (Apg16), which is required for the function of the Apg12p-Apg5p conjugate.; PDB: 3A7O_D 3A7P_B.
Probab=23.55  E-value=1.7e+02  Score=21.91  Aligned_cols=31  Identities=23%  Similarity=0.312  Sum_probs=23.8

Q ss_pred             HHHHHHHHHHHHHHHHHhhchhHHHHHHhhh
Q psy6200          11 ECFQSVLKSSQRKLLKASRDKSFLLDRLLEY   41 (112)
Q Consensus        11 Ecfq~eLR~aQrKLLkvsRDKsFLLDRLLqY   41 (112)
                      ..++-++-.++.|+=++..+..=|++|+|++
T Consensus       154 ~~L~l~~~~~e~k~~~l~~En~~Lv~Rwm~~  184 (194)
T PF08614_consen  154 QALQLQLNMLEEKLRKLEEENRELVERWMQR  184 (194)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3344455566678888999999999999986


No 20 
>smart00355 ZnF_C2H2 zinc finger.
Probab=23.18  E-value=41  Score=15.82  Aligned_cols=11  Identities=36%  Similarity=1.023  Sum_probs=7.7

Q ss_pred             cccccCCCccc
Q psy6200          77 HRCLQCGTSWA   87 (112)
Q Consensus        77 h~~~~~~~~~~   87 (112)
                      ++|..|+.+-.
T Consensus         1 ~~C~~C~~~f~   11 (26)
T smart00355        1 YRCPECGKVFK   11 (26)
T ss_pred             CCCCCCcchhC
Confidence            57888986543


No 21 
>PF14353 CpXC:  CpXC protein
Probab=22.70  E-value=42  Score=23.19  Aligned_cols=14  Identities=21%  Similarity=0.650  Sum_probs=11.0

Q ss_pred             CCcccccCCCcccc
Q psy6200          75 HPHRCLQCGTSWAN   88 (112)
Q Consensus        75 ~~h~~~~~~~~~~~   88 (112)
                      +.|.|.+||..-..
T Consensus        37 ~~~~CP~Cg~~~~~   50 (128)
T PF14353_consen   37 FSFTCPSCGHKFRL   50 (128)
T ss_pred             CEEECCCCCCceec
Confidence            45899999987654


No 22 
>PF13945 NST1:  Salt tolerance down-regulator
Probab=21.95  E-value=29  Score=27.48  Aligned_cols=15  Identities=33%  Similarity=0.740  Sum_probs=12.3

Q ss_pred             cCCCcccccCCCccc
Q psy6200          73 QNHPHRCLQCGTSWA   87 (112)
Q Consensus        73 ~n~~h~~~~~~~~~~   87 (112)
                      |.|.-.|+.||+...
T Consensus       138 q~h~C~C~vCgr~~~  152 (190)
T PF13945_consen  138 QKHSCSCSVCGRKRT  152 (190)
T ss_pred             hccCcccHHHhchhh
Confidence            568889999999863


No 23 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=21.77  E-value=44  Score=19.73  Aligned_cols=18  Identities=39%  Similarity=0.767  Sum_probs=8.1

Q ss_pred             cccCCCcccccCCCCCCC
Q psy6200          79 CLQCGTSWANKGPTGTFR   96 (112)
Q Consensus        79 ~~~~~~~~~~~~~~~t~~   96 (112)
                      |++||..-..+.|.|-.+
T Consensus         3 C~~CG~~l~~~ip~gd~r   20 (34)
T PF14803_consen    3 CPQCGGPLERRIPEGDDR   20 (34)
T ss_dssp             -TTT--B-EEE--TT-SS
T ss_pred             cccccChhhhhcCCCCCc
Confidence            899999887777766543


No 24 
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated
Probab=21.63  E-value=1.7e+02  Score=22.43  Aligned_cols=65  Identities=14%  Similarity=0.045  Sum_probs=35.0

Q ss_pred             HHHHHHHHHHHHHHhhchhHH------------HHHHhhhcCCCCCCCCCcccccCCcccccccCcccccccCCCccccc
Q psy6200          14 QSVLKSSQRKLLKASRDKSFL------------LDRLLEYEKPVWSDSSDGEATESSDEEHKRVDFRYLFIQNHPHRCLQ   81 (112)
Q Consensus        14 q~eLR~aQrKLLkvsRDKsFL------------LDRLLqYE~v~~~~SSDsdaT~SSd~e~~~~~~~~~~~~n~~h~~~~   81 (112)
                      ..+++..++.+|....+.+.+            |..+..+=.+. .. .-   +....  ...++.+.+.+.-.+.||-.
T Consensus        78 ~~~~~~~rk~~l~~ll~~h~~~C~~C~~~g~C~Lq~~a~~~g~~-~~-~~---~~~~~--~~~~d~s~~~i~~d~~kCi~  150 (234)
T PRK07569         78 TPRLQEYRRMIVELLFAEGNHVCAVCVANGNCELQDLAIEVGMD-HV-RF---PYLFP--RRPVDISHPRFGIDHNRCVL  150 (234)
T ss_pred             CHHHHHHHHHHHHHHHHhccccCcccCCCCCcHHHHHHHHhCCC-Cc-cc---CcccC--CcccccCCCcEEeehhhCcC
Confidence            367888888888876665444            66665544444 11 10   00011  11222333444445689999


Q ss_pred             CCCc
Q psy6200          82 CGTS   85 (112)
Q Consensus        82 ~~~~   85 (112)
                      ||+=
T Consensus       151 Cg~C  154 (234)
T PRK07569        151 CTRC  154 (234)
T ss_pred             ccHH
Confidence            9873


No 25 
>KOG4102|consensus
Probab=21.51  E-value=1.6e+02  Score=22.44  Aligned_cols=30  Identities=30%  Similarity=0.511  Sum_probs=19.3

Q ss_pred             cccCCCcccccCCCCCCCCCCCCCCCCCCC
Q psy6200          79 CLQCGTSWANKGPTGTFRGPGAASLPKSPK  108 (112)
Q Consensus        79 ~~~~~~~~~~~~~~~t~~~p~~~~~p~~p~  108 (112)
                      |..|--..++..|.|.--+|....+|.-||
T Consensus        90 crgh~~~~~~~~p~~~~~~~d~~~~~~e~k  119 (121)
T KOG4102|consen   90 CRGHTEKRKNAKPNGPEIGPDYSQPPQEPK  119 (121)
T ss_pred             cccccchhhccCCCCCCCCCccccCCcccc
Confidence            666666666667777766666655555554


No 26 
>PF12269 zf-CpG_bind_C:  CpG binding protein zinc finger C terminal domain;  InterPro: IPR022056  This domain family is found in eukaryotes, and is approximately 240 amino acids in length. This domain is the zinc finger domain of a CpG binding DNA methyltransferase protein. It contains a CxxC motif which forms the zinc finger and binds to DNA. 
Probab=21.38  E-value=2.4e+02  Score=23.19  Aligned_cols=35  Identities=6%  Similarity=-0.023  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHHhhchhHHHHHHhhhcCCCCCC
Q psy6200          14 QSVLKSSQRKLLKASRDKSFLLDRLLEYEKPVWSD   48 (112)
Q Consensus        14 q~eLR~aQrKLLkvsRDKsFLLDRLLqYE~v~~~~   48 (112)
                      ..+...++.+|..+.+.-..|-.=+..-....+..
T Consensus        35 r~kq~~v~~~l~eLe~~~~el~~~i~~~k~~~~~~   69 (236)
T PF12269_consen   35 RKKQQKVRNRLQELEKRFKELEAIIARAKQFTVDQ   69 (236)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcccCc
Confidence            33444555666666665555544444444444333


No 27 
>PF06970 RepA_N:  Replication initiator protein A (RepA) N-terminus;  InterPro: IPR010724 This entry represents the N terminus (approximately 80 residues) of replication initiator protein A (RepA), a DNA replication initiator in plasmids []. Most proteins in this entry are bacterial, but archaeal and eukaryotic members are also included.
Probab=21.29  E-value=51  Score=22.07  Aligned_cols=25  Identities=24%  Similarity=0.401  Sum_probs=21.7

Q ss_pred             ehhhhhHHHHHHHHHHHHHHHHHhh
Q psy6200           5 FIFQENECFQSVLKSSQRKLLKASR   29 (112)
Q Consensus         5 fLvYEnEcfq~eLR~aQrKLLkvsR   29 (112)
                      |++|.+|-+++.|...+.++.++-+
T Consensus        50 Yi~~s~eel~~~L~~s~~tv~~~~k   74 (76)
T PF06970_consen   50 YIIFSIEELMELLNCSKSTVIKAKK   74 (76)
T ss_pred             EEEeeHHHHHHHHCCCHHHHHHHHH
Confidence            7899999999999999988887654


No 28 
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G. This model represents the G subunit (one of 14: A-N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts. This model excludes related subunits from formate dehydrogenase complexes.
Probab=20.83  E-value=49  Score=28.54  Aligned_cols=17  Identities=29%  Similarity=0.720  Sum_probs=14.4

Q ss_pred             cccccCCCcccccCCCc
Q psy6200          69 YLFIQNHPHRCLQCGTS   85 (112)
Q Consensus        69 ~~~~~n~~h~~~~~~~~   85 (112)
                      ++-.-||||.|..|+..
T Consensus        86 e~ll~~h~~dC~~C~~~  102 (603)
T TIGR01973        86 EFLLINHPLDCPICDQG  102 (603)
T ss_pred             HHHHhcCCCCCCcCCCC
Confidence            56668999999999975


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=20.81  E-value=29  Score=17.20  Aligned_cols=11  Identities=36%  Similarity=0.996  Sum_probs=8.1

Q ss_pred             cccccCCCccc
Q psy6200          77 HRCLQCGTSWA   87 (112)
Q Consensus        77 h~~~~~~~~~~   87 (112)
                      |+|..||++-.
T Consensus         1 y~C~~C~~~f~   11 (23)
T PF00096_consen    1 YKCPICGKSFS   11 (23)
T ss_dssp             EEETTTTEEES
T ss_pred             CCCCCCCCccC
Confidence            57899987644


No 30 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=20.44  E-value=33  Score=16.25  Aligned_cols=12  Identities=33%  Similarity=0.916  Sum_probs=6.9

Q ss_pred             cccccCCCcccc
Q psy6200          77 HRCLQCGTSWAN   88 (112)
Q Consensus        77 h~~~~~~~~~~~   88 (112)
                      |.|..||..-.+
T Consensus         1 ~~C~~C~~~~~~   12 (24)
T PF13894_consen    1 FQCPICGKSFRS   12 (24)
T ss_dssp             EE-SSTS-EESS
T ss_pred             CCCcCCCCcCCc
Confidence            578899876543


No 31 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=20.21  E-value=1.1e+02  Score=22.05  Aligned_cols=19  Identities=26%  Similarity=0.740  Sum_probs=14.7

Q ss_pred             ccCCCcccccCCCcccccC
Q psy6200          72 IQNHPHRCLQCGTSWANKG   90 (112)
Q Consensus        72 ~~n~~h~~~~~~~~~~~~~   90 (112)
                      .|..|-.|..||+.+..-.
T Consensus        22 Lnk~PivCP~CG~~~~~~~   40 (108)
T PF09538_consen   22 LNKDPIVCPKCGTEFPPEP   40 (108)
T ss_pred             CCCCCccCCCCCCccCccc
Confidence            3557788999999987763


No 32 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=20.05  E-value=67  Score=20.27  Aligned_cols=19  Identities=26%  Similarity=0.428  Sum_probs=12.7

Q ss_pred             cccccccCCCcccccCCCcccc
Q psy6200          67 FRYLFIQNHPHRCLQCGTSWAN   88 (112)
Q Consensus        67 ~~~~~~~n~~h~~~~~~~~~~~   88 (112)
                      +.+++..   .+|..||..|..
T Consensus        28 f~~Lp~~---w~CP~C~a~K~~   46 (50)
T cd00730          28 FEDLPDD---WVCPVCGAGKDD   46 (50)
T ss_pred             HhHCCCC---CCCCCCCCcHHH
Confidence            3355554   789999877653


Done!