Diaphorina citri psyllid: psy6220


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MSPPFLFRSNETTATLDACATLEKMTVAETISEDTILFWQIHKSIWPVTQRDAVFWSHMTQVPDPSDRDAQNIWIVVNNSTDLDAYPVSRRRVTQTVLQVS
ccccEEEECcccccccHHHHccEEEEEEEEEccccEEEEEEEEcccccccccEEEEEEEEEcccccccccccEEEEEEccccccccccccccEEEEEEEEc
**PPFLFRSNETTATLDACATLEKMTVAETISEDTILFWQIHKSIWPVTQRDAVFWSHMTQVPDPSDRDAQNIWIVVNNSTDLDAYPVSRRRVTQTVLQVS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPPFLFRSNETTATLDACATLEKMTVAETISEDTILFWQIHKSIWPVTQRDAVFWSHMTQVPDPSDRDAQNIWIVVNNSTDLDAYPVSRRRVTQTVLQVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035627 [BP]ceramide transportprobableGO:0051234, GO:0006869, GO:0006810, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0051179, GO:0044699
GO:0097001 [MF]ceramide bindingprobableGO:0005488, GO:0003674, GO:0046625, GO:0008289
GO:0035620 [MF]ceramide transporter activityprobableGO:0005319, GO:0005215, GO:0003674, GO:0022892, GO:0046624

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E3N, chain A
Confidence level:very confident
Coverage over the Query: 6-97
View the alignment between query and template
View the model in PyMOL