Query         psy6223
Match_columns 107
No_of_seqs    7 out of 9
Neff          1.1 
Searched_HMMs 46136
Date          Fri Aug 16 20:52:35 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6223.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6223hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1924|consensus               86.9     2.1 4.6E-05   40.4   6.6   20    7-26    497-516 (1102)
  2 PRK10265 chaperone-modulator p  58.6     8.9 0.00019   25.4   2.1   23    7-29     73-95  (101)
  3 PRK13729 conjugal transfer pil  53.7      29 0.00062   30.1   4.9   25    5-29     97-121 (475)
  4 PF11629 Mst1_SARAH:  C termina  51.3      12 0.00027   23.9   1.8   23    8-30     11-37  (49)
  5 PRK00736 hypothetical protein;  50.7      30 0.00065   22.0   3.5   28    5-32     25-53  (68)
  6 PF00769 ERM:  Ezrin/radixin/mo  49.0      12 0.00027   28.3   1.8   19    8-26    185-203 (246)
  7 cd04766 HTH_HspR Helix-Turn-He  45.1      23 0.00049   22.3   2.3   23    6-28     66-88  (91)
  8 PF00831 Ribosomal_L29:  Riboso  39.4      33 0.00072   20.9   2.4   26    8-33     10-35  (58)
  9 PF10737 GerPC:  Spore germinat  38.3      27 0.00058   26.5   2.2   20    9-28      3-22  (176)
 10 cd00427 Ribosomal_L29_HIP Ribo  38.3      35 0.00076   20.6   2.3   26    8-33      9-34  (57)
 11 PRK02793 phi X174 lysis protei  37.1      68  0.0015   20.5   3.6   28    4-31     27-55  (72)
 12 cd01110 HTH_SoxR Helix-Turn-He  36.2   1E+02  0.0022   21.2   4.6   19   31-49    115-133 (139)
 13 TIGR00012 L29 ribosomal protei  35.7      23  0.0005   21.5   1.2   26    8-33      8-33  (55)
 14 PF06305 DUF1049:  Protein of u  35.0      38 0.00082   19.8   2.1   20    6-25     49-68  (68)
 15 PRK00295 hypothetical protein;  34.5      70  0.0015   20.3   3.4   27    4-30     24-51  (68)
 16 COG0255 RpmC Ribosomal protein  33.4      24 0.00052   23.2   1.1   27    9-35     15-41  (69)
 17 PRK02119 hypothetical protein;  32.6      88  0.0019   20.1   3.6   27    4-30     28-55  (73)
 18 PRK00306 50S ribosomal protein  31.9      29 0.00063   21.5   1.3   25    8-32     12-36  (66)
 19 PF00170 bZIP_1:  bZIP transcri  28.4      59  0.0013   19.4   2.2   18    9-26     30-47  (64)
 20 CHL00154 rpl29 ribosomal prote  28.4      58  0.0012   20.9   2.2   26    8-33     15-40  (67)
 21 PF07400 IL11:  Interleukin 11;  28.1 1.1E+02  0.0024   24.2   4.2   39    5-46    124-162 (199)
 22 PRK04406 hypothetical protein;  27.7 1.2E+02  0.0025   19.7   3.6   27    4-30     30-57  (75)
 23 PF11336 DUF3138:  Protein of u  27.3 1.3E+02  0.0028   26.9   4.9   31    1-31     21-51  (514)
 24 PRK11546 zraP zinc resistance   26.3      44 0.00095   24.6   1.6   17   12-28     89-105 (143)
 25 KOG4286|consensus               25.8 1.6E+02  0.0035   28.1   5.4   52   40-105   880-932 (966)
 26 PRK00846 hypothetical protein;  25.0 1.2E+02  0.0026   20.3   3.4   29    4-32     32-61  (77)
 27 PRK00461 rpmC 50S ribosomal pr  24.9      37 0.00081   23.0   0.9   25    8-32     11-35  (87)
 28 PRK14549 50S ribosomal protein  24.8      80  0.0017   20.1   2.4   25    8-32     15-39  (69)
 29 PF04201 TPD52:  Tumour protein  23.7      69  0.0015   24.3   2.2   26    5-30     29-54  (162)
 30 PRK10803 tol-pal system protei  23.6      65  0.0014   24.4   2.1   19    8-26     57-75  (263)
 31 PF05008 V-SNARE:  Vesicle tran  23.5      86  0.0019   18.9   2.3   25    4-28     53-77  (79)
 32 PF10148 SCHIP-1:  Schwannomin-  23.5      61  0.0013   25.9   2.0   25    9-33    184-211 (238)
 33 PHA00327 minor capsid protein   23.3      45 0.00098   26.3   1.2   31   74-107    69-100 (187)
 34 KOG1924|consensus               22.2 2.6E+02  0.0057   27.1   6.1   11    6-16    475-485 (1102)
 35 smart00338 BRLZ basic region l  21.7   1E+02  0.0022   18.3   2.3   23    6-28     41-63  (65)
 36 COG4985 ABC-type phosphate tra  21.1      79  0.0017   26.4   2.2   25    6-30    222-246 (289)
 37 PF11853 DUF3373:  Protein of u  21.0      74  0.0016   27.6   2.2   23    6-28     25-47  (489)
 38 KOG0227|consensus               20.8      67  0.0015   25.9   1.8   23    1-23     17-39  (222)
 39 COG3416 Uncharacterized protei  20.7 1.8E+02  0.0038   23.7   4.1   22    9-30     52-73  (233)
 40 PF14215 bHLH-MYC_N:  bHLH-MYC   20.7      40 0.00087   24.1   0.4   10   10-19      1-10  (163)

No 1  
>KOG1924|consensus
Probab=86.90  E-value=2.1  Score=40.37  Aligned_cols=20  Identities=15%  Similarity=0.262  Sum_probs=10.7

Q ss_pred             HhHHHHHHHhhhhhhhhhhh
Q psy6223           7 AVHLQQRLRSLSTELVTLRN   26 (107)
Q Consensus         7 avhlqqrl~slstelvtlrn   26 (107)
                      +-|..+.++.|..|.+.|+.
T Consensus       497 l~k~e~Ki~~l~ae~~al~s  516 (1102)
T KOG1924|consen  497 LQKHEEKIKLLEAEKQALSS  516 (1102)
T ss_pred             HHHhhhhcccCchhhhhccC
Confidence            33444555556666666554


No 2  
>PRK10265 chaperone-modulator protein CbpM; Provisional
Probab=58.62  E-value=8.9  Score=25.42  Aligned_cols=23  Identities=30%  Similarity=0.391  Sum_probs=19.8

Q ss_pred             HhHHHHHHHhhhhhhhhhhhhcc
Q psy6223           7 AVHLQQRLRSLSTELVTLRNKLH   29 (107)
Q Consensus         7 avhlqqrl~slstelvtlrnrlh   29 (107)
                      +.+|-+|+..|-.|+-.|+|||-
T Consensus        73 vl~LLd~i~~Lr~el~~L~~~l~   95 (101)
T PRK10265         73 ALTLLDEIAHLKQENRLLRQRLS   95 (101)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            46788999999999999999873


No 3  
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional
Probab=53.73  E-value=29  Score=30.11  Aligned_cols=25  Identities=16%  Similarity=0.271  Sum_probs=21.2

Q ss_pred             hhHhHHHHHHHhhhhhhhhhhhhcc
Q psy6223           5 NEAVHLQQRLRSLSTELVTLRNKLH   29 (107)
Q Consensus         5 neavhlqqrl~slstelvtlrnrlh   29 (107)
                      ...-.+|+||+.|++|+-.|+.++-
T Consensus        97 aq~~dle~KIkeLEaE~~~Lk~Ql~  121 (475)
T PRK13729         97 KQRGDDQRRIEKLGQDNAALAEQVK  121 (475)
T ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHH
Confidence            3445789999999999999999983


No 4  
>PF11629 Mst1_SARAH:  C terminal SARAH domain of Mst1;  InterPro: IPR024205 The SARAH (Sav/Rassf/Hpo) domain is found at the C terminus in three classes of eukaryotic tumour suppressors that give the domain its name. In the Sav (Salvador) and Hpo (Hippo) families, the SARAH domain mediates signal transduction from Hpo via the Sav scaffolding protein to the downstream component Wts (Warts); the phosphorylation of Wts by Hpo triggers cell cycle arrest and apoptosis by down-regulating cyclin E, Diap 1 and other targets []. The SARAH domain is also involved in dimerisation, as in the human Hpo orthologue, Mst1, which homodimerises via its C-terminal SARAH domain. The SARAH domain is found associated with other domains, such as protein kinase domains, WW/rsp5/WWP domain (IPR001202 from INTERPRO), C1 domain (IPR002219 from INTERPRO), LIM domain (IPR001781 from INTERPRO), or the Ras-associating (RA) domain (IPR000159 from INTERPRO).; GO: 0004674 protein serine/threonine kinase activity; PDB: 2JO8_A.
Probab=51.34  E-value=12  Score=23.94  Aligned_cols=23  Identities=43%  Similarity=0.587  Sum_probs=18.0

Q ss_pred             hHHHHHHHhhh----hhhhhhhhhccc
Q psy6223           8 VHLQQRLRSLS----TELVTLRNKLHV   30 (107)
Q Consensus         8 vhlqqrl~sls----telvtlrnrlhv   30 (107)
                      -.||+||.||.    .||-.||.|.+.
T Consensus        11 ~eL~~rl~~LD~~ME~Eieelr~RY~~   37 (49)
T PF11629_consen   11 EELQQRLASLDPEMEQEIEELRQRYQA   37 (49)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhCCHHHHHHHHHHHHHHHH
Confidence            36999999985    577788888764


No 5  
>PRK00736 hypothetical protein; Provisional
Probab=50.67  E-value=30  Score=21.97  Aligned_cols=28  Identities=11%  Similarity=0.172  Sum_probs=20.4

Q ss_pred             hhHhHHHH-HHHhhhhhhhhhhhhccccC
Q psy6223           5 NEAVHLQQ-RLRSLSTELVTLRNKLHVQA   32 (107)
Q Consensus         5 neavhlqq-rl~slstelvtlrnrlhv~~   32 (107)
                      |++|.-|| .+..|..+|-.|++||--..
T Consensus        25 n~~v~~Qq~~i~~L~~ql~~L~~rl~~~~   53 (68)
T PRK00736         25 SDQLAEQWKTVEQMRKKLDALTERFLSLE   53 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            66666555 56778888999999986533


No 6  
>PF00769 ERM:  Ezrin/radixin/moesin family;  InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin []. Ezrin was first identified as a constituent of microvilli [], radixin as a barbed, end-capping actin-modulating protein from isolated junctional fractions [], and moesin as a heparin binding protein []. A tumour suppressor molecule responsible for neurofibromatosis type 2 (NF2) is highly similar to ERM proteins and has been designated merlin (moesin-ezrin-radixin-like protein). ERM molecules contain 3 domains, an N-terminal globular domain; an extended alpha-helical domain; and a charged C-terminal domain []. Ezrin, radixin and merlin also contain a polyproline region between the helical and C-terminal domains. The N-terminal domain is highly conserved, and is also found in merlin, band 4.1 proteins and members of the band 4.1 superfamily. ERM proteins crosslink actin filaments with plasma membranes. They co-localise with CD44 at actin filament-plasma membrane interaction sites, associating with CD44 via their N-terminal domains and with actin filaments via their C-terminal domains [].; GO: 0008092 cytoskeletal protein binding, 0005737 cytoplasm, 0019898 extrinsic to membrane; PDB: 2I1J_A 2I1K_A 1E5W_A 1EF1_C.
Probab=48.98  E-value=12  Score=28.31  Aligned_cols=19  Identities=37%  Similarity=0.630  Sum_probs=16.6

Q ss_pred             hHHHHHHHhhhhhhhhhhh
Q psy6223           8 VHLQQRLRSLSTELVTLRN   26 (107)
Q Consensus         8 vhlqqrl~slstelvtlrn   26 (107)
                      -|||++|+.|++||-.+|.
T Consensus       185 k~lq~QL~~L~~EL~~~kd  203 (246)
T PF00769_consen  185 KRLQEQLKELKSELEQLKD  203 (246)
T ss_dssp             HHHHHHHHHHHHHHHTTB-
T ss_pred             HHHHHHHHHHHHHHHHHhh
Confidence            3899999999999998884


No 7  
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator. Helix-turn-helix (HTH) transcription regulator HspR, N-terminal domain. Heat shock protein regulators (HspR) have been shown to regulate expression of specific regulons in response to high temperature or high osmolarity in Streptomyces and Helicobacter, respectively. These proteins share the N-terminal DNA binding domain  with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the spacer between the -35 and -10 promoter elements.  A typical MerR regulator is comprised of distinct domains that harbor the regulatory (effector-binding) site and the active (DNA-binding) site. Their conserved N-terminal domains contain predicted winged HTH motifs that mediate DNA binding, while the dissimilar C-terminal domains bind specific coactivator molecules.
Probab=45.09  E-value=23  Score=22.26  Aligned_cols=23  Identities=35%  Similarity=0.541  Sum_probs=19.4

Q ss_pred             hHhHHHHHHHhhhhhhhhhhhhc
Q psy6223           6 EAVHLQQRLRSLSTELVTLRNKL   28 (107)
Q Consensus         6 eavhlqqrl~slstelvtlrnrl   28 (107)
                      +.++|.+|+..|..||..||+.|
T Consensus        66 ~~l~l~~~~~~l~~~l~~l~~~~   88 (91)
T cd04766          66 RILELEEELAELRAELDELRARL   88 (91)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHh
Confidence            45678889999999999998876


No 8  
>PF00831 Ribosomal_L29:  Ribosomal L29 protein;  InterPro: IPR001854 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L29 is one of the proteins from the large ribosomal subunit. L29 belongs to a family of ribosomal proteins of 63 to 138 amino-acid residues which, on the basis of sequence similarities [], groups:  Red algal L29. Bacterial L29. Mammalian L35  Caenorhabditis elegans L35 (ZK652.4). Yeast L35.  ; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1VSP_W 3MS1_Y 3MRZ_Y 3F1H_2 3PYT_Y 3PYO_Y 3D5D_2 3D5B_2 3PYR_Y 1VSA_W ....
Probab=39.43  E-value=33  Score=20.89  Aligned_cols=26  Identities=31%  Similarity=0.351  Sum_probs=22.5

Q ss_pred             hHHHHHHHhhhhhhhhhhhhccccCC
Q psy6223           8 VHLQQRLRSLSTELVTLRNKLHVQAP   33 (107)
Q Consensus         8 vhlqqrl~slstelvtlrnrlhv~~~   33 (107)
                      -.|+..|.++..||..||...-+++.
T Consensus        10 ~eL~~~l~elk~eL~~Lr~q~~~~~l   35 (58)
T PF00831_consen   10 EELQEKLEELKKELFNLRFQKATGQL   35 (58)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHSSS
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccc
Confidence            46899999999999999998877654


No 9  
>PF10737 GerPC:  Spore germination protein GerPC;  InterPro: IPR019673  GerPC is required for the formation of functionally normal spores. The gerP locus encodes a number of proteins which are thought to be involved in the establishment of normal spore coat structure and/or permeability, which allows the access of germinants to their receptor []. 
Probab=38.27  E-value=27  Score=26.48  Aligned_cols=20  Identities=40%  Similarity=0.597  Sum_probs=18.1

Q ss_pred             HHHHHHHhhhhhhhhhhhhc
Q psy6223           9 HLQQRLRSLSTELVTLRNKL   28 (107)
Q Consensus         9 hlqqrl~slstelvtlrnrl   28 (107)
                      +|.+||++|..|+-+|++|-
T Consensus         3 ~LE~~~~~l~~e~~~Lk~~p   22 (176)
T PF10737_consen    3 RLEQRLQELQQELEELKQQP   22 (176)
T ss_pred             HHHHHHHHHHHHHHHHHhCC
Confidence            68999999999999998873


No 10 
>cd00427 Ribosomal_L29_HIP Ribosomal L29 protein/HIP.  L29 is a protein of the large ribosomal Subunit. A homolog, called heparin/heparan sulfate interacting protein (HIP), has also been identified in mammals.  L29 is located on the surface of the large ribosomal subunit, where it participates in forming a protein ring that surrounds the polypeptide exit channel, providing structural support for the ribosome.  L29 is involved in forming the translocon binding site, along with L19, L22, L23, L24, and L31e.  In addition, L29 and L23 form the interaction site for trigger factor (TF) on the ribosomal surface, adjacent to the exit tunnel.  L29 forms numerous interactions with L23 and with the 23S rRNA. In some eukaryotes, L29 is referred to as L35, which is distinct from L35 found in bacteria and some eukaryotes (primarily plastids and mitochondria).  The mammalian homolog, HIP, is found on the surface of many tissues and cell lines. It is believed to play a role in cell adhesion and modulat
Probab=38.25  E-value=35  Score=20.64  Aligned_cols=26  Identities=31%  Similarity=0.342  Sum_probs=21.9

Q ss_pred             hHHHHHHHhhhhhhhhhhhhccccCC
Q psy6223           8 VHLQQRLRSLSTELVTLRNKLHVQAP   33 (107)
Q Consensus         8 vhlqqrl~slstelvtlrnrlhv~~~   33 (107)
                      -.|+..|.++..||..||-...+|+.
T Consensus         9 ~eL~~~l~~l~~elf~Lr~q~~~~~~   34 (57)
T cd00427           9 EELQEKLDELKKELFNLRFQKATGQL   34 (57)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCC
Confidence            46899999999999999977777663


No 11 
>PRK02793 phi X174 lysis protein; Provisional
Probab=37.08  E-value=68  Score=20.53  Aligned_cols=28  Identities=25%  Similarity=0.306  Sum_probs=19.6

Q ss_pred             chhHhHHHH-HHHhhhhhhhhhhhhcccc
Q psy6223           4 SNEAVHLQQ-RLRSLSTELVTLRNKLHVQ   31 (107)
Q Consensus         4 sneavhlqq-rl~slstelvtlrnrlhv~   31 (107)
                      -|++|.-|| .+..|..+|-.|++||--.
T Consensus        27 Ln~~v~~Qq~~I~~L~~~l~~L~~rl~~~   55 (72)
T PRK02793         27 LNVTVTAHEMEMAKLRDHLRLLTEKLKAS   55 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            377777665 4566777888888888653


No 12 
>cd01110 HTH_SoxR Helix-Turn-Helix DNA binding domain of the SoxR transcription regulator. Helix-turn-helix (HTH) transcriptional regulator SoxR. The global regulator, SoxR, up-regulates gene expression of another transcription activator, SoxS, which directly stimulates the oxidative stress regulon genes in E. coli. The soxRS response renders the bacterial cell resistant to superoxide-generating agents, macrophage-generated nitric oxide, organic solvents, and antibiotics. The SoxR proteins share the N-terminal DNA binding domain with other transcription regulators of the MerR superfamily that promote transcription by reconfiguring the unusually long spacer between the -35 and -10 promoter elements. They also harbor a regulatory C-terminal domain containing an iron-sulfur center.
Probab=36.18  E-value=1e+02  Score=21.24  Aligned_cols=19  Identities=21%  Similarity=0.155  Sum_probs=13.6

Q ss_pred             cCCCCCCCCCCCCCCCCCC
Q psy6223          31 QAPPTAPPIKPSLPPVAPG   49 (107)
Q Consensus        31 ~~~~~ap~ikpslppvapg   49 (107)
                      .....-|.++|...+.++|
T Consensus       115 ~~~~~c~~~~~~~~~~~~~  133 (139)
T cd01110         115 LSLKKCPLYNPEDRLGAQG  133 (139)
T ss_pred             CCccCCCcCCcchhccCCC
Confidence            3445667888888887777


No 13 
>TIGR00012 L29 ribosomal protein L29. called L29 in prokaryotic (50S) large subunits and L35 in eukaryotic (60S) large subunits.
Probab=35.73  E-value=23  Score=21.45  Aligned_cols=26  Identities=27%  Similarity=0.295  Sum_probs=21.3

Q ss_pred             hHHHHHHHhhhhhhhhhhhhccccCC
Q psy6223           8 VHLQQRLRSLSTELVTLRNKLHVQAP   33 (107)
Q Consensus         8 vhlqqrl~slstelvtlrnrlhv~~~   33 (107)
                      ..|+..|.++..||..||-.--+++.
T Consensus         8 ~EL~~~l~~lr~eLf~Lr~~~~~~~~   33 (55)
T TIGR00012         8 EELAKKLDELKKELFELRFQKATGQL   33 (55)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCCc
Confidence            46899999999999999977555544


No 14 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=34.99  E-value=38  Score=19.84  Aligned_cols=20  Identities=35%  Similarity=0.519  Sum_probs=9.8

Q ss_pred             hHhHHHHHHHhhhhhhhhhh
Q psy6223           6 EAVHLQQRLRSLSTELVTLR   25 (107)
Q Consensus         6 eavhlqqrl~slstelvtlr   25 (107)
                      +.-.++++++.+..|+-.||
T Consensus        49 ~~~~~~k~l~~le~e~~~lr   68 (68)
T PF06305_consen   49 RIRRLRKELKKLEKELEQLR   68 (68)
T ss_pred             HHHHHHHHHHHHHHHHHhcC
Confidence            33445555555555554443


No 15 
>PRK00295 hypothetical protein; Provisional
Probab=34.48  E-value=70  Score=20.25  Aligned_cols=27  Identities=19%  Similarity=0.224  Sum_probs=18.6

Q ss_pred             chhHhHHHH-HHHhhhhhhhhhhhhccc
Q psy6223           4 SNEAVHLQQ-RLRSLSTELVTLRNKLHV   30 (107)
Q Consensus         4 sneavhlqq-rl~slstelvtlrnrlhv   30 (107)
                      -|++|.-|| .+..|..+|-.|++||--
T Consensus        24 Ln~~v~~Qq~~I~~L~~ql~~L~~rl~~   51 (68)
T PRK00295         24 LNDVLVEQQRVIERLQLQMAALIKRQEE   51 (68)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            366776655 466677788888888754


No 16 
>COG0255 RpmC Ribosomal protein L29 [Translation, ribosomal structure and biogenesis]
Probab=33.36  E-value=24  Score=23.21  Aligned_cols=27  Identities=33%  Similarity=0.449  Sum_probs=23.7

Q ss_pred             HHHHHHHhhhhhhhhhhhhccccCCCC
Q psy6223           9 HLQQRLRSLSTELVTLRNKLHVQAPPT   35 (107)
Q Consensus         9 hlqqrl~slstelvtlrnrlhv~~~~~   35 (107)
                      .|.++|..|-.||..||-.+-+|+..+
T Consensus        15 eL~~~l~eLK~ELf~LR~q~a~g~l~n   41 (69)
T COG0255          15 ELEEELRELKKELFNLRFQLATGQLEN   41 (69)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhCCCCC
Confidence            588999999999999999988887664


No 17 
>PRK02119 hypothetical protein; Provisional
Probab=32.61  E-value=88  Score=20.12  Aligned_cols=27  Identities=30%  Similarity=0.302  Sum_probs=19.2

Q ss_pred             chhHhHHHH-HHHhhhhhhhhhhhhccc
Q psy6223           4 SNEAVHLQQ-RLRSLSTELVTLRNKLHV   30 (107)
Q Consensus         4 sneavhlqq-rl~slstelvtlrnrlhv   30 (107)
                      -|++|.-|| .+..|..+|-.|++||--
T Consensus        28 LN~~v~~Qq~~id~L~~ql~~L~~rl~~   55 (73)
T PRK02119         28 LNQALIEQQFVIDKMQVQLRYMANKLKD   55 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            367776665 466777888888888854


No 18 
>PRK00306 50S ribosomal protein L29; Reviewed
Probab=31.87  E-value=29  Score=21.54  Aligned_cols=25  Identities=28%  Similarity=0.335  Sum_probs=20.1

Q ss_pred             hHHHHHHHhhhhhhhhhhhhccccC
Q psy6223           8 VHLQQRLRSLSTELVTLRNKLHVQA   32 (107)
Q Consensus         8 vhlqqrl~slstelvtlrnrlhv~~   32 (107)
                      ..|+.+|.+|-.||..||-..-+++
T Consensus        12 ~eL~~~l~~lkkeL~~lR~~~~~~~   36 (66)
T PRK00306         12 EELNEKLLELKKELFNLRFQKATGQ   36 (66)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCC
Confidence            4689999999999999996554443


No 19 
>PF00170 bZIP_1:  bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature;  InterPro: IPR011616  The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0046983 protein dimerization activity, 0006355 regulation of transcription, DNA-dependent; PDB: 2H7H_B 2OQQ_B 1S9K_E 1JNM_A 1JUN_A 1FOS_H 1A02_J 1T2K_C 1CI6_A 1DH3_C ....
Probab=28.39  E-value=59  Score=19.39  Aligned_cols=18  Identities=22%  Similarity=0.458  Sum_probs=8.8

Q ss_pred             HHHHHHHhhhhhhhhhhh
Q psy6223           9 HLQQRLRSLSTELVTLRN   26 (107)
Q Consensus         9 hlqqrl~slstelvtlrn   26 (107)
                      .|++++..|++|...|+.
T Consensus        30 ~Le~~~~~L~~en~~L~~   47 (64)
T PF00170_consen   30 ELEEKVEELESENEELKK   47 (64)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            445555555555444443


No 20 
>CHL00154 rpl29 ribosomal protein L29; Validated
Probab=28.38  E-value=58  Score=20.92  Aligned_cols=26  Identities=19%  Similarity=0.233  Sum_probs=21.3

Q ss_pred             hHHHHHHHhhhhhhhhhhhhccccCC
Q psy6223           8 VHLQQRLRSLSTELVTLRNKLHVQAP   33 (107)
Q Consensus         8 vhlqqrl~slstelvtlrnrlhv~~~   33 (107)
                      ..|+++|.+|..||..||-..-+|+-
T Consensus        15 ~eL~~~l~elk~elf~LRfq~atgql   40 (67)
T CHL00154         15 SEISEEIIKTKKELFDLRLKKATRQN   40 (67)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCcc
Confidence            46899999999999999977555543


No 21 
>PF07400 IL11:  Interleukin 11;  InterPro: IPR020438  Interleukins (IL) are a group of cytokines that play an important role in the immune system. They modulate inflammation and immunity by regulating growth, mobility and differentiation of lymphoid and other cells.   Interleukin-11 (IL-11) is a pleiotropic cytokine that stimulates megakaryocytopoiesis, resulting in increased production of platelets, as well as activating osteoclasts, inhibiting epithelial cell proliferation and apoptosis, and inhibiting macrophage mediator production. These functions may be particularly important in mediating the hematopoietic, osseous and mucosal protective effects of IL-11 []. The cytokine also possesses anti-inflammatory activity, and has been proposed as a therapeutic agent in the treatment of chronic inflammatory diseases, such as Crohn's disease and rheumatoid arthritis []. 
Probab=28.05  E-value=1.1e+02  Score=24.21  Aligned_cols=39  Identities=28%  Similarity=0.377  Sum_probs=25.6

Q ss_pred             hhHhHHHHHHHhhhhhhhhhhhhccccCCCCCCCCCCCCCCC
Q psy6223           5 NEAVHLQQRLRSLSTELVTLRNKLHVQAPPTAPPIKPSLPPV   46 (107)
Q Consensus         5 neavhlqqrl~slstelvtlrnrlhv~~~~~ap~ikpslppv   46 (107)
                      -|-..++.|+++|-.-|--+-+|++..+   .++-.|++|+-
T Consensus       124 p~lg~~~s~l~~Ll~~lq~lM~rl~~pq---~~p~~PspP~~  162 (199)
T PF07400_consen  124 PELGTMHSRLKRLLNRLQLLMSRLELPQ---LTPPSPSPPLP  162 (199)
T ss_pred             hhHHHHHHHHHHHHHHHHHHHHHhhCCC---CCCCCCCCCCC
Confidence            3455678889998888888888885433   34444555553


No 22 
>PRK04406 hypothetical protein; Provisional
Probab=27.66  E-value=1.2e+02  Score=19.75  Aligned_cols=27  Identities=19%  Similarity=0.251  Sum_probs=19.0

Q ss_pred             chhHhHHHH-HHHhhhhhhhhhhhhccc
Q psy6223           4 SNEAVHLQQ-RLRSLSTELVTLRNKLHV   30 (107)
Q Consensus         4 sneavhlqq-rl~slstelvtlrnrlhv   30 (107)
                      -|++|.-|| .+..|..+|-.|++||--
T Consensus        30 LN~~v~~Qq~~I~~L~~ql~~L~~rl~~   57 (75)
T PRK04406         30 LNDALSQQQLLITKMQDQMKYVVGKVKN   57 (75)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            367776665 456677788888888854


No 23 
>PF11336 DUF3138:  Protein of unknown function (DUF3138);  InterPro: IPR021485  This family of proteins with unknown function appear to be restricted to Proteobacteria. 
Probab=27.32  E-value=1.3e+02  Score=26.86  Aligned_cols=31  Identities=29%  Similarity=0.464  Sum_probs=26.8

Q ss_pred             CCCchhHhHHHHHHHhhhhhhhhhhhhcccc
Q psy6223           1 ASSSNEAVHLQQRLRSLSTELVTLRNKLHVQ   31 (107)
Q Consensus         1 asssneavhlqqrl~slstelvtlrnrlhv~   31 (107)
                      +++|++--.||..|+.|..++-.||..|-..
T Consensus        21 ~a~a~~i~~L~~ql~aLq~~v~eL~~~laa~   51 (514)
T PF11336_consen   21 AATADQIKALQAQLQALQDQVNELRAKLAAK   51 (514)
T ss_pred             cCCHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            4678888899999999999999999997553


No 24 
>PRK11546 zraP zinc resistance protein; Provisional
Probab=26.32  E-value=44  Score=24.63  Aligned_cols=17  Identities=24%  Similarity=0.561  Sum_probs=9.2

Q ss_pred             HHHHhhhhhhhhhhhhc
Q psy6223          12 QRLRSLSTELVTLRNKL   28 (107)
Q Consensus        12 qrl~slstelvtlrnrl   28 (107)
                      ++++.|+.|+..||..|
T Consensus        89 ~kI~aL~kEI~~Lr~kL  105 (143)
T PRK11546         89 SKINAVAKEMENLRQSL  105 (143)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            44555555555555444


No 25 
>KOG4286|consensus
Probab=25.81  E-value=1.6e+02  Score=28.10  Aligned_cols=52  Identities=23%  Similarity=0.290  Sum_probs=28.9

Q ss_pred             CCCCCCCCCCCCCCCCccccCCcchhhhhcchhhhhhccCCCCCccccCCCCCCC-CCCCCCCCCCc
Q psy6223          40 KPSLPPVAPGNTGPAPLLYKPIPQHQKAANIVVADVLSEKCPPVPAVGGGGSTPH-SPGDAGSKPVT  105 (107)
Q Consensus        40 kpslppvapgntgpapllykpipqhqkaanivvadvlsekcppvpavggggstph-spgdagskpvt  105 (107)
                      .|+.++-+-|-.+++|+   +.||+           ++..-+--||+|||+---- --+|+|++|+.
T Consensus       880 QP~s~~r~~gGS~ssp~---~spq~-----------S~~s~eQ~~AaGG~~~d~s~~a~dll~~p~d  932 (966)
T KOG4286|consen  880 QPQAEAKVNGGSVSSPS---TSLQR-----------SDSSQPQLLAVGGSQTDDSMGEEDLLSPPQD  932 (966)
T ss_pred             CCCCccCCCCCCCCCCC---ccccc-----------CcccchhhhhccCCCCCcccccccccCCCcc
Confidence            45556655555566664   33443           2223455678877654222 23688888863


No 26 
>PRK00846 hypothetical protein; Provisional
Probab=24.99  E-value=1.2e+02  Score=20.28  Aligned_cols=29  Identities=14%  Similarity=-0.073  Sum_probs=20.7

Q ss_pred             chhHhHHHHH-HHhhhhhhhhhhhhccccC
Q psy6223           4 SNEAVHLQQR-LRSLSTELVTLRNKLHVQA   32 (107)
Q Consensus         4 sneavhlqqr-l~slstelvtlrnrlhv~~   32 (107)
                      -|++|.-||+ +..|...|..|++||--..
T Consensus        32 LN~~v~~qq~~I~~L~~ql~~L~~rL~~~~   61 (77)
T PRK00846         32 LSEALADARLTGARNAELIRHLLEDLGKVR   61 (77)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            3677766655 5677778888999987643


No 27 
>PRK00461 rpmC 50S ribosomal protein L29; Reviewed
Probab=24.94  E-value=37  Score=23.03  Aligned_cols=25  Identities=32%  Similarity=0.309  Sum_probs=20.6

Q ss_pred             hHHHHHHHhhhhhhhhhhhhccccC
Q psy6223           8 VHLQQRLRSLSTELVTLRNKLHVQA   32 (107)
Q Consensus         8 vhlqqrl~slstelvtlrnrlhv~~   32 (107)
                      ..|+.+|.+|..||..||-..-.++
T Consensus        11 eEL~e~L~elkkELf~LR~q~atgq   35 (87)
T PRK00461         11 EELEKLVIELKAELFTLRFKNATGS   35 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCc
Confidence            4689999999999999997755553


No 28 
>PRK14549 50S ribosomal protein L29P; Provisional
Probab=24.76  E-value=80  Score=20.12  Aligned_cols=25  Identities=20%  Similarity=0.288  Sum_probs=21.0

Q ss_pred             hHHHHHHHhhhhhhhhhhhhccccC
Q psy6223           8 VHLQQRLRSLSTELVTLRNKLHVQA   32 (107)
Q Consensus         8 vhlqqrl~slstelvtlrnrlhv~~   32 (107)
                      ..|+.+|.+|..||..||-.-.+++
T Consensus        15 ~eL~~~l~elk~eLf~LR~q~~~~~   39 (69)
T PRK14549         15 EEREEKLEELKLELLKERAQAAMGG   39 (69)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhCc
Confidence            4689999999999999997666665


No 29 
>PF04201 TPD52:  Tumour protein D52 family;  InterPro: IPR007327 The hD52 gene was originally identified through its elevated expression level in human breast carcinoma. Cloning of D52 homologues from other species has indicated that D52 may play roles in calcium-mediated signal transduction and cell proliferation. Two human homologues of hD52, hD53 and hD54, have also been identified, demonstrating the existence of a novel gene/protein family []. These proteins have an N-terminal coiled-coil that allows members to form homo- and heterodimers with each other [].
Probab=23.66  E-value=69  Score=24.32  Aligned_cols=26  Identities=31%  Similarity=0.415  Sum_probs=20.9

Q ss_pred             hhHhHHHHHHHhhhhhhhhhhhhccc
Q psy6223           5 NEAVHLQQRLRSLSTELVTLRNKLHV   30 (107)
Q Consensus         5 neavhlqqrl~slstelvtlrnrlhv   30 (107)
                      .|.-.|++-|..+-.|+.|||+-|..
T Consensus        29 eE~eeLr~EL~KvEeEI~TLrqvL~a   54 (162)
T PF04201_consen   29 EEREELRSELAKVEEEIQTLRQVLAA   54 (162)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            46677888899999999999986653


No 30 
>PRK10803 tol-pal system protein YbgF; Provisional
Probab=23.63  E-value=65  Score=24.43  Aligned_cols=19  Identities=32%  Similarity=0.497  Sum_probs=13.1

Q ss_pred             hHHHHHHHhhhhhhhhhhh
Q psy6223           8 VHLQQRLRSLSTELVTLRN   26 (107)
Q Consensus         8 vhlqqrl~slstelvtlrn   26 (107)
                      ..||++|..|..|+-.||-
T Consensus        57 ~~l~~ql~~lq~ev~~LrG   75 (263)
T PRK10803         57 TQLQQQLSDNQSDIDSLRG   75 (263)
T ss_pred             HHHHHHHHHHHHHHHHHhh
Confidence            4677777777777766663


No 31 
>PF05008 V-SNARE:  Vesicle transport v-SNARE protein N-terminus;  InterPro: IPR007705  V-SNARE proteins are required for protein traffic between eukaryotic organelles. The v-SNAREs on transport vesicles interact with t-SNAREs on target membranes in order to facilitate this []. This domain is the N-terminal half of the V-Snare proteins. ; GO: 0006886 intracellular protein transport, 0016020 membrane; PDB: 2V8S_V 1VCS_A 3ONL_C 3ONJ_A 2QYW_A.
Probab=23.54  E-value=86  Score=18.87  Aligned_cols=25  Identities=32%  Similarity=0.515  Sum_probs=20.0

Q ss_pred             chhHhHHHHHHHhhhhhhhhhhhhc
Q psy6223           4 SNEAVHLQQRLRSLSTELVTLRNKL   28 (107)
Q Consensus         4 sneavhlqqrl~slstelvtlrnrl   28 (107)
                      .++-..++.||++.-++|-.|++.|
T Consensus        53 ~s~r~~~~~kl~~yr~~l~~lk~~l   77 (79)
T PF05008_consen   53 PSERNQYKSKLRSYRSELKKLKKEL   77 (79)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            3566788999999999999888754


No 32 
>PF10148 SCHIP-1:  Schwannomin-interacting protein 1;  InterPro: IPR015649 SCHIP-1 is a coiled-coil protein that specifically associates with schwannomin in vitro and in vivo. The product of the neurofibromatosis type 2 (NF2) tumour suppressor gene, known as schwannomin or merlin, is involved in NF2-associated and sporadic schwannomas and meningiomas. It is closely related to the ezrin-radixin-moesin family members, which link membrane proteins to the cytoskeleton. Association with SCHIP-1 can be observed only with some naturally occurring mutants of schwannomin, or a schwannomin spliced isoform lacking exons 2 and 3, but not with the schwannomin isoform exhibiting growth-suppressive activity []. This entry consists of mammalian SCHIP-1 proteins from Mus musculus (Mouse) and Homo sapiens (Human).
Probab=23.52  E-value=61  Score=25.93  Aligned_cols=25  Identities=36%  Similarity=0.703  Sum_probs=20.7

Q ss_pred             HHHHHHHhhhhhhhhh---hhhccccCC
Q psy6223           9 HLQQRLRSLSTELVTL---RNKLHVQAP   33 (107)
Q Consensus         9 hlqqrl~slstelvtl---rnrlhv~~~   33 (107)
                      .|++++.+|+.|||.+   |.-||..+.
T Consensus       184 ~l~~~i~~ln~~Lv~~L~~RD~Lh~eqd  211 (238)
T PF10148_consen  184 DLHEQIEALNEELVQLLLERDDLHMEQD  211 (238)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhcccc
Confidence            4789999999999864   888998764


No 33 
>PHA00327 minor capsid protein
Probab=23.32  E-value=45  Score=26.33  Aligned_cols=31  Identities=42%  Similarity=0.698  Sum_probs=21.6

Q ss_pred             hhhccCCCCCcccc-CCCCCCCCCCCCCCCCCcCC
Q psy6223          74 DVLSEKCPPVPAVG-GGGSTPHSPGDAGSKPVTPV  107 (107)
Q Consensus        74 dvlsekcppvpavg-gggstphspgdagskpvtpv  107 (107)
                      |.-..---|.-+.| ||.|||-.   ||..|+.|+
T Consensus        69 DmkkAGLNpLla~g~GgASsPsG---Ag~Sp~Np~  100 (187)
T PHA00327         69 DMKKAGLNPLLAFGKGGASSPSG---AGWSPNNPV  100 (187)
T ss_pred             HHHHcCccHHHHhcCCCCCCCCC---CCCCCCCcH
Confidence            44444556777888 88888765   777777664


No 34 
>KOG1924|consensus
Probab=22.22  E-value=2.6e+02  Score=27.06  Aligned_cols=11  Identities=18%  Similarity=0.480  Sum_probs=6.2

Q ss_pred             hHhHHHHHHHh
Q psy6223           6 EAVHLQQRLRS   16 (107)
Q Consensus         6 eavhlqqrl~s   16 (107)
                      +|+.+|..+.+
T Consensus       475 kA~e~~kk~~k  485 (1102)
T KOG1924|consen  475 KAAELEKKFDK  485 (1102)
T ss_pred             HHHHHHHHHHH
Confidence            56666655544


No 35 
>smart00338 BRLZ basic region leucin zipper.
Probab=21.73  E-value=1e+02  Score=18.30  Aligned_cols=23  Identities=30%  Similarity=0.502  Sum_probs=14.8

Q ss_pred             hHhHHHHHHHhhhhhhhhhhhhc
Q psy6223           6 EAVHLQQRLRSLSTELVTLRNKL   28 (107)
Q Consensus         6 eavhlqqrl~slstelvtlrnrl   28 (107)
                      |-..|+.++..|..|+..|++-+
T Consensus        41 en~~L~~~~~~l~~e~~~lk~~~   63 (65)
T smart00338       41 ENERLKKEIERLRRELEKLKSEL   63 (65)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHh
Confidence            33456667777777777776654


No 36 
>COG4985 ABC-type phosphate transport system, auxiliary component [Inorganic ion transport and metabolism]
Probab=21.05  E-value=79  Score=26.40  Aligned_cols=25  Identities=48%  Similarity=0.575  Sum_probs=21.2

Q ss_pred             hHhHHHHHHHhhhhhhhhhhhhccc
Q psy6223           6 EAVHLQQRLRSLSTELVTLRNKLHV   30 (107)
Q Consensus         6 eavhlqqrl~slstelvtlrnrlhv   30 (107)
                      |--.||.|++.|.+||-.||.-+|-
T Consensus       222 e~seLq~r~~~l~~~L~~L~~e~~r  246 (289)
T COG4985         222 EKSELQKRLAQLQTELDALRAELER  246 (289)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhhhhh
Confidence            4457999999999999999987774


No 37 
>PF11853 DUF3373:  Protein of unknown function (DUF3373);  InterPro: IPR021803  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 472 to 574 amino acids in length. 
Probab=21.01  E-value=74  Score=27.60  Aligned_cols=23  Identities=22%  Similarity=0.468  Sum_probs=16.7

Q ss_pred             hHhHHHHHHHhhhhhhhhhhhhc
Q psy6223           6 EAVHLQQRLRSLSTELVTLRNKL   28 (107)
Q Consensus         6 eavhlqqrl~slstelvtlrnrl   28 (107)
                      .-+.+||+|..|+.||..|+..+
T Consensus        25 ~~~~~~qkie~L~kql~~Lk~q~   47 (489)
T PF11853_consen   25 DDIDLLQKIEALKKQLEELKAQQ   47 (489)
T ss_pred             hhhHHHHHHHHHHHHHHHHHHhh
Confidence            34456668888888888887764


No 38 
>KOG0227|consensus
Probab=20.80  E-value=67  Score=25.94  Aligned_cols=23  Identities=35%  Similarity=0.377  Sum_probs=20.0

Q ss_pred             CCCchhHhHHHHHHHhhhhhhhh
Q psy6223           1 ASSSNEAVHLQQRLRSLSTELVT   23 (107)
Q Consensus         1 asssneavhlqqrl~slstelvt   23 (107)
                      ||.|+...+-..||++|..|-..
T Consensus        17 AS~se~n~~RrerlrqLaletid   39 (222)
T KOG0227|consen   17 ASESEFNRDRRERLRQLALETID   39 (222)
T ss_pred             cchhhhhHHHHHHHHHHHHhhcc
Confidence            68899999999999999888654


No 39 
>COG3416 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.67  E-value=1.8e+02  Score=23.72  Aligned_cols=22  Identities=23%  Similarity=0.395  Sum_probs=18.9

Q ss_pred             HHHHHHHhhhhhhhhhhhhccc
Q psy6223           9 HLQQRLRSLSTELVTLRNKLHV   30 (107)
Q Consensus         9 hlqqrl~slstelvtlrnrlhv   30 (107)
                      -+.|-|+++++++..||.|+|.
T Consensus        52 iqE~ALk~a~~~i~eLe~ri~~   73 (233)
T COG3416          52 IQEQALKKASTQIKELEKRIAI   73 (233)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Confidence            3457799999999999999986


No 40 
>PF14215 bHLH-MYC_N:  bHLH-MYC and R2R3-MYB transcription factors N-terminal
Probab=20.65  E-value=40  Score=24.12  Aligned_cols=10  Identities=80%  Similarity=0.929  Sum_probs=6.1

Q ss_pred             HHHHHHhhhh
Q psy6223          10 LQQRLRSLST   19 (107)
Q Consensus        10 lqqrl~slst   19 (107)
                      |||||++|-.
T Consensus         1 Lq~~Lr~lv~   10 (163)
T PF14215_consen    1 LQQRLRSLVE   10 (163)
T ss_pred             ChHHHHHHhC
Confidence            5677766643


Done!