BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy6224
         (82 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HT4|A Chain A, Crystal Structure Of The Q81a77_baccr Protein From
          Bacillus Cereus. Northeast Structural Genomics
          Consortium Target Bcr213
 pdb|3HT4|B Chain B, Crystal Structure Of The Q81a77_baccr Protein From
          Bacillus Cereus. Northeast Structural Genomics
          Consortium Target Bcr213
 pdb|3HT4|C Chain C, Crystal Structure Of The Q81a77_baccr Protein From
          Bacillus Cereus. Northeast Structural Genomics
          Consortium Target Bcr213
 pdb|3HT4|D Chain D, Crystal Structure Of The Q81a77_baccr Protein From
          Bacillus Cereus. Northeast Structural Genomics
          Consortium Target Bcr213
 pdb|3HT4|E Chain E, Crystal Structure Of The Q81a77_baccr Protein From
          Bacillus Cereus. Northeast Structural Genomics
          Consortium Target Bcr213
 pdb|3HT4|F Chain F, Crystal Structure Of The Q81a77_baccr Protein From
          Bacillus Cereus. Northeast Structural Genomics
          Consortium Target Bcr213
 pdb|3HT4|G Chain G, Crystal Structure Of The Q81a77_baccr Protein From
          Bacillus Cereus. Northeast Structural Genomics
          Consortium Target Bcr213
 pdb|3HT4|H Chain H, Crystal Structure Of The Q81a77_baccr Protein From
          Bacillus Cereus. Northeast Structural Genomics
          Consortium Target Bcr213
          Length = 431

 Score = 31.2 bits (69), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 39 NQIDAVRSRPDE---RNQFIVLTTFGEHTL--HHLFPTIDHCFLHIAHE 82
          +QI  V  R DE    NQF VL +FG+H +   H  PT  + +  I  +
Sbjct: 20 SQITEVHKRADEVIESNQFRVLESFGKHKISDSHFIPTTGYGYDDIGRD 68


>pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From
           Pseudomonas Fragi, Form I (Native2)
 pdb|1WDK|B Chain B, Fatty Acid Beta-Oxidation Multienzyme Complex From
           Pseudomonas Fragi, Form I (Native2)
 pdb|1WDL|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From
           Pseudomonas Fragi, Form Ii (Native4)
 pdb|1WDL|B Chain B, Fatty Acid Beta-Oxidation Multienzyme Complex From
           Pseudomonas Fragi, Form Ii (Native4)
 pdb|1WDM|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From
           Pseudomonas Fragi, Form I (Native3)
 pdb|1WDM|B Chain B, Fatty Acid Beta-Oxidation Multienzyme Complex From
           Pseudomonas Fragi, Form I (Native3)
 pdb|2D3T|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From
           Pseudomonas Fragi, Form V
 pdb|2D3T|B Chain B, Fatty Acid Beta-Oxidation Multienzyme Complex From
           Pseudomonas Fragi, Form V
          Length = 715

 Score = 27.7 bits (60), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 5/44 (11%)

Query: 3   GWG---SFLFAVIGVNAAHHHPDIFHQG--DTPREDRDWGINQI 41
           GW    ++L  V+G++  HH  D+  +G  D  ++DR   I+ +
Sbjct: 532 GWPMGPAYLMDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDAL 575


>pdb|1KGZ|A Chain A, Crystal Structure Analysis Of The Anthranilate
           Phosphoribosyltransferase From Erwinia Carotovora
           (current Name, Pectobacterium Carotovorum)
 pdb|1KGZ|B Chain B, Crystal Structure Analysis Of The Anthranilate
           Phosphoribosyltransferase From Erwinia Carotovora
           (current Name, Pectobacterium Carotovorum)
 pdb|1KHD|A Chain A, Crystal Structure Analysis Of The Anthranilate
           Phosphoribosyltransferase From Erwinia Carotovora At 1.9
           Resolution (Current Name, Pectobacterium Carotovorum)
 pdb|1KHD|B Chain B, Crystal Structure Analysis Of The Anthranilate
           Phosphoribosyltransferase From Erwinia Carotovora At 1.9
           Resolution (Current Name, Pectobacterium Carotovorum)
 pdb|1KHD|C Chain C, Crystal Structure Analysis Of The Anthranilate
           Phosphoribosyltransferase From Erwinia Carotovora At 1.9
           Resolution (Current Name, Pectobacterium Carotovorum)
 pdb|1KHD|D Chain D, Crystal Structure Analysis Of The Anthranilate
           Phosphoribosyltransferase From Erwinia Carotovora At 1.9
           Resolution (Current Name, Pectobacterium Carotovorum)
          Length = 345

 Score = 27.3 bits (59), Expect = 1.9,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%)

Query: 26  QGDTPREDRDWGINQI----DAVRSRPDERNQFIVLTTFGEHTLHH 67
           QG TP E+RD     +    DA  +R    N  ++L  FG+  L H
Sbjct: 275 QGGTPEENRDILARLLQGKGDAAHARQVAANVALLLKLFGQDNLRH 320


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.143    0.491 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,927,996
Number of Sequences: 62578
Number of extensions: 101086
Number of successful extensions: 240
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 238
Number of HSP's gapped (non-prelim): 5
length of query: 82
length of database: 14,973,337
effective HSP length: 51
effective length of query: 31
effective length of database: 11,781,859
effective search space: 365237629
effective search space used: 365237629
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)