BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy6224
(82 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3HT4|A Chain A, Crystal Structure Of The Q81a77_baccr Protein From
Bacillus Cereus. Northeast Structural Genomics
Consortium Target Bcr213
pdb|3HT4|B Chain B, Crystal Structure Of The Q81a77_baccr Protein From
Bacillus Cereus. Northeast Structural Genomics
Consortium Target Bcr213
pdb|3HT4|C Chain C, Crystal Structure Of The Q81a77_baccr Protein From
Bacillus Cereus. Northeast Structural Genomics
Consortium Target Bcr213
pdb|3HT4|D Chain D, Crystal Structure Of The Q81a77_baccr Protein From
Bacillus Cereus. Northeast Structural Genomics
Consortium Target Bcr213
pdb|3HT4|E Chain E, Crystal Structure Of The Q81a77_baccr Protein From
Bacillus Cereus. Northeast Structural Genomics
Consortium Target Bcr213
pdb|3HT4|F Chain F, Crystal Structure Of The Q81a77_baccr Protein From
Bacillus Cereus. Northeast Structural Genomics
Consortium Target Bcr213
pdb|3HT4|G Chain G, Crystal Structure Of The Q81a77_baccr Protein From
Bacillus Cereus. Northeast Structural Genomics
Consortium Target Bcr213
pdb|3HT4|H Chain H, Crystal Structure Of The Q81a77_baccr Protein From
Bacillus Cereus. Northeast Structural Genomics
Consortium Target Bcr213
Length = 431
Score = 31.2 bits (69), Expect = 0.13, Method: Composition-based stats.
Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 5/49 (10%)
Query: 39 NQIDAVRSRPDE---RNQFIVLTTFGEHTL--HHLFPTIDHCFLHIAHE 82
+QI V R DE NQF VL +FG+H + H PT + + I +
Sbjct: 20 SQITEVHKRADEVIESNQFRVLESFGKHKISDSHFIPTTGYGYDDIGRD 68
>pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From
Pseudomonas Fragi, Form I (Native2)
pdb|1WDK|B Chain B, Fatty Acid Beta-Oxidation Multienzyme Complex From
Pseudomonas Fragi, Form I (Native2)
pdb|1WDL|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From
Pseudomonas Fragi, Form Ii (Native4)
pdb|1WDL|B Chain B, Fatty Acid Beta-Oxidation Multienzyme Complex From
Pseudomonas Fragi, Form Ii (Native4)
pdb|1WDM|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From
Pseudomonas Fragi, Form I (Native3)
pdb|1WDM|B Chain B, Fatty Acid Beta-Oxidation Multienzyme Complex From
Pseudomonas Fragi, Form I (Native3)
pdb|2D3T|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From
Pseudomonas Fragi, Form V
pdb|2D3T|B Chain B, Fatty Acid Beta-Oxidation Multienzyme Complex From
Pseudomonas Fragi, Form V
Length = 715
Score = 27.7 bits (60), Expect = 1.6, Method: Composition-based stats.
Identities = 13/44 (29%), Positives = 24/44 (54%), Gaps = 5/44 (11%)
Query: 3 GWG---SFLFAVIGVNAAHHHPDIFHQG--DTPREDRDWGINQI 41
GW ++L V+G++ HH D+ +G D ++DR I+ +
Sbjct: 532 GWPMGPAYLMDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAIDAL 575
>pdb|1KGZ|A Chain A, Crystal Structure Analysis Of The Anthranilate
Phosphoribosyltransferase From Erwinia Carotovora
(current Name, Pectobacterium Carotovorum)
pdb|1KGZ|B Chain B, Crystal Structure Analysis Of The Anthranilate
Phosphoribosyltransferase From Erwinia Carotovora
(current Name, Pectobacterium Carotovorum)
pdb|1KHD|A Chain A, Crystal Structure Analysis Of The Anthranilate
Phosphoribosyltransferase From Erwinia Carotovora At 1.9
Resolution (Current Name, Pectobacterium Carotovorum)
pdb|1KHD|B Chain B, Crystal Structure Analysis Of The Anthranilate
Phosphoribosyltransferase From Erwinia Carotovora At 1.9
Resolution (Current Name, Pectobacterium Carotovorum)
pdb|1KHD|C Chain C, Crystal Structure Analysis Of The Anthranilate
Phosphoribosyltransferase From Erwinia Carotovora At 1.9
Resolution (Current Name, Pectobacterium Carotovorum)
pdb|1KHD|D Chain D, Crystal Structure Analysis Of The Anthranilate
Phosphoribosyltransferase From Erwinia Carotovora At 1.9
Resolution (Current Name, Pectobacterium Carotovorum)
Length = 345
Score = 27.3 bits (59), Expect = 1.9, Method: Composition-based stats.
Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 4/46 (8%)
Query: 26 QGDTPREDRDWGINQI----DAVRSRPDERNQFIVLTTFGEHTLHH 67
QG TP E+RD + DA +R N ++L FG+ L H
Sbjct: 275 QGGTPEENRDILARLLQGKGDAAHARQVAANVALLLKLFGQDNLRH 320
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.143 0.491
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,927,996
Number of Sequences: 62578
Number of extensions: 101086
Number of successful extensions: 240
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 238
Number of HSP's gapped (non-prelim): 5
length of query: 82
length of database: 14,973,337
effective HSP length: 51
effective length of query: 31
effective length of database: 11,781,859
effective search space: 365237629
effective search space used: 365237629
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 45 (21.9 bits)