Query         psy6224
Match_columns 82
No_of_seqs    35 out of 37
Neff          2.9 
Searched_HMMs 46136
Date          Fri Aug 16 20:53:49 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6224.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6224hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4232|consensus               99.5   2E-16 4.4E-21  128.8  -3.1   73    4-81    313-386 (430)
  2 cd03507 Delta12-FADS-like The   98.1   6E-07 1.3E-11   65.2   0.1   68    4-76    153-221 (222)
  3 cd03506 Delta6-FADS-like The D  97.8 3.3E-06 7.1E-11   59.7  -0.5   65   14-81    127-192 (204)
  4 PF00487 FA_desaturase:  Fatty   97.8 4.9E-06 1.1E-10   55.3   0.1   53   28-81    186-239 (257)
  5 PLN02505 omega-6 fatty acid de  96.7 0.00049 1.1E-08   55.0   0.4   61   16-82    272-334 (381)
  6 PLN03198 delta6-acyl-lipid des  95.8 0.00097 2.1E-08   55.2  -2.2   62   13-81    419-481 (526)
  7 PLN02498 omega-3 fatty acid de  95.4  0.0064 1.4E-07   50.3   1.1   57   20-82    334-391 (450)
  8 PLN02598 omega-6 fatty acid de  95.1  0.0043 9.3E-08   50.3  -0.7   62   16-82    297-360 (421)
  9 PLN03199 delta6-acyl-lipid des  92.0   0.034 7.4E-07   45.2  -0.7   63   14-80    369-436 (485)
 10 cd03511 Rhizopine-oxygenase-li  91.8   0.046 9.9E-07   40.4  -0.2   24   58-81    243-266 (285)
 11 cd03510 Rhizobitoxine-FADS-lik  91.7   0.052 1.1E-06   38.4   0.1   25   58-82    149-173 (175)
 12 COG3239 DesA Fatty acid desatu  91.3   0.032 6.9E-07   43.5  -1.5   49   32-81    240-289 (343)
 13 cd03514 CrtR_beta-carotene-hyd  90.4   0.081 1.8E-06   38.2   0.0   23   59-81    173-195 (207)
 14 cd03513 CrtW_beta-carotene-ket  89.6   0.086 1.9E-06   39.4  -0.4   65    3-80    159-224 (225)
 15 PF12073 DUF3553:  Protein of u  86.7     0.4 8.7E-06   29.9   1.3   22   26-47      3-26  (52)
 16 cd01060 Membrane-FADS-like The  86.0    0.23   5E-06   31.0  -0.0   14   57-70    108-122 (122)
 17 cd03509 DesA_FADS-like Fatty a  84.7    0.32 6.9E-06   37.2   0.2   24   59-82    228-251 (288)
 18 cd03508 Delta4-sphingolipid-FA  77.8    0.82 1.8E-05   35.2   0.3   28   55-82    225-252 (289)
 19 PLN02579 sphingolipid delta-4   73.9     1.1 2.5E-05   35.2   0.2   28   55-82    253-280 (323)
 20 PF00067 p450:  Cytochrome P450  51.2     6.4 0.00014   27.9   0.5   23   12-34    365-387 (463)
 21 smart00546 CUE Domain that may  41.6     6.4 0.00014   21.8  -0.5   19   63-81      7-25  (43)
 22 PLN02500 cytochrome P450 90B1   37.4      15 0.00033   28.5   0.8   24   11-34    385-408 (490)
 23 PLN02687 flavonoid 3'-monooxyg  34.7      17 0.00036   28.6   0.6   24   11-34    399-422 (517)
 24 PLN02220 delta-9 acyl-lipid de  34.5     8.1 0.00018   30.4  -1.2   20   52-71    233-254 (299)
 25 PTZ00404 cytochrome P450; Prov  33.8      17 0.00037   28.0   0.5   23   12-34    387-409 (482)
 26 PF10848 DUF2655:  Protein of u  33.5      30 0.00065   23.3   1.6   52   13-64     16-76  (82)
 27 PLN03141 3-epi-6-deoxocathaste  32.9      19 0.00041   27.7   0.7   24   11-34    356-379 (452)
 28 PF00799 Gemini_AL1:  Geminivir  32.2      11 0.00024   26.0  -0.7   10   33-42    104-113 (114)
 29 PLN02655 ent-kaurene oxidase    30.8      20 0.00043   27.8   0.5   25   11-35    363-387 (466)
 30 cd03505 Delta9-FADS-like The D  29.8     9.4  0.0002   28.0  -1.4   21   51-71    125-147 (178)
 31 PLN03112 cytochrome P450 famil  28.1      25 0.00054   27.4   0.6   26   11-36    398-423 (514)
 32 PF05304 DUF728:  Protein of un  27.9      19 0.00041   25.3  -0.1   12   30-41     90-101 (103)
 33 PF02845 CUE:  CUE domain;  Int  27.2      18 0.00039   20.0  -0.3   18   64-81      7-24  (42)
 34 KOG3635|consensus               27.1      21 0.00045   33.4  -0.0   26   19-44    123-148 (1150)
 35 PRK15137 DNA-specific endonucl  25.5      26 0.00057   27.4   0.3    9   64-72    118-126 (235)
 36 TIGR00622 ssl1 transcription f  25.5      27 0.00059   24.5   0.3   10   63-72     33-42  (112)
 37 PLN02774 brassinosteroid-6-oxi  24.9      28 0.00061   26.9   0.3   24   11-34    368-391 (463)
 38 PF04231 Endonuclease_1:  Endon  24.5      22 0.00049   26.7  -0.2    9   64-72    106-114 (218)
 39 COG2124 CypX Cytochrome P450 [  23.8      32 0.00069   26.8   0.5   24   11-34    321-344 (411)
 40 PLN02302 ent-kaurenoic acid ox  23.1      34 0.00074   26.1   0.5   24   11-34    392-415 (490)
 41 COG1398 OLE1 Fatty-acid desatu  22.9      61  0.0013   26.3   1.9   22   51-72    224-248 (289)
 42 PLN02183 ferulate 5-hydroxylas  22.0      40 0.00088   26.5   0.7   24   11-34    405-428 (516)
 43 PLN02196 abscisic acid 8'-hydr  20.8      34 0.00075   26.5   0.1   23   12-34    369-391 (463)

No 1  
>KOG4232|consensus
Probab=99.54  E-value=2e-16  Score=128.79  Aligned_cols=73  Identities=29%  Similarity=0.470  Sum_probs=65.7

Q ss_pred             eeehhhhhhcccccccCCCccCCCCCCCCCCCceeeeeeehcccccc-cceeeEeeecCchhhhhccCCCCcccccccc
Q psy6224           4 WGSFLFAVIGVNAAHHHPDIFHQGDTPREDRDWGINQIDAVRSRPDE-RNQFIVLTTFGEHTLHHLFPTIDHCFLHIAH   81 (82)
Q Consensus         4 ~~Sf~F~~iGl~AaHHhp~ifhdGD~~r~d~DwGi~qldtv~dR~d~-~s~F~vlt~FGdH~LHHLFPTlDH~~L~~~~   81 (82)
                      .++++|..+ ++++|+.|+|||+|+ ++  +||+.+|++|++||.+. .+++++. .+|.++.||||||++++-|+-++
T Consensus       313 ~~~~s~~v~-l~~nH~~~~i~~~~~-i~--~dw~~~Q~~tT~n~~~~~f~dwl~g-hln~qieHHLFPtmpr~nL~~v~  386 (430)
T KOG4232|consen  313 FSSWSFWVT-LTMNHIDPEIYHEGD-IR--RDWFSLQLATTINVGPSKFSDWLSG-HLNFQIEHHLFPTMPRHNLNKVA  386 (430)
T ss_pred             HHHHHHHHH-HhhhccchhhccCCc-ch--hhHHHHHHhhccccCchhHHHHHHh-hhhhhHHhhcCCCCCccchHHHH
Confidence            445555555 999999999999999 77  99999999999999999 9999999 99999999999999999987653


No 2  
>cd03507 Delta12-FADS-like The Delta12 Fatty Acid Desaturase (Delta12-FADS)-like CD includes the integral-membrane enzymes, delta-12 acyl-lipid desaturases, oleate 12-hydroxylases, omega3 and omega6 fatty acid desaturases, and other related proteins, found in a wide range of organisms including higher plants, green algae, diatoms, nematodes, fungi, and bacteria. The expression of these proteins appears to be temperature dependent: decreases in temperature result in increased levels of fatty acid desaturation within membrane lipids subsequently altering cell membrane fluidity. An important enzyme for the production of polyunsaturates in plants is the oleate delta-12 desaturase (Arabidopsis FAD2) of the endoplasmic reticulum. This enzyme accepts l-acyl-2-oleoyl-sn-glycero-3-phosphocholine as substrate and requires NADH:cytochrome b oxidoreductase, cytochrome b, and oxygen for activity. FAD2 converts oleate(18:1) to linoleate (18:2) and is closely related to oleate 12-hydroxylase which cat
Probab=98.11  E-value=6e-07  Score=65.20  Aligned_cols=68  Identities=21%  Similarity=0.283  Sum_probs=53.8

Q ss_pred             eeehhhhhhcccccccCCCccCCCCCCCCCCCceeeeeeehcccccc-cceeeEeeecCchhhhhccCCCCccc
Q psy6224           4 WGSFLFAVIGVNAAHHHPDIFHQGDTPREDRDWGINQIDAVRSRPDE-RNQFIVLTTFGEHTLHHLFPTIDHCF   76 (82)
Q Consensus         4 ~~Sf~F~~iGl~AaHHhp~ifhdGD~~r~d~DwGi~qldtv~dR~d~-~s~F~vlt~FGdH~LHHLFPTlDH~~   76 (82)
                      +.++..+ +.+-.-|.+|++-++++   ++.+|+..|+.+.+||+.. ...++.- ++|.|..|||||++-+..
T Consensus       153 ~~~~~l~-~~t~l~H~~~~~~~~~~---~~w~~~~~q~~~t~~~~~~~~~~~l~~-~i~~hv~HHlfP~iP~y~  221 (222)
T cd03507         153 VVNAWLV-LITYLQHTFPDIPWYRA---DEWNFAQAGLLGTVDRDYGGWLNWLTH-IIGTHVAHHLFPRIPHYN  221 (222)
T ss_pred             HHHHHHH-eeeEecCCCCCCCCcCc---cccchhhhcceeeeeccccHHHHHHhc-CCCcccchhcCCCCCcCc
Confidence            3455555 77888999999988876   6678889999999999655 4455555 999999999999986653


No 3  
>cd03506 Delta6-FADS-like The Delta6 Fatty Acid Desaturase (Delta6-FADS)-like CD includes the integral-membrane enzymes: delta-4, delta-5, delta-6, delta-8, delta-8-sphingolipid, and delta-11 desaturases found in vertebrates, higher plants, fungi, and bacteria. These desaturases are required for the synthesis of highly unsaturated fatty acids (HUFAs), which are mainly esterified into phospholipids and contribute to maintaining membrane fluidity. While HUFAs may be required for cold tolerance in bacteria, plants and fish, the primary role of HUFAs in mammals is cell signaling. These enzymes are described as front-end desaturases because they introduce a double bond between the pre-exiting double bond and the carboxyl (front) end of the fatty acid. Various substrates are involved, with both acyl-coenzyme A (CoA) and acyl-lipid desaturases present in this CD. Acyl-lipid desaturases are localized in the membranes of cyanobacterial thylakoid, plant endoplasmic reticulum (ER), and plastid; an
Probab=97.81  E-value=3.3e-06  Score=59.67  Aligned_cols=65  Identities=17%  Similarity=0.206  Sum_probs=50.1

Q ss_pred             ccccccCCCccCCCCCCCCCCCceeeeeeehcccccc-cceeeEeeecCchhhhhccCCCCcccccccc
Q psy6224          14 VNAAHHHPDIFHQGDTPREDRDWGINQIDAVRSRPDE-RNQFIVLTTFGEHTLHHLFPTIDHCFLHIAH   81 (82)
Q Consensus        14 l~AaHHhp~ifhdGD~~r~d~DwGi~qldtv~dR~d~-~s~F~vlt~FGdH~LHHLFPTlDH~~L~~~~   81 (82)
                      +...|...++....+  +++.||...|+.|.+|+... ...++ .-+++-|+.|||||++-+..||++.
T Consensus       127 ~~~~H~~~~~~~~~~--~~~~~w~~~q~~tt~~~~~~~~~~~l-~ggln~qieHHLfP~ip~~~l~~~~  192 (204)
T cd03506         127 FQLNHFGMPVEDPPG--ESKNDWLERQVLTTRNITGSPFLDWL-HGGLNYQIEHHLFPTMPRHNYPKVA  192 (204)
T ss_pred             eecccccccccCCCC--CcccCHHHHHHhCcccCCCCCHHHHH-hcchhhHHHHhcCCCchhhhHHHHH
Confidence            446677777776411  36779999999999999544 44444 4688999999999999999999864


No 4  
>PF00487 FA_desaturase:  Fatty acid desaturase This entry is only a subset of the Pfam family.;  InterPro: IPR005804  Fatty acid desaturases are enzymes that catalyse the insertion of a double bond at the delta position of fatty acids. There seem to be two distinct families of fatty acid desaturases which do not seem to be evolutionary related. Family 1 is composed of:  Stearoyl-CoA desaturase (SCD) (1.14.19.1 from EC) [].    Family 2 is composed of:  Bacterial fatty acid desaturases. Plant stearoyl-acyl-carrier-protein desaturase (1.14.19.1 from EC) [], this enzyme catalyzes the introduction of a double bond at the delta(9) position of steraoyl-ACP to produce oleoyl-ACP. This enzyme is responsible for the conversion of saturated fatty acids to unsaturated fatty acids in the synthesis of vegetable oils. Cyanobacterial DesA [], an enzyme that can introduce a second cis double bond at the delta(12) position of fatty acid bound to membranes glycerolipids. DesA is involved in chilling tolerance; the phase transition temperature of lipids of cellular membranes being dependent on the degree of unsaturation of fatty acids of the membrane lipids.  This entry contains fatty acid desaturases belonging to Family 1. ; GO: 0006629 lipid metabolic process
Probab=97.80  E-value=4.9e-06  Score=55.27  Aligned_cols=53  Identities=25%  Similarity=0.355  Sum_probs=41.7

Q ss_pred             CCCCCCCCceeeeeeehcccccc-cceeeEeeecCchhhhhccCCCCcccccccc
Q psy6224          28 DTPREDRDWGINQIDAVRSRPDE-RNQFIVLTTFGEHTLHHLFPTIDHCFLHIAH   81 (82)
Q Consensus        28 D~~r~d~DwGi~qldtv~dR~d~-~s~F~vlt~FGdH~LHHLFPTlDH~~L~~~~   81 (82)
                      +...++.+|..-|+.+..+.... ...+ ..-++|-|+.||+||++....||++.
T Consensus       186 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~H~~HHl~P~vp~~~l~~~~  239 (257)
T PF00487_consen  186 DDNEDTRDFYYRQLPGSSNVHNSWWLNW-LTGGLNYHIEHHLFPGVPWYNLPEAH  239 (257)
T ss_pred             cccccccceecccccccccccCchhhhc-cccCCCChHHhCCCCCcCHHHHHHHH
Confidence            44457788999999988886555 3344 46678999999999999999999874


No 5  
>PLN02505 omega-6 fatty acid desaturase
Probab=96.69  E-value=0.00049  Score=55.04  Aligned_cols=61  Identities=28%  Similarity=0.421  Sum_probs=48.8

Q ss_pred             ccccCCCccCCCCCCCCCCCceeeeeeehcccccc-cceeeEeeecC-chhhhhccCCCCccccccccC
Q psy6224          16 AAHHHPDIFHQGDTPREDRDWGINQIDAVRSRPDE-RNQFIVLTTFG-EHTLHHLFPTIDHCFLHIAHE   82 (82)
Q Consensus        16 AaHHhp~ifhdGD~~r~d~DwGi~qldtv~dR~d~-~s~F~vlt~FG-dH~LHHLFPTlDH~~L~~~~~   82 (82)
                      .=|.+|++.+..+   ++.+|---||.| +|| +. .-.+ .+-+.| .|..|||||.+-+--|++|.|
T Consensus       272 lqHt~~~ip~~~~---~~W~~~rgAl~t-vdr-~yg~~~~-l~h~I~~~Hv~HHl~srIP~Y~l~eA~~  334 (381)
T PLN02505        272 LQHTHPALPHYDS---SEWDWLRGALAT-VDR-DYGILNK-VFHNITDTHVAHHLFSTMPHYHAMEATK  334 (381)
T ss_pred             HhccCCCCCccCC---CCcChhhcccee-ccC-cchHHHH-HHccCCcccchhhccCCCCCCCHHHHHH
Confidence            4588999999866   888899999977 788 44 2222 456666 999999999999999999964


No 6  
>PLN03198 delta6-acyl-lipid desaturase; Provisional
Probab=95.84  E-value=0.00097  Score=55.17  Aligned_cols=62  Identities=19%  Similarity=0.303  Sum_probs=46.7

Q ss_pred             cccccccCCCccCCCCCCCCCCCceeeeeeehcccccc-cceeeEeeecCchhhhhccCCCCcccccccc
Q psy6224          13 GVNAAHHHPDIFHQGDTPREDRDWGINQIDAVRSRPDE-RNQFIVLTTFGEHTLHHLFPTIDHCFLHIAH   81 (82)
Q Consensus        13 Gl~AaHHhp~ifhdGD~~r~d~DwGi~qldtv~dR~d~-~s~F~vlt~FGdH~LHHLFPTlDH~~L~~~~   81 (82)
                      =+...|-..+++      .++.||-..|+.|.+|=..- ...| ..-+.+-|+-|||||++-+..||+|.
T Consensus       419 vF~lnH~~~~v~------~~~~dw~~~Qv~tT~n~~~~~~~~w-f~GGLN~QiEHHLFP~iP~~~l~~i~  481 (526)
T PLN03198        419 VFVLSHNGMEVY------NKSKEFVNAQIVSTRDIKANIFNDW-FTGGLNRQIEHHLFPTMPRHNLNKIA  481 (526)
T ss_pred             hhhccccCCCCC------CCCcCHHHHHHhcCcCcCCchHHHH-hhcCCcccchhhcCCCCchhhHHHHh
Confidence            366778887775      12338999999999885422 3333 34678999999999999999999874


No 7  
>PLN02498 omega-3 fatty acid desaturase
Probab=95.40  E-value=0.0064  Score=50.33  Aligned_cols=57  Identities=25%  Similarity=0.343  Sum_probs=41.6

Q ss_pred             CCCccCCCCCCCCCCCceeeeeeehcccccc-cceeeEeeecCchhhhhccCCCCccccccccC
Q psy6224          20 HPDIFHQGDTPREDRDWGINQIDAVRSRPDE-RNQFIVLTTFGEHTLHHLFPTIDHCFLHIAHE   82 (82)
Q Consensus        20 hp~ifhdGD~~r~d~DwGi~qldtv~dR~d~-~s~F~vlt~FGdH~LHHLFPTlDH~~L~~~~~   82 (82)
                      +|++=+-.+   ++.+|---|| +.+|| |. +-.+ ..-+-|.|..|||||.+-|--|++|.|
T Consensus       334 ~~~iP~y~~---~eWs~~rGaL-~TvDR-~yg~i~~-l~H~I~tHV~HHlf~~IPhYhl~eAt~  391 (450)
T PLN02498        334 EDKLPWYRG---KEWSYLRGGL-TTLDR-DYGWINN-IHHDIGTHVIHHLFPQIPHYHLVEATE  391 (450)
T ss_pred             CCCCCCCCC---CCcchhhccc-eeecC-cccchhh-hhcCcccchhhhccCCCCCcCHHHHHH
Confidence            466654433   5777777788 68899 65 3333 233678999999999999999999864


No 8  
>PLN02598 omega-6 fatty acid desaturase
Probab=95.12  E-value=0.0043  Score=50.31  Aligned_cols=62  Identities=21%  Similarity=0.252  Sum_probs=43.1

Q ss_pred             ccccCCCccCCCCCCCCCCCceeeeeeehcccccc--cceeeEeeecCchhhhhccCCCCccccccccC
Q psy6224          16 AAHHHPDIFHQGDTPREDRDWGINQIDAVRSRPDE--RNQFIVLTTFGEHTLHHLFPTIDHCFLHIAHE   82 (82)
Q Consensus        16 AaHHhp~ifhdGD~~r~d~DwGi~qldtv~dR~d~--~s~F~vlt~FGdH~LHHLFPTlDH~~L~~~~~   82 (82)
                      .-|.+|++-++.+   ++.+|.--|+...++| |.  +..+ ..=+.|-|..|||||++-+..||++.+
T Consensus       297 lhHt~p~ip~~~~---~eW~~~~~al~~Tv~~-~~~~~~~~-L~hnIn~HV~HHLfP~IP~Y~lpea~~  360 (421)
T PLN02598        297 VHHTAPHIPFKQA---REWNAAQAQLNGTVHC-DYPAWIEF-LCHDISVHIPHHISSKIPSYNLRKAHA  360 (421)
T ss_pred             HhhcCCCCCcccc---ccccHhhhhhcCceec-CCcHHHHH-HHcCCccchhhhcCCCCCcchHHHHHH
Confidence            4577888877433   4444444566667777 44  3222 445778999999999999999998853


No 9  
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional
Probab=92.03  E-value=0.034  Score=45.21  Aligned_cols=63  Identities=17%  Similarity=0.230  Sum_probs=44.0

Q ss_pred             ccccccCCCccCCCCCCCCCCCceeeeeeehccccc-cc--cee--eEeeecCchhhhhccCCCCccccccc
Q psy6224          14 VNAAHHHPDIFHQGDTPREDRDWGINQIDAVRSRPD-ER--NQF--IVLTTFGEHTLHHLFPTIDHCFLHIA   80 (82)
Q Consensus        14 l~AaHHhp~ifhdGD~~r~d~DwGi~qldtv~dR~d-~~--s~F--~vlt~FGdH~LHHLFPTlDH~~L~~~   80 (82)
                      +..+|..-+++.+ +   +..||...|+.|.+|=.- .+  |.|  ...-..+-+.-|||||++-|..+|++
T Consensus       369 f~l~H~~~~~~~~-~---~~~d~~~~Qv~TT~n~~~~~~~~s~~~~wf~GGLN~QIEHHLFP~mp~~~y~~i  436 (485)
T PLN03199        369 FGLGHNGMATYDA-D---ARPDFWKLQVTTTRNIIGGHGFPQAFVDWFCGGLQYQVDHHLFPMLPRHNIAKC  436 (485)
T ss_pred             EecCCccccccCC-C---CCccHHHHHHHhccCccCCCCCcchHHHHHhccchhhhhhhcCCCCchhhHHhh
Confidence            4567776666533 3   344899999999987631 00  222  22356788999999999999999875


No 10 
>cd03511 Rhizopine-oxygenase-like This CD includes the putative hydrocarbon oxygenase, MocD, a bacterial rhizopine (3-O-methyl-scyllo-inosamine, 3-O-MSI) oxygenase, and other related proteins. It has been proposed that MocD, MocE (Rieske-like ferredoxin), and MocF (ferredoxin reductase) under the regulation of MocR, act in concert to form a ferredoxin oxygenase system that demethylates 3-O-MSI to form scyllo-inosamine.  This domain family appears to be structurally related to the membrane fatty acid desaturases and the alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA d
Probab=91.75  E-value=0.046  Score=40.39  Aligned_cols=24  Identities=25%  Similarity=0.437  Sum_probs=21.9

Q ss_pred             eecCchhhhhccCCCCcccccccc
Q psy6224          58 TTFGEHTLHHLFPTIDHCFLHIAH   81 (82)
Q Consensus        58 t~FGdH~LHHLFPTlDH~~L~~~~   81 (82)
                      -++|-|+-||+||++-+..||++.
T Consensus       243 ~n~nyH~eHHl~P~vP~y~Lp~~h  266 (285)
T cd03511         243 WNMPYHAEHHMYPSVPFHALPKLH  266 (285)
T ss_pred             cCCchHHHHhcCCCCcHhHHHHHH
Confidence            588999999999999999999865


No 11 
>cd03510 Rhizobitoxine-FADS-like This CD includes the dihydrorhizobitoxine fatty acid desaturase (RtxC) characterized in Bradyrhizobium japonicum USDA110, and other related proteins. Dihydrorhizobitoxine desaturase is reported to be involved in the final step of rhizobitoxine biosynthesis. This domain family appears to be structurally related to the membrane fatty acid desaturases and the alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXX(X)HH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA desaturase and alkane hydroxylase.
Probab=91.74  E-value=0.052  Score=38.38  Aligned_cols=25  Identities=36%  Similarity=0.538  Sum_probs=22.2

Q ss_pred             eecCchhhhhccCCCCccccccccC
Q psy6224          58 TTFGEHTLHHLFPTIDHCFLHIAHE   82 (82)
Q Consensus        58 t~FGdH~LHHLFPTlDH~~L~~~~~   82 (82)
                      -++|-|..|||||++-.-.||++++
T Consensus       149 ~~~~YH~eHHl~P~vP~~~Lp~~h~  173 (175)
T cd03510         149 HNINYHLEHHLFPAVPFYNLPKAHR  173 (175)
T ss_pred             cCCcHHHHHhCCcCCchhhHHHHHH
Confidence            4899999999999999999988753


No 12 
>COG3239 DesA Fatty acid desaturase [Lipid metabolism]
Probab=91.27  E-value=0.032  Score=43.52  Aligned_cols=49  Identities=29%  Similarity=0.401  Sum_probs=37.5

Q ss_pred             CCCCceeeeeeehcccccc-cceeeEeeecCchhhhhccCCCCcccccccc
Q psy6224          32 EDRDWGINQIDAVRSRPDE-RNQFIVLTTFGEHTLHHLFPTIDHCFLHIAH   81 (82)
Q Consensus        32 ~d~DwGi~qldtv~dR~d~-~s~F~vlt~FGdH~LHHLFPTlDH~~L~~~~   81 (82)
                      +|.+|..-|+.+.++. +. +-.-...=+.|-|..|||||.|-.-.||++.
T Consensus       240 ~d~~~~~~~l~~~~~~-~~~~~~~~l~~n~nyH~~HHl~P~vP~y~lp~~~  289 (343)
T COG3239         240 EDWQWSDRALNARSNV-DAPPLLRFLTGNINYHVEHHLFPDVPWYRLPRAH  289 (343)
T ss_pred             ccchHHHHHHhccCcc-CchHHHHHhcCCccccHhhhCCCCCchhhHHHHH
Confidence            6777798998877633 33 3333455689999999999999999998875


No 13 
>cd03514 CrtR_beta-carotene-hydroxylase Beta-carotene hydroxylase (CrtR), the carotenoid zeaxanthin biosynthetic enzyme catalyzes the addition of hydroxyl groups to the beta-ionone rings of beta-carotene to form zeaxanthin and is found in bacteria and red algae. Carotenoids are important natural pigments; zeaxanthin and lutein are the only dietary carotenoids that accumulate in the macular region of the retina and lens. It is proposed that these carotenoids protect ocular tissues against photooxidative damage. CrtR does not show overall amino acid sequence similarity to the beta-carotene hydroxylases similar to CrtZ, an astaxanthin biosynthetic beta-carotene hydroxylase. However, CrtR does show sequence similarity to the green alga, Haematococcus pluvialis, beta-carotene ketolase (CrtW), which converts beta-carotene to canthaxanthin. Sequences of the CrtR_beta-carotene-hydroxylase domain family, as well as, the CrtW_beta-carotene-ketolase domain family appear to be structurally related 
Probab=90.44  E-value=0.081  Score=38.23  Aligned_cols=23  Identities=30%  Similarity=0.355  Sum_probs=20.3

Q ss_pred             ecCchhhhhccCCCCcccccccc
Q psy6224          59 TFGEHTLHHLFPTIDHCFLHIAH   81 (82)
Q Consensus        59 ~FGdH~LHHLFPTlDH~~L~~~~   81 (82)
                      +.|-|.-|||||.+-+..||+|.
T Consensus       173 ~~nyH~~HHL~P~IP~y~Lp~a~  195 (207)
T cd03514         173 GQNYHLVHHLWPSIPWYRYPEAY  195 (207)
T ss_pred             CCchhHHHhCCCCCchhhhHHHH
Confidence            34589999999999999999986


No 14 
>cd03513 CrtW_beta-carotene-ketolase Beta-carotene ketolase/oxygenase (CrtW, also known as CrtO), the carotenoid astaxanthin biosynthetic enzyme, initially catalyzes the addition of two keto groups to carbons C4 and C4' of beta-carotene. Carotenoids are important natural pigments produced by many microorganisms and plants. Astaxanthin is reported to be an antioxidant, an anti-cancer agent, and an immune system stimulant. A number of bacteria and green algae can convert beta-carotene into astaxanthin by using several ketocarotenoids as intermediates and CrtW and a beta-carotene hydroxylase (CrtZ). CrtW initially converts beta-carotene to canthaxanthin via echinenone, and CrtZ initially mediates the conversion of beta-carotene to zeaxanthin via beta-cryptoxanthin. After a few more intermediates are formed, CrtW and CrtZ act in combination to produce astaxanthin. Sequences of this domain family appear to be structurally related to membrane fatty acid desaturases and alkane hydroxylases. Th
Probab=89.61  E-value=0.086  Score=39.41  Aligned_cols=65  Identities=25%  Similarity=0.202  Sum_probs=39.2

Q ss_pred             eeeehhhhhhcccccccCCCccCCCCCCCCCCCceeeeeeehcccc-cccceeeEeeecCchhhhhccCCCCccccccc
Q psy6224           3 GWGSFLFAVIGVNAAHHHPDIFHQGDTPREDRDWGINQIDAVRSRP-DERNQFIVLTTFGEHTLHHLFPTIDHCFLHIA   80 (82)
Q Consensus         3 ~~~Sf~F~~iGl~AaHHhp~ifhdGD~~r~d~DwGi~qldtv~dR~-d~~s~F~vlt~FGdH~LHHLFPTlDH~~L~~~   80 (82)
                      +++|+.-+++|=+-.|+.++.      +..+..       ..+..+ -.+-.|+.--+||-|.-||+||.+-.-.||+|
T Consensus       159 l~~~~~l~~f~T~lpH~~~~~------~~~~~~-------~a~~~~~~~~~~~l~c~~fgyH~eHH~fP~~Pw~~Lp~~  224 (225)
T cd03513         159 ILSSLQLFYFGTWLPHRPGRG------GFADRH-------RARSSRLSPVLSFLTCYHFGYHHEHHLSPSTPWWRLPEL  224 (225)
T ss_pred             HHHHHHHHHHHhhcCCCCCCC------CCCCcc-------cceecCccHHHHHHHHHhcCcchhhccCCCCCcccCccc
Confidence            457777788888877875441      111111       111110 01222222236999999999999999999987


No 15 
>PF12073 DUF3553:  Protein of unknown function (DUF3553);  InterPro: IPR021938  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are about 60 amino acids in length. This protein has two conserved sequence motifs: GQVQS and TVNF. 
Probab=86.70  E-value=0.4  Score=29.92  Aligned_cols=22  Identities=32%  Similarity=0.602  Sum_probs=18.3

Q ss_pred             CCCCCC--CCCCceeeeeeehccc
Q psy6224          26 QGDTPR--EDRDWGINQIDAVRSR   47 (82)
Q Consensus        26 dGD~~r--~d~DwGi~qldtv~dR   47 (82)
                      .|+..|  +-.|||+-|+++.++.
T Consensus         3 pG~~VrHP~~pdWG~GqVqS~i~~   26 (52)
T PF12073_consen    3 PGMLVRHPDHPDWGIGQVQSNIGG   26 (52)
T ss_pred             CCCEEeCCCCCCCcceEEEEecCC
Confidence            577666  7889999999998776


No 16 
>cd01060 Membrane-FADS-like The membrane fatty acid desaturase (Membrane_FADS)-like CD includes membrane FADSs, alkane hydroxylases, beta carotene ketolases (CrtW-like), hydroxylases (CrtR-like), and other related proteins. They are present in all groups of organisms with the exception of archaea. Membrane FADSs are non-heme, iron-containing, oxygen-dependent enzymes involved in regioselective introduction of double bonds in fatty acyl aliphatic chains. They play an important role in the maintenance of the proper structure and functioning of biological membranes. Alkane hydroxylases are bacterial, integral-membrane di-iron enzymes that share a requirement for iron and oxygen for activity similar to that of membrane FADSs, and are involved in the initial oxidation of inactivated alkanes. Beta-carotene ketolase and beta-carotene hydroxylase are carotenoid biosynthetic enzymes for astaxanthin and zeaxanthin, respectively. This superfamily domain has extensive hydrophobic regions that would
Probab=85.97  E-value=0.23  Score=31.01  Aligned_cols=14  Identities=64%  Similarity=1.084  Sum_probs=11.9

Q ss_pred             eee-cCchhhhhccC
Q psy6224          57 LTT-FGEHTLHHLFP   70 (82)
Q Consensus        57 lt~-FGdH~LHHLFP   70 (82)
                      +++ ++-|..|||||
T Consensus       108 ~~~g~~~H~~HHl~P  122 (122)
T cd01060         108 LTGGLGYHNEHHLFP  122 (122)
T ss_pred             HhcccccccccccCc
Confidence            344 89999999999


No 17 
>cd03509 DesA_FADS-like Fatty acid desaturase protein family subgroup, a delta-12 acyl-lipid desaturase-like, DesA-like, yet uncharacterized subgroup of membrane fatty acid desaturase proteins found in alpha-, beta-, and gamma-proteobacteria. Sequences of this domain family appear to be structurally related to membrane fatty acid desaturases and alkane hydroxylases. They all share in common extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of these sequences also reveals three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for the iron atoms contained within homologs, stearoyl CoA desaturase and alkane hydroxylase.
Probab=84.69  E-value=0.32  Score=37.23  Aligned_cols=24  Identities=25%  Similarity=0.234  Sum_probs=22.2

Q ss_pred             ecCchhhhhccCCCCccccccccC
Q psy6224          59 TFGEHTLHHLFPTIDHCFLHIAHE   82 (82)
Q Consensus        59 ~FGdH~LHHLFPTlDH~~L~~~~~   82 (82)
                      +-|-|.-||++|.+-...||+|++
T Consensus       228 ninyH~~HH~~P~vP~y~Lp~~h~  251 (288)
T cd03509         228 NNNLHVVHHDLPTLPWYDLPRLYR  251 (288)
T ss_pred             cCCchHhhcCCCCCCcccHHHHHH
Confidence            889999999999999999999863


No 18 
>cd03508 Delta4-sphingolipid-FADS-like The Delta4-sphingolipid Fatty Acid Desaturase (Delta4-sphingolipid-FADS)-like CD includes the integral-membrane enzymes, dihydroceramide Delta-4 desaturase, involved in the synthesis of sphingosine; and the human membrane fatty acid (lipid) desaturase (MLD), reported to modulate biosynthesis of the epidermal growth factor receptor; and other related proteins. These proteins are found in various eukaryotes including vertebrates, higher plants, and fungi. Studies show that MLD is localized to the endoplasmic reticulum. As with other members of this superfamily, this domain family has extensive hydrophobic regions that would be capable of spanning the membrane bilayer at least twice. Comparison of sequences also reveals the existence of three regions of conserved histidine cluster motifs that contain eight histidine residues: HXXXH, HXXHH, and HXXHH. These histidine residues are reported to be catalytically essential and proposed to be the ligands for
Probab=77.84  E-value=0.82  Score=35.22  Aligned_cols=28  Identities=29%  Similarity=0.354  Sum_probs=23.9

Q ss_pred             eEeeecCchhhhhccCCCCccccccccC
Q psy6224          55 IVLTTFGEHTLHHLFPTIDHCFLHIAHE   82 (82)
Q Consensus        55 ~vlt~FGdH~LHHLFPTlDH~~L~~~~~   82 (82)
                      ...-+-|-|.-||+||++-.-.||+|.+
T Consensus       225 ~~~~n~~yH~~HH~~p~iP~~~Lp~~~~  252 (289)
T cd03508         225 LLTFNVGYHNEHHDFPYIPGTRLPKLRK  252 (289)
T ss_pred             HHhhccChHHHhcCCCCCCcccHHHHHH
Confidence            3455789999999999999999999863


No 19 
>PLN02579 sphingolipid delta-4 desaturase
Probab=73.95  E-value=1.1  Score=35.17  Aligned_cols=28  Identities=36%  Similarity=0.493  Sum_probs=24.0

Q ss_pred             eEeeecCchhhhhccCCCCccccccccC
Q psy6224          55 IVLTTFGEHTLHHLFPTIDHCFLHIAHE   82 (82)
Q Consensus        55 ~vlt~FGdH~LHHLFPTlDH~~L~~~~~   82 (82)
                      .+.=+-|-|.-||+||.+--..||+|.+
T Consensus       253 ~l~~NigYH~eHH~fP~IP~~~Lp~l~~  280 (323)
T PLN02579        253 LLTWNVGYHNEHHDFPRIPGSKLHKVKE  280 (323)
T ss_pred             HHhhcccccHhhcCCCCCchhhHHHHHH
Confidence            3445789999999999999999999864


No 20 
>PF00067 p450:  Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature;  InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry. In mammals, these proteins are found primarily in microsomes of hepatocytes and other cell types, where they oxidise steroids, fatty acids and xenobiotics, and are important for the detoxification and clearance of various compounds, as well as for hormone synthesis and breakdown, cholesterol synthesis and vitamin D metabolism. In plants, these proteins are important for the biosynthesis of several compounds such as hormones, defensive compounds and fatty acids. In bacteria, they are important for several metabolic processes, such as the biosynthesis of antibiotic erythromycin in Saccharopolyspora erythraea (Streptomyces erythraeus). Cytochrome P450 enzymes use haem to oxidise their substrates, using protons derived from NADH or NADPH to split the oxygen so a single atom can be added to a substrate. They also require electrons, which they receive from a variety of redox partners. In certain cases, cytochrome P450 can be fused to its redox partner to produce a bi-functional protein, such as with P450BM-3 from Bacillus megaterium [], which has haem and flavin domains. Organisms produce many different cytochrome P450 enzymes (at least 58 in humans), which together with alternative splicing can provide a wide array of enzymes with different substrate and tissue specificities. Individual cytochrome P450 proteins follow the nomenclature: CYP, followed by a number (family), then a letter (subfamily), and another number (protein); e.g. CYP3A4 is the fourth protein in family 3, subfamily A. In general, family members should share >40% identity, while subfamily members should share >55% identity. Cytochrome P450 proteins can also be grouped by two different schemes. One scheme was based on a taxonomic split: class I (prokaryotic/mitochondrial) and class II (eukaryotic microsomes). The other scheme was based on the number of components in the system: class B (3-components) and class E (2-components). These classes merge to a certain degree. Most prokaryotes and mitochondria (and fungal CYP55) have 3-component systems (class I/class B) - a FAD-containing flavoprotein (NAD(P)H-dependent reductase), an iron-sulphur protein and P450. Most eukaryotic microsomes have 2-component systems (class II/class E) - NADPH:P450 reductase (FAD and FMN-containing flavoprotein) and P450. There are exceptions to this scheme, such as 1-component systems that resemble class E enzymes [, , ]. The class E enzymes can be further subdivided into five sequence clusters, groups I-V, each of which may contain more than one cytochrome P450 family (eg, CYP1 and CYP2 are both found in group I). The divergence of the cytochrome P450 superfamily into B- and E-classes, and further divergence into stable clusters within the E-class, appears to be very ancient, occurring before the appearance of eukaryotes. More information about these proteins can be found at Protein of the Month: Cytochrome P450 [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 0020037 heme binding, 0055114 oxidation-reduction process; PDB: 2RFC_B 2RFB_A 3EJB_H 3EJE_H 3EJD_H 1N6B_A 1NR6_A 1DT6_A 3EL3_A 3DBG_B ....
Probab=51.25  E-value=6.4  Score=27.86  Aligned_cols=23  Identities=26%  Similarity=0.517  Sum_probs=17.7

Q ss_pred             hcccccccCCCccCCCCCCCCCC
Q psy6224          12 IGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        12 iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      +...++|++|++|.|.+..++++
T Consensus       365 ~~~~~~~~d~~~~~dp~~F~P~R  387 (463)
T PF00067_consen  365 VSIYALHRDPEYFPDPDEFDPER  387 (463)
T ss_dssp             EEHHHHTTSTTTSSSTTS--TTG
T ss_pred             ccccccccccccccccccccccc
Confidence            34678999999999999888766


No 21 
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs). CUE domains also occur in two protein of the IL-1 signal transduction pathway, tollip and TAB2. Ponting (Biochem. J.) "Proteins of the Endoplasmic reticulum" (in press)
Probab=41.64  E-value=6.4  Score=21.84  Aligned_cols=19  Identities=26%  Similarity=0.609  Sum_probs=15.2

Q ss_pred             hhhhhccCCCCcccccccc
Q psy6224          63 HTLHHLFPTIDHCFLHIAH   81 (82)
Q Consensus        63 H~LHHLFPTlDH~~L~~~~   81 (82)
                      ..|.=|||.++...+..|.
T Consensus         7 ~~L~~mFP~l~~~~I~~~L   25 (43)
T smart00546        7 HDLKDMFPNLDEEVIKAVL   25 (43)
T ss_pred             HHHHHHCCCCCHHHHHHHH
Confidence            3567799999999887764


No 22 
>PLN02500 cytochrome P450 90B1
Probab=37.44  E-value=15  Score=28.51  Aligned_cols=24  Identities=17%  Similarity=0.156  Sum_probs=19.8

Q ss_pred             hhcccccccCCCccCCCCCCCCCC
Q psy6224          11 VIGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        11 ~iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      ++...|.||+|++|.|-+..++++
T Consensus       385 ~~~~~~~hrdp~~~~dP~~F~PeR  408 (490)
T PLN02500        385 LPVIAAVHLDSSLYDQPQLFNPWR  408 (490)
T ss_pred             EechhhcccCcccCCCccccChhh
Confidence            456778999999999998887665


No 23 
>PLN02687 flavonoid 3'-monooxygenase
Probab=34.74  E-value=17  Score=28.65  Aligned_cols=24  Identities=25%  Similarity=0.318  Sum_probs=19.9

Q ss_pred             hhcccccccCCCccCCCCCCCCCC
Q psy6224          11 VIGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        11 ~iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      ++...++||+|++|.|.++.++++
T Consensus       399 ~~~~~~~h~d~~~~~dp~~F~PeR  422 (517)
T PLN02687        399 LVNVWAIARDPEQWPDPLEFRPDR  422 (517)
T ss_pred             EEecHHhcCCcccCCCcccCCchh
Confidence            456778999999999999888665


No 24 
>PLN02220 delta-9 acyl-lipid desaturase
Probab=34.49  E-value=8.1  Score=30.41  Aligned_cols=20  Identities=40%  Similarity=0.649  Sum_probs=16.3

Q ss_pred             ceeeEeeecCc--hhhhhccCC
Q psy6224          52 NQFIVLTTFGE--HTLHHLFPT   71 (82)
Q Consensus        52 s~F~vlt~FGd--H~LHHLFPT   71 (82)
                      +-++.+-+||+  |--||-||.
T Consensus       233 ~~~lallt~GEgwHNnHHafP~  254 (299)
T PLN02220        233 VWWLSLFTMGESWHNNHHAFES  254 (299)
T ss_pred             hHHHHHHhccccccccccCCcc
Confidence            45567778887  999999996


No 25 
>PTZ00404 cytochrome P450; Provisional
Probab=33.83  E-value=17  Score=28.03  Aligned_cols=23  Identities=13%  Similarity=0.166  Sum_probs=19.1

Q ss_pred             hcccccccCCCccCCCCCCCCCC
Q psy6224          12 IGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        12 iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      +...|.|++|++|.|-++.++++
T Consensus       387 ~~~~a~hrdp~~~~dP~~F~PeR  409 (482)
T PTZ00404        387 INYYSLGRNEKYFENPEQFDPSR  409 (482)
T ss_pred             eeHHHhhCCccccCCccccCccc
Confidence            44568899999999999988665


No 26 
>PF10848 DUF2655:  Protein of unknown function (DUF2655);  InterPro: IPR020371 This entry contains proteins with no known function.
Probab=33.46  E-value=30  Score=23.30  Aligned_cols=52  Identities=29%  Similarity=0.473  Sum_probs=32.1

Q ss_pred             cccccccCCCccCC-CC--CCCC---CCCceeeeeeehcccccc---cceeeEeeecCchh
Q psy6224          13 GVNAAHHHPDIFHQ-GD--TPRE---DRDWGINQIDAVRSRPDE---RNQFIVLTTFGEHT   64 (82)
Q Consensus        13 Gl~AaHHhp~ifhd-GD--~~r~---d~DwGi~qldtv~dR~d~---~s~F~vlt~FGdH~   64 (82)
                      |-..+|-.|++|-. |.  -+++   -.|--++.-=-|-||+|-   ...|+|||+||.-+
T Consensus        16 ~kq~g~yspe~~~~tgkdcnpqpanclkd~~vlrhccv~drs~kmg~s~~~~vlt~~~~et   76 (82)
T PF10848_consen   16 KKQPGHYSPEIFPSTGKDCNPQPANCLKDQYVLRHCCVDDRSDKMGYSAKFLVLTSMDTET   76 (82)
T ss_pred             ccCCCCcCccccccCCCCCCCCchhhhhhhhhhhhhcccCCCcccCceEEEEEEEecCcch
Confidence            44567888888753 21  1111   123334445567789887   56789999999643


No 27 
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional
Probab=32.88  E-value=19  Score=27.67  Aligned_cols=24  Identities=8%  Similarity=-0.000  Sum_probs=20.1

Q ss_pred             hhcccccccCCCccCCCCCCCCCC
Q psy6224          11 VIGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        11 ~iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      ++.+.++|++|++|.|-+..++++
T Consensus       356 ~~~~~~~~~d~~~~~dP~~F~PeR  379 (452)
T PLN03141        356 LAYFRSVHLDEENYDNPYQFNPWR  379 (452)
T ss_pred             EEehHhccCCchhcCCccccCccc
Confidence            456789999999999999888655


No 28 
>PF00799 Gemini_AL1:  Geminivirus Rep catalytic domain;  InterPro: IPR022690 Geminiviruses are characterised by a genome of circular single-stranded DNA encapsidated in twinned (geminate) quasi-isometric particles, from which the group derives its name []. Most geminiviruses can be divided into two subgroups on the basis of host range and/or insect vector: i.e. those that infect dicotyledenous plants and are transmitted by the same whitefly species, and those that infect monocotyledenous plants and are transmitted by different leafhopper vectors. The genomes of the whitefly-transmitted African cassava mosaic virus, Tomato golden mosaic virus (TGMV) and Bean golden mosaic virus (BGMV) possess a bipartite genome. By contrast, only a single DNA component has been identified for the leafhopper-transmitted Maize streak virus (MSV) and Wheat dwarf virus (WDV) [, ]. Beet curly top virus (BCTV), and Tobacco yellow dwarf virus belong to a third possible subgroup. Like MSV and WDV, BCTV is transmitted by a specific leafhopper species, yet like the whitefly-transmitted geminiviruses it has a host range confined to dicotyledenous plants. Sequence comparison of the whitefly-transmitted Squash leaf curl virus (SqLCV) and Tomato yellow leaf curl virus (TYLCV) with the genomic components of TGMV and BGMV reveals a close evolutionary relationship [, , ]. Amino acid sequence alignments of Potato yellow mosaic virus (PYMV) proteins with those encoded by other geminiviruses show that PYMV is closely related to geminiviruses isolated from the New World, especially in the putative coat protein gene regions []. Comparison of MSV DNA-encoded proteins with those of other geminiviruses infecting monocotyledonous plants, including Panicum streak virus [] and Miscanthus streak virus (MiSV) [], reveal high levels of similarity.  The AL1 proteins encodes the replication initiator protein (Rep) of geminiviruses, which is a replicon-specific initiator enzyme and is an essential component of the replisome []. For geminivirus Rep protein, this N-terminal region is crucial for origin recognition and DNA cleavage and nucleotidyl transfer []. It is found in association with PF08283 from PFAM. ; GO: 0006260 DNA replication; PDB: 1L5I_A 1L2M_A.
Probab=32.19  E-value=11  Score=26.00  Aligned_cols=10  Identities=50%  Similarity=0.866  Sum_probs=4.1

Q ss_pred             CCCceeeeee
Q psy6224          33 DRDWGINQID   42 (82)
Q Consensus        33 d~DwGi~qld   42 (82)
                      .++||.+|+|
T Consensus       104 ~~e~G~fq~~  113 (114)
T PF00799_consen  104 YIEWGTFQID  113 (114)
T ss_dssp             EEEEC-----
T ss_pred             EEeeeeEecC
Confidence            5789999987


No 29 
>PLN02655 ent-kaurene oxidase
Probab=30.83  E-value=20  Score=27.76  Aligned_cols=25  Identities=8%  Similarity=0.106  Sum_probs=20.5

Q ss_pred             hhcccccccCCCccCCCCCCCCCCC
Q psy6224          11 VIGVNAAHHHPDIFHQGDTPREDRD   35 (82)
Q Consensus        11 ~iGl~AaHHhp~ifhdGD~~r~d~D   35 (82)
                      ++...++||+|++|.|-++.++++=
T Consensus       363 ~~~~~~~~~d~~~~~~p~~F~PeR~  387 (466)
T PLN02655        363 AINIYGCNMDKKRWENPEEWDPERF  387 (466)
T ss_pred             EecHHHhcCCcccCCChhccCcccc
Confidence            4677899999999999888876653


No 30 
>cd03505 Delta9-FADS-like The Delta9 Fatty Acid Desaturase (Delta9-FADS)-like CD includes the delta-9 and delta-11 acyl CoA desaturases found in various eukaryotes including vertebrates, insects, higher plants, and fungi. The delta-9 acyl-lipid desaturases are found in a wide range of bacteria. These enzymes play essential roles in fatty acid metabolism and the regulation of cell membrane fluidity. Acyl-CoA desaturases are the enzymes involved in the CoA-bound desaturation of fatty acids. Mammalian stearoyl-CoA delta-9 desaturase is a key enzyme in the biosynthesis of monounsaturated fatty acids, and in yeast, the delta-9 acyl-CoA desaturase (OLE1) reaction accounts for all de nova unsaturated fatty acid production in Saccharomyces cerevisiae. These non-heme, iron-containing, ER membrane-bound enzymes are part of a three-component enzyme system involving cytochrome b5, cytochrome b5 reductase, and the delta-9 fatty acid desaturase. This complex catalyzes the NADH- and oxygen-dependent i
Probab=29.82  E-value=9.4  Score=27.97  Aligned_cols=21  Identities=52%  Similarity=0.926  Sum_probs=16.5

Q ss_pred             cceeeEeeecCc--hhhhhccCC
Q psy6224          51 RNQFIVLTTFGE--HTLHHLFPT   71 (82)
Q Consensus        51 ~s~F~vlt~FGd--H~LHHLFPT   71 (82)
                      .+-++.+-+||+  |--||.||.
T Consensus       125 n~~~~~llt~GEg~HNnHHafP~  147 (178)
T cd03505         125 NNWWVALLTFGEGWHNNHHAFPG  147 (178)
T ss_pred             hhHHHHHHHccccccccccCCcc
Confidence            455577777877  999999995


No 31 
>PLN03112 cytochrome P450 family protein; Provisional
Probab=28.10  E-value=25  Score=27.43  Aligned_cols=26  Identities=19%  Similarity=0.470  Sum_probs=21.8

Q ss_pred             hhcccccccCCCccCCCCCCCCCCCc
Q psy6224          11 VIGVNAAHHHPDIFHQGDTPREDRDW   36 (82)
Q Consensus        11 ~iGl~AaHHhp~ifhdGD~~r~d~Dw   36 (82)
                      ++...+.||+|++|.|-++.++++-|
T Consensus       398 ~~~~~~~h~d~~~~~dP~~F~PeRf~  423 (514)
T PLN03112        398 FINTHGLGRNTKIWDDVEEFRPERHW  423 (514)
T ss_pred             EEehHHhhCCcccCCChhhcCCcccC
Confidence            45778899999999988888887755


No 32 
>PF05304 DUF728:  Protein of unknown function (DUF728);  InterPro: IPR007968 This entry is represented by the Tobacco rattle virus, 16kDa protein; it is a family of uncharacterised viral proteins.
Probab=27.90  E-value=19  Score=25.30  Aligned_cols=12  Identities=42%  Similarity=0.869  Sum_probs=10.3

Q ss_pred             CCCCCCceeeee
Q psy6224          30 PREDRDWGINQI   41 (82)
Q Consensus        30 ~r~d~DwGi~ql   41 (82)
                      .|.|+|+||-||
T Consensus        90 ~RDDi~fGl~~L  101 (103)
T PF05304_consen   90 FRDDIDFGLDQL  101 (103)
T ss_pred             hhccCccchhhh
Confidence            468999999887


No 33 
>PF02845 CUE:  CUE domain;  InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs). CUE domains also occur in two proteins of the IL-1 signal transduction pathway, tollip and TAB2.; GO: 0005515 protein binding; PDB: 2EKF_A 1OTR_A 1P3Q_Q 1MN3_A 1WGL_A 2EJS_A 2DAE_A 2DHY_A 2DI0_A.
Probab=27.19  E-value=18  Score=20.03  Aligned_cols=18  Identities=22%  Similarity=0.534  Sum_probs=13.1

Q ss_pred             hhhhccCCCCcccccccc
Q psy6224          64 TLHHLFPTIDHCFLHIAH   81 (82)
Q Consensus        64 ~LHHLFPTlDH~~L~~~~   81 (82)
                      .|-=|||.++...|..|.
T Consensus         7 ~L~~mFP~~~~~~I~~~L   24 (42)
T PF02845_consen    7 QLQEMFPDLDREVIEAVL   24 (42)
T ss_dssp             HHHHHSSSS-HHHHHHHH
T ss_pred             HHHHHCCCCCHHHHHHHH
Confidence            456689999998887664


No 34 
>KOG3635|consensus
Probab=27.14  E-value=21  Score=33.40  Aligned_cols=26  Identities=46%  Similarity=0.631  Sum_probs=22.4

Q ss_pred             cCCCccCCCCCCCCCCCceeeeeeeh
Q psy6224          19 HHPDIFHQGDTPREDRDWGINQIDAV   44 (82)
Q Consensus        19 Hhp~ifhdGD~~r~d~DwGi~qldtv   44 (82)
                      |.--+.|-|+++-.|-+||=.|+|||
T Consensus       123 HsKf~~~Tg~~v~~d~~wgHLQiDav  148 (1150)
T KOG3635|consen  123 HSKFNVHTGGTVVGDEEWGHLQIDAV  148 (1150)
T ss_pred             HHHhcccCCCcccChhhccceehhHH
Confidence            34457789999999999999999997


No 35 
>PRK15137 DNA-specific endonuclease I; Provisional
Probab=25.53  E-value=26  Score=27.37  Aligned_cols=9  Identities=44%  Similarity=0.874  Sum_probs=7.3

Q ss_pred             hhhhccCCC
Q psy6224          64 TLHHLFPTI   72 (82)
Q Consensus        64 ~LHHLFPTl   72 (82)
                      =||||+|+.
T Consensus       118 DLHnL~Pa~  126 (235)
T PRK15137        118 DMHNLQPAI  126 (235)
T ss_pred             ccccccccc
Confidence            389999985


No 36 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=25.46  E-value=27  Score=24.45  Aligned_cols=10  Identities=50%  Similarity=0.976  Sum_probs=7.6

Q ss_pred             hhhhhccCCC
Q psy6224          63 HTLHHLFPTI   72 (82)
Q Consensus        63 H~LHHLFPTl   72 (82)
                      -..|||||--
T Consensus        33 RSyHHLfPl~   42 (112)
T TIGR00622        33 RSYHHLFPLK   42 (112)
T ss_pred             HhhhccCCCc
Confidence            4579999954


No 37 
>PLN02774 brassinosteroid-6-oxidase
Probab=24.89  E-value=28  Score=26.94  Aligned_cols=24  Identities=13%  Similarity=0.018  Sum_probs=20.1

Q ss_pred             hhcccccccCCCccCCCCCCCCCC
Q psy6224          11 VIGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        11 ~iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      ++...+.|+||++|.|-+..++++
T Consensus       368 ~~~~~~~~rdp~~~~dP~~F~PeR  391 (463)
T PLN02774        368 YVYTREINYDPFLYPDPMTFNPWR  391 (463)
T ss_pred             EEehHHhcCCcccCCChhccCchh
Confidence            456678999999999999888765


No 38 
>PF04231 Endonuclease_1:  Endonuclease I;  InterPro: IPR007346 Bacterial periplasmic or secreted (3.1.21.1 from EC) Escherichia coli endonuclease I (EndoI) is a sequence independent endonuclease located in the periplasm. It is inhibited by different RNA species. It is thought to normally generate double strand breaks in DNA, except in the presence of high salt concentrations and RNA, when it generates single strand breaks in DNA. Its biological role is unknown []. Other family members are known to be extracellular []. This family also includes a non-specific, Mg2+-activated ribonuclease precursor (Q03091 from SWISSPROT) [].; GO: 0004518 nuclease activity; PDB: 1OUO_A 1OUP_B 2IVK_C 2VND_A 2PU3_A 2G7F_A 2G7E_A.
Probab=24.53  E-value=22  Score=26.73  Aligned_cols=9  Identities=44%  Similarity=0.608  Sum_probs=7.1

Q ss_pred             hhhhccCCC
Q psy6224          64 TLHHLFPTI   72 (82)
Q Consensus        64 ~LHHLFPTl   72 (82)
                      =||||||+.
T Consensus       106 DlH~L~pa~  114 (218)
T PF04231_consen  106 DLHNLRPAD  114 (218)
T ss_dssp             -GGGEEEEE
T ss_pred             cccceeccc
Confidence            489999985


No 39 
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=23.84  E-value=32  Score=26.78  Aligned_cols=24  Identities=25%  Similarity=0.577  Sum_probs=20.1

Q ss_pred             hhcccccccCCCccCCCCCCCCCC
Q psy6224          11 VIGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        11 ~iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      ++.+.+|||+|+.|-+-|..+.++
T Consensus       321 ~~~~~~anrDp~~f~~P~~F~p~R  344 (411)
T COG2124         321 LLSIGAANRDPEVFPDPDEFDPER  344 (411)
T ss_pred             EecHhhhcCChhhCCChhhcCCCC
Confidence            456779999999999999888665


No 40 
>PLN02302 ent-kaurenoic acid oxidase
Probab=23.13  E-value=34  Score=26.14  Aligned_cols=24  Identities=13%  Similarity=0.278  Sum_probs=19.5

Q ss_pred             hhcccccccCCCccCCCCCCCCCC
Q psy6224          11 VIGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        11 ~iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      .+...+.|++|++|.|-+..++++
T Consensus       392 ~~~~~~~~rd~~~~~dP~~F~PeR  415 (490)
T PLN02302        392 LAWFRQVHMDPEVYPNPKEFDPSR  415 (490)
T ss_pred             EeeHHHhcCCcccCCCccccChhh
Confidence            345668999999999999888665


No 41 
>COG1398 OLE1 Fatty-acid desaturase [Lipid metabolism]
Probab=22.88  E-value=61  Score=26.28  Aligned_cols=22  Identities=55%  Similarity=0.972  Sum_probs=16.3

Q ss_pred             ccee-eEeeecCc--hhhhhccCCC
Q psy6224          51 RNQF-IVLTTFGE--HTLHHLFPTI   72 (82)
Q Consensus        51 ~s~F-~vlt~FGd--H~LHHLFPTl   72 (82)
                      .|++ ..|..||+  |--||-||+-
T Consensus       224 rN~ww~al~t~GEgwHNnHHafp~~  248 (289)
T COG1398         224 RNCWWVALVTFGEGWHNNHHAFPNS  248 (289)
T ss_pred             cceeEEEEeecccccccccccCcch
Confidence            5555 55667765  9999999984


No 42 
>PLN02183 ferulate 5-hydroxylase
Probab=21.98  E-value=40  Score=26.54  Aligned_cols=24  Identities=21%  Similarity=0.246  Sum_probs=19.7

Q ss_pred             hhcccccccCCCccCCCCCCCCCC
Q psy6224          11 VIGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        11 ~iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      ++...+.||+|++|.|-+..++++
T Consensus       405 ~~~~~~~hrd~~~~~dP~~F~PeR  428 (516)
T PLN02183        405 MINAWAIGRDKNSWEDPDTFKPSR  428 (516)
T ss_pred             EEehhhhcCCccccCCccccCchh
Confidence            355678999999999999887665


No 43 
>PLN02196 abscisic acid 8'-hydroxylase
Probab=20.80  E-value=34  Score=26.52  Aligned_cols=23  Identities=26%  Similarity=0.291  Sum_probs=19.3

Q ss_pred             hcccccccCCCccCCCCCCCCCC
Q psy6224          12 IGVNAAHHHPDIFHQGDTPREDR   34 (82)
Q Consensus        12 iGl~AaHHhp~ifhdGD~~r~d~   34 (82)
                      +...++|++|++|.|-+..++++
T Consensus       369 ~~~~~~~rd~~~~~dP~~F~PeR  391 (463)
T PLN02196        369 PLFRNIHHSADIFSDPGKFDPSR  391 (463)
T ss_pred             eeHHHhcCCchhcCCcCccChhh
Confidence            45668999999999999888766


Done!