Query         psy6232
Match_columns 100
No_of_seqs    55 out of 57
Neff          3.6 
Searched_HMMs 46136
Date          Fri Aug 16 21:10:19 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6232.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6232hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2571|consensus               98.9 2.9E-10 6.3E-15  102.2   0.3   96    1-96    141-238 (862)
  2 KOG1098|consensus               53.2     9.3  0.0002   35.3   2.0   38   42-79    166-203 (780)
  3 KOG1228|consensus               34.4      20 0.00042   29.3   1.0   28   64-91    170-200 (256)
  4 PF10236 DAP3:  Mitochondrial r  30.4      15 0.00033   29.2  -0.2   51   44-94     45-103 (309)
  5 KOG3218|consensus               19.6      32 0.00069   27.4  -0.3   18   52-69    137-154 (208)
  6 KOG4263|consensus               18.1 1.1E+02  0.0023   25.7   2.4   25   39-63    128-152 (299)
  7 PF08430 Fork_head_N:  Forkhead  15.9      59  0.0013   23.8   0.4   10   86-95    119-128 (136)
  8 PF08171 Mad3_BUB1_II:  Mad3/BU  15.6      74  0.0016   21.2   0.8   23   78-100    43-68  (68)
  9 PF01191 RNA_pol_Rpb5_C:  RNA p  15.1      35 0.00077   22.8  -0.9   23   52-74      3-25  (74)
 10 COG1902 NemA NADH:flavin oxido  15.0      77  0.0017   26.4   0.9   18   77-94    172-191 (363)

No 1  
>KOG2571|consensus
Probab=98.89  E-value=2.9e-10  Score=102.16  Aligned_cols=96  Identities=24%  Similarity=0.156  Sum_probs=89.8

Q ss_pred             CCCCCCCCccccccCCCCce-eccCCC-cccHHHHHHHHHHHHHHHHHHHhHHHhhhccCcccccccccccccccccchh
Q psy6232           1 MCGLRNDDPCFFQNSIPDYL-FFVSPS-IYFLDDFILKQHAWVWLLWLLSQTWITLHIWTPKCERLATTEKLFVRPMYDA   78 (100)
Q Consensus         1 ~C~~r~~d~C~f~~~iPdyL-F~~~p~-~~~l~~f~~~~~~w~WLlWllSQ~Wit~HiW~p~~eRLA~tEkLFv~p~Y~~   78 (100)
                      .|.+|..|||.-+|.++|+. .+.++. ..++.+|......|.|+.|+.||.|.+.|.|++++++.+++|+++..|+|.|
T Consensus       141 ~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~s~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~  220 (862)
T KOG2571|consen  141 NAILRQSDPCERRGFLSDESLKPKLSKTFESLKLFILDYQLWESLIDLDSGSWRGYTDMNTANKRKMPNEGLTRAPRYIG  220 (862)
T ss_pred             cchhccCCcccccccccccCCCCCCCccccchhccccchhhhccCcccccccchheeeccccccccccccCCccCceeee
Confidence            37889999999999999998 999984 4577999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhhhhccccccccc
Q psy6232          79 LLIDQSMSLNRRCDDEKD   96 (100)
Q Consensus        79 ~liDQsl~lNRrr~d~~~   96 (100)
                      ..++|++++++++.+...
T Consensus       221 ~~~~~~~~~~~~~~~~~~  238 (862)
T KOG2571|consen  221 TTLFQSSVLGLIKVALST  238 (862)
T ss_pred             ehhhhhhccccchhhhhc
Confidence            999999999999987653


No 2  
>KOG1098|consensus
Probab=53.24  E-value=9.3  Score=35.33  Aligned_cols=38  Identities=24%  Similarity=0.204  Sum_probs=34.1

Q ss_pred             HHHHHHHhHHHhhhccCcccccccccccccccccchhh
Q psy6232          42 WLLWLLSQTWITLHIWTPKCERLATTEKLFVRPMYDAL   79 (100)
Q Consensus        42 WLlWllSQ~Wit~HiW~p~~eRLA~tEkLFv~p~Y~~~   79 (100)
                      =|||.++|+.+-+|-+-|-..|.++.|-.||+--|-++
T Consensus       166 ~ll~v~~qLf~kv~~tkp~asr~~saeif~vc~~~l~P  203 (780)
T KOG1098|consen  166 GLLRVFGQLFKKVEATKPAASRSESAEIFVVCLGYLAP  203 (780)
T ss_pred             HHHHHHHHHHHHHHhcCChhhhhhccceeeeeecccCc
Confidence            37999999999999999999999999999998777543


No 3  
>KOG1228|consensus
Probab=34.43  E-value=20  Score=29.31  Aligned_cols=28  Identities=29%  Similarity=0.479  Sum_probs=21.7

Q ss_pred             ccccccccccccchhhhhhhhh---hhcccc
Q psy6232          64 LATTEKLFVRPMYDALLIDQSM---SLNRRC   91 (100)
Q Consensus        64 LA~tEkLFv~p~Y~~~liDQsl---~lNRrr   91 (100)
                      +..+|||||+|-|-.+|++-+.   -=|++|
T Consensus       170 lg~s~kLmVTpEYv~fL~~~anekmdeN~kr  200 (256)
T KOG1228|consen  170 LGHSGKLMVTPEYVDFLLNVANEKMDENKKR  200 (256)
T ss_pred             cCCCccEEecHHHHHHHHHHHHHHHhhhHHH
Confidence            3479999999999999998663   345554


No 4  
>PF10236 DAP3:  Mitochondrial ribosomal death-associated protein 3;  InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  This entry represents a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis []. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix [] and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29). 
Probab=30.39  E-value=15  Score=29.23  Aligned_cols=51  Identities=20%  Similarity=0.322  Sum_probs=35.2

Q ss_pred             HHHHHhHHHhhhccCc-----ccccccc---cccccccccchhhhhhhhhhhccccccc
Q psy6232          44 LWLLSQTWITLHIWTP-----KCERLAT---TEKLFVRPMYDALLIDQSMSLNRRCDDE   94 (100)
Q Consensus        44 lWllSQ~Wit~HiW~p-----~~eRLA~---tEkLFv~p~Y~~~liDQsl~lNRrr~d~   94 (100)
                      .|-..|=||.+||=.+     .+.=.++   .+.+|.+|+|..-++.+.+..|...-.+
T Consensus        45 ~~A~~~~wiVl~vp~a~~~~~~~~~~~~~~~~~~~~~qP~~a~~~L~~~~~~N~~~L~~  103 (309)
T PF10236_consen   45 HYARENGWIVLYVPSAQDWVNGTTDYAPSPYNPGLYDQPMYAAKWLKKFLKANEELLKK  103 (309)
T ss_pred             HHHHhCCEEEEEcCCHHHHhhCCeeEeeCCCCCCeeecHHHHHHHHHHHHHHhHHHHHh
Confidence            3555778888886332     2221222   4699999999999999999999744333


No 5  
>KOG3218|consensus
Probab=19.59  E-value=32  Score=27.44  Aligned_cols=18  Identities=44%  Similarity=0.497  Sum_probs=16.8

Q ss_pred             HhhhccCccccccccccc
Q psy6232          52 ITLHIWTPKCERLATTEK   69 (100)
Q Consensus        52 it~HiW~p~~eRLA~tEk   69 (100)
                      ||=|.|.|+...|.+.||
T Consensus       137 IT~H~lvPkH~vL~~eEK  154 (208)
T KOG3218|consen  137 ITEHELVPKHQVLTDEEK  154 (208)
T ss_pred             ccceeecCceEEcCHHHH
Confidence            788999999999999987


No 6  
>KOG4263|consensus
Probab=18.10  E-value=1.1e+02  Score=25.71  Aligned_cols=25  Identities=28%  Similarity=0.707  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHhHHHhhhccCccccc
Q psy6232          39 AWVWLLWLLSQTWITLHIWTPKCER   63 (100)
Q Consensus        39 ~w~WLlWllSQ~Wit~HiW~p~~eR   63 (100)
                      +..-|+-+.--.-.|-|.|+|++.|
T Consensus       128 ~ff~li~~fPR~~LtrHFWTpqQr~  152 (299)
T KOG4263|consen  128 VFFFLIIFFPRLVLTRHFWTPQQRR  152 (299)
T ss_pred             HHHHHHHHHHHHHHHHHhCChHhHh
Confidence            3444555666777899999999864


No 7  
>PF08430 Fork_head_N:  Forkhead N-terminal region;  InterPro: IPR013638 The region described in this entry is found towards the N terminus of various eukaryotic fork head/HNF-3-related transcription factors (which contain the IPR001766 from INTERPRO domain). These proteins play key roles in embryogenesis, maintenance of differentiated cell states, and tumorigenesis []. ; GO: 0008134 transcription factor binding, 0019904 protein domain specific binding
Probab=15.90  E-value=59  Score=23.75  Aligned_cols=10  Identities=40%  Similarity=0.537  Sum_probs=8.1

Q ss_pred             hhcccccccc
Q psy6232          86 SLNRRCDDEK   95 (100)
Q Consensus        86 ~lNRrr~d~~   95 (100)
                      +|||.||+|.
T Consensus       119 ~l~R~R~~Kt  128 (136)
T PF08430_consen  119 ALNRARDPKT  128 (136)
T ss_pred             ccccccCCcc
Confidence            4999998874


No 8  
>PF08171 Mad3_BUB1_II:  Mad3/BUB1 homology region 2;  InterPro: IPR012572 This domain is required for cell cycle arrest induced by spindle assembly checkpoint (SPC) activation. It is also involved in the nuclear accumulation and kinetochore targeting of proteins Bub1p, Bub3p and Mad3p [].; GO: 0000075 cell cycle checkpoint, 0005634 nucleus; PDB: 2I3T_D 2I3S_F.
Probab=15.59  E-value=74  Score=21.15  Aligned_cols=23  Identities=17%  Similarity=0.351  Sum_probs=10.3

Q ss_pred             hhhhhhhhhhccc---cccccccccC
Q psy6232          78 ALLIDQSMSLNRR---CDDEKDVKTE  100 (100)
Q Consensus        78 ~~liDQsl~lNRr---r~d~~~i~~e  100 (100)
                      -.-+++-|||.|.   +..++.+|.|
T Consensus        43 E~s~eEiLA~sR~~~y~~~~~~~k~~   68 (68)
T PF08171_consen   43 EYSLEEILAISRNVYYKKKQKKRKRE   68 (68)
T ss_dssp             B--HHHHHHHHTT--SS---------
T ss_pred             eecHHHHHHHHhhcchhhhhhcccCC
Confidence            4678999999998   4455555543


No 9  
>PF01191 RNA_pol_Rpb5_C:  RNA polymerase Rpb5, C-terminal domain;  InterPro: IPR000783  Prokaryotes contain a single DNA-dependent RNA polymerase (RNAP; 2.7.7.6 from EC) that is responsible for the transcription of all genes, while eukaryotes have three classes of RNAPs (I-III) that transcribe different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. Certain subunits of RNAPs, including RPB5 (POLR2E in mammals), are common to all three eukaryotic polymerases. RPB5 plays a role in the transcription activation process. Eukaryotic RPB5 has a bipartite structure consisting of a unique N-terminal region (IPR005571 from INTERPRO), plus a C-terminal region that is structurally homologous to the prokaryotic RPB5 homologue, subunit H (gene rpoH) [, , , ]. This entry represents prokaryotic subunit H and the C-terminal domain of eukaryotic RPB5, which share a two-layer alpha/beta fold, with a core structure of beta/alpha/beta/alpha/beta(2). ; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 1EIK_A 2Y0S_Z 1DZF_A 3GTG_E 2VUM_E 3GTP_E 3GTO_E 3S17_E 3S1R_E 1I3Q_E ....
Probab=15.07  E-value=35  Score=22.77  Aligned_cols=23  Identities=39%  Similarity=0.326  Sum_probs=16.6

Q ss_pred             HhhhccCcccccccccccccccc
Q psy6232          52 ITLHIWTPKCERLATTEKLFVRP   74 (100)
Q Consensus        52 it~HiW~p~~eRLA~tEkLFv~p   74 (100)
                      ||-|...|+.+.|..+|+-=+.-
T Consensus         3 i~~H~lVPkH~ils~eE~~~lL~   25 (74)
T PF01191_consen    3 ITKHELVPKHEILSEEEKKELLK   25 (74)
T ss_dssp             CTSSTTC-EEEEE-HHHHHHHHH
T ss_pred             cccceecCCeEEcCHHHHHHHHH
Confidence            57899999999999999754433


No 10 
>COG1902 NemA NADH:flavin oxidoreductases, Old Yellow Enzyme family [Energy production and conversion]
Probab=14.97  E-value=77  Score=26.42  Aligned_cols=18  Identities=33%  Similarity=0.505  Sum_probs=15.2

Q ss_pred             hhhhhhhhhh--hccccccc
Q psy6232          77 DALLIDQSMS--LNRRCDDE   94 (100)
Q Consensus        77 ~~~liDQsl~--lNRrr~d~   94 (100)
                      +|-||||.|.  -|+|.|+.
T Consensus       172 hGYLi~qFlsp~tN~RtD~Y  191 (363)
T COG1902         172 HGYLLSQFLSPLTNKRTDEY  191 (363)
T ss_pred             cchHHHHhcCCccCCCCCcc
Confidence            5789999998  99988864


Done!