Diaphorina citri psyllid: psy6233


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MSSKDAMSNFIDLLDLKCILFKPYIDAHVAQKEEENRKAREQIEREEKVKSEQVNGNEVSQETSIEEKKRRLIQDALNQQTYAQFRAYAEDQFPGNPEQQAVLVQIGPANMWTLTNIKSFKEHIRKEGGDAIIKIGHGETVTVRVPTHEGGSCLYWEFCTDHYDLGFGIYFEWNKSPTNQVSVHVSETDDEMISDKDTESGRTGSQPRKTTKIVNRSPFSIISPIMRRDCHQEVYAGSHCYPGEGVYLLKFDNSYSLWRSKTLYYRVYYTR
ccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccccEEEEEECccccccEEEEEEECccccCEEEEEEEEcccccccEEEEEccccccccccccccccccccccccccccccccccCEEEEcEECccccccccCEEECcccEEEEEEECccCEEEEEEEEEEEEEEEc
*****AMSNFIDLLDLKCILFKPYIDAHV************************************************NQQTYAQFRAYAEDQF*****QQAVLVQIGPANMWTLTNIKSFKEHIRKEGGDAIIKIGHGETVTVRVPTHEGGSCLYWEFCTDHYDLGFGIYFEWNKSPTNQ***********************************RSPFSIISPIMRRDCHQEVYAGSHCYPGEGVYLLKFDNSYSLWRSKTLYYRVYYTR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSKDAMSNFIDLLDLKCILFKPYIDAHxxxxxxxxxxxxxxxxxxxxxxxxQVNGNEVSQETSIEEKKRRLIQDALNQQTYAQFRAYAEDQFPGNPEQQAVLVQIGPANMWTLTNIKSFKEHIRKEGGDAIIKIGHGETVTVRVPTHEGGSCLYWEFCTDHYDLGFGIYFEWNKSPTNQVSVHVSETDDEMISDKDTESGRTGSQPRKTTKIVNRSPFSIISPIMRRDCHQEVYAGSHCYPGEGVYLLKFDNSYSLWRSKTLYYRVYYTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Golgi resident protein GCP60 Involved in the maintenance of Golgi structure by interacting with giantin, affecting protein transport between the endoplasmic reticulum and Golgi. Involved in hormone-induced steroid biosynthesis in testicular Leydig cells.confidentQ9H3P7
Golgi resident protein GCP60 Involved in the maintenance of Golgi structure by interacting with giantin, affecting protein transport between the endoplasmic reticulum and Golgi. Involved in hormone-induced steroid biosynthesis in testicular Leydig cells.confidentQ7TNY6
Golgi resident protein GCP60 Involved in the maintenance of Golgi structure by interacting with giantin, affecting protein transport between the endoplasmic reticulum and Golgi (By similarity). Involved in hormone-induced steroid biosynthesis in testicular Leydig cells.confidentQ8BMP6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000139 [CC]Golgi membraneprobableGO:0005737, GO:0005794, GO:0031090, GO:0043229, GO:0016020, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0012505, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OLM, chain A
Confidence level:very confident
Coverage over the Query: 106-178,201-270
View the alignment between query and template
View the model in PyMOL
Template: 2COP, chain A
Confidence level:probable
Coverage over the Query: 1-30
View the alignment between query and template
View the model in PyMOL