RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy624
         (69 letters)



>gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein
           Serine/Threonine Kinase, Microtubule-associated
           serine/threonine-like kinase.  Serine/Threonine Kinases
           (STKs), Microtubule-associated serine/threonine (MAST)
           kinase subfamily, MAST-like (MASTL) kinases, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAST kinases contain an N-terminal domain of
           unknown function, a central catalytic domain, and a
           C-terminal PDZ domain that mediates protein-protein
           interactions. The MASTL kinases in this group carry only
           a catalytic domain, which contains a long insertion
           relative to MAST kinases. The human MASTL gene has also
           been labelled FLJ14813. A missense mutation in FLJ14813
           is associated with autosomal dominant thrombocytopenia.
           To date, the function of MASTL is unknown.
          Length = 669

 Score = 62.2 bits (151), Expect = 2e-13
 Identities = 26/37 (70%), Positives = 28/37 (75%), Gaps = 1/37 (2%)

Query: 34  PFRTPKSVRIG-KQASDNRILGTPDYLAPELLLGQDH 69
           P+RTPKSVR G       RILGTPDYLAPELLLG+ H
Sbjct: 521 PYRTPKSVRRGAAPVEGERILGTPDYLAPELLLGKPH 557


>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated
           serine/threonine kinase-like proteins.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAST kinase subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. The MAST kinase subfamily
           includes MAST kinases, MAST-like (MASTL) kinases, and
           fungal kinases with similarity to Saccharomyces
           cerevisiae Rim15 and Schizosaccharomyces pombe cek1.
           MAST kinases contain an N-terminal domain of unknown
           function, a central catalytic domain, and a C-terminal
           PDZ domain that mediates protein-protein interactions.
           MASTL kinases carry only a catalytic domain which
           contains a long insert relative to other kinases. The
           fungal kinases in this subfamily harbor other domains in
           addition to a central catalytic domain, which also
           contains an insert relative to MAST kinases like MASTL.
           Rim15 contains a C-terminal signal receiver (REC) domain
           while cek1 contains an N-terminal PAS domain. MAST
           kinases are cytoskeletal associated kinases of unknown
           function that are also expressed at neuromuscular
           junctions and postsynaptic densities. The fungal
           proteins Rim15 and cek1 are involved in the regulation
           of meiosis and mitosis, respectively.
          Length = 265

 Score = 45.7 bits (109), Expect = 2e-07
 Identities = 15/23 (65%), Positives = 19/23 (82%)

Query: 47  ASDNRILGTPDYLAPELLLGQDH 69
             D RI+GTPDY+APE++LGQ H
Sbjct: 156 KEDKRIVGTPDYIAPEVILGQGH 178


>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine
           Kinase, cAMP-dependent protein kinase.  Serine/Threonine
           Kinases (STKs), cAMP-dependent protein kinase (PKA)
           subfamily, catalytic (c) subunit. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This subfamily is composed of the
           cAMP-dependent proteins kinases, PKA and PRKX. The
           inactive PKA holoenzyme is a heterotetramer composed of
           two phosphorylated and active catalytic (C) subunits
           with a dimer of regulatory (R) subunits. Activation is
           achieved through the binding of the important second
           messenger cAMP to the R subunits, which leads to the
           dissociation of PKA into the R dimer and two active C
           subunits. PKA is present ubiquitously in cells and
           interacts with many different downstream targets. It
           plays a role in the regulation of diverse processes such
           as growth, development, memory, metabolism, gene
           expression, immunity, and lipolysis.
          Length = 290

 Score = 36.8 bits (86), Expect = 2e-04
 Identities = 13/40 (32%), Positives = 21/40 (52%), Gaps = 12/40 (30%)

Query: 30  AKKIPFRTPKSVRIGKQASDNRILGTPDYLAPELLLGQDH 69
           AK++  RT              + GTP+YLAPE++L + +
Sbjct: 148 AKRVKGRT------------YTLCGTPEYLAPEIILSKGY 175


>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), AGC (Protein Kinases A, G and C) family,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The AGC family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and Phosphoinositide 3-Kinase (PI3K). Members of
           this family include cAMP-dependent Protein Kinase (PKA),
           cGMP-dependent Protein Kinase (PKG), Protein Kinase C
           (PKC), Protein Kinase B (PKB), G protein-coupled
           Receptor Kinase (GRK), Serum- and Glucocorticoid-induced
           Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase
           (p70S6K or S6K), among others. AGC kinases share an
           activation mechanism based on the phosphorylation of up
           to three sites: the activation loop (A-loop), the
           hydrophobic motif (HM) and the turn motif.
           Phosphorylation at the A-loop is required of most AGC
           kinases, which results in a disorder-to-order transition
           of the A-loop. The ordered conformation results in the
           access of substrates and ATP to the active site. A
           subset of AGC kinases with C-terminal extensions
           containing the HM also requires phosphorylation at this
           site. Phosphorylation at the HM allows the C-terminal
           extension to form an ordered structure that packs into
           the hydrophobic pocket of the catalytic domain, which
           then reconfigures the kinase into an active bi-lobed
           state. In addition, growth factor-activated AGC kinases
           such as PKB, p70S6K, RSK, MSK, PKC, and SGK, require
           phosphorylation at the turn motif (also called tail or
           zipper site), located N-terminal to the HM at the
           C-terminal extension. AGC kinases regulate many cellular
           processes including division, growth, survival,
           metabolism, motility, and differentiation. Many are
           implicated in the development of various human diseases.
          Length = 250

 Score = 35.6 bits (83), Expect = 6e-04
 Identities = 11/16 (68%), Positives = 15/16 (93%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP+YLAPE+LLG+ +
Sbjct: 155 GTPEYLAPEVLLGKGY 170


>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C theta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), theta isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta
           is selectively expressed in T-cells and plays an
           important and non-redundant role in several aspects of
           T-cell biology. Although T-cells also express other PKC
           isoforms, PKC-theta is unique in that upon antigen
           stimulation, it is translocated to the plasma membrane
           at the immunological synapse, where it mediates signals
           essential for T-cell activation. It is essential for
           TCR-induced proliferation, cytokine production, T-cell
           survival, and the differentiation and effector function
           of T-helper (Th) cells, particularly Th2 and Th17.
           PKC-theta is being developed as a therapeutic target for
           Th2-mediated allergic inflammation and Th17-mediated
           autoimmune diseases.
          Length = 316

 Score = 34.9 bits (80), Expect = 0.001
 Identities = 13/24 (54%), Positives = 16/24 (66%)

Query: 46  QASDNRILGTPDYLAPELLLGQDH 69
            A      GTPDY+APE+LLGQ +
Sbjct: 150 DAKTCTFCGTPDYIAPEILLGQKY 173


>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like
           Protein Serine/Threonine Kinases.  Serine/Threonine
           Kinases (STKs), Microtubule-associated serine/threonine
           (MAST) kinase subfamily, fungal Rim15-like kinases,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The MAST kinase
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include Saccharomyces
           cerevisiae Rim15, Schizosaccharomyces pombe cek1, and
           similar fungal proteins. They contain a central
           catalytic domain, which contains an insert relative to
           MAST kinases. In addition, Rim15 contains a C-terminal
           signal receiver (REC) domain while cek1 contains an
           N-terminal PAS domain. Rim15 (or Rim15p) functions as a
           regulator of meiosis. It acts as a downstream effector
           of PKA and regulates entry into stationary phase (G0).
           Thus, it plays a crucial role in regulating yeast
           proliferation, differentiation, and aging. Cek1 may
           facilitate progression of mitotic anaphase.
          Length = 260

 Score = 34.0 bits (78), Expect = 0.002
 Identities = 11/18 (61%), Positives = 14/18 (77%)

Query: 51  RILGTPDYLAPELLLGQD 68
           + +GTPDYLAPE +LG  
Sbjct: 152 KFVGTPDYLAPETILGVG 169


>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Rho-associated
           coiled-coil containing protein kinase (ROCK) and Nuclear
           Dbf2-Related (NDR)-like kinase subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK- and NDR-like
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this subfamily include ROCK and
           ROCK-like proteins such as DMPK, MRCK, and CRIK, as well
           as NDR and NDR-like proteins such as LATS, CBK1 and
           Sid2p. ROCK and CRIK are effectors of the small GTPase
           Rho, while MRCK is an effector of the small GTPase
           Cdc42. NDR and NDR-like kinases contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. Proteins in this subfamily are involved in
           regulating many cellular functions including
           contraction, motility, division, proliferation,
           apoptosis, morphogenesis, and cytokinesis.
          Length = 350

 Score = 33.0 bits (76), Expect = 0.005
 Identities = 13/44 (29%), Positives = 18/44 (40%), Gaps = 3/44 (6%)

Query: 24  IATPHPAKKIPFRTPKSVRIGKQASDNRILGTPDYLAPELLLGQ 67
                    +  R     R  +  S    +GTPDY+APE+L G 
Sbjct: 165 HNLLFRDNVLVRRRDHKQRRVRANS---TVGTPDYIAPEVLRGT 205


>gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed.
          Length = 932

 Score = 33.2 bits (76), Expect = 0.005
 Identities = 12/16 (75%), Positives = 15/16 (93%)

Query: 51  RILGTPDYLAPELLLG 66
           +I+GTPDY+APE LLG
Sbjct: 190 KIVGTPDYMAPERLLG 205


>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein
           Serine/Threonine Kinase, Microtubule-associated
           serine/threonine kinase.  Serine/Threonine Kinases
           (STKs), Microtubule-associated serine/threonine (MAST)
           kinase subfamily, MAST, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MAST kinase subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. MAST kinases contain an
           N-terminal domain of unknown function, a central
           catalytic domain, and a C-terminal PDZ domain that
           mediates protein-protein interactions. There are four
           mammalian MAST kinases, named MAST1-MAST4. MAST1 is also
           referred to as syntrophin-associated STK (SAST), while
           MAST2 is also called MAST205. MAST kinases are
           cytoskeletal associated kinases of unknown function that
           are also expressed at neuromuscular junctions and
           postsynaptic densities. MAST1, MAST2, and MAST3 bind and
           phosphorylate the tumor suppressor PTEN, and may
           contribute to the regulation and stabilization of PTEN.
           MAST2 is involved in the regulation of the Fc-gamma
           receptor of the innate immune response in macrophages,
           and may also be involved in the regulation of the Na+/H+
           exchanger NHE3.
          Length = 305

 Score = 32.8 bits (75), Expect = 0.005
 Identities = 10/23 (43%), Positives = 18/23 (78%)

Query: 45  KQASDNRILGTPDYLAPELLLGQ 67
           ++  D ++ GTP+Y+APE++L Q
Sbjct: 169 REFLDKQVCGTPEYIAPEVILRQ 191


>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic
           domain.  Phosphotransferases. Serine or
           threonine-specific kinase subfamily.
          Length = 254

 Score = 32.5 bits (75), Expect = 0.008
 Identities = 10/16 (62%), Positives = 15/16 (93%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP+Y+APE+LLG+ +
Sbjct: 158 GTPEYMAPEVLLGKGY 173


>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein
           Serine/Threonine Kinases, Novel Protein Kinase C theta
           and delta.  Serine/Threonine Kinases (STKs), Novel
           Protein Kinase C (nPKC), theta and delta-like isoforms,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The nPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           nPKCs are calcium-independent, but require DAG
           (1,2-diacylglycerol) and phosphatidylserine (PS) for
           activity. There are four nPKC isoforms, delta, epsilon,
           eta, and theta. PKC-theta is selectively expressed in
           T-cells and plays an important and non-redundant role in
           several aspects of T-cell biology. PKC-delta plays a
           role in cell cycle regulation and programmed cell death
           in many cell types.
          Length = 316

 Score = 32.1 bits (73), Expect = 0.010
 Identities = 11/14 (78%), Positives = 13/14 (92%)

Query: 54  GTPDYLAPELLLGQ 67
           GTPDY+APE+L GQ
Sbjct: 158 GTPDYIAPEILKGQ 171


>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase C.  Serine/Threonine Kinases
           (STKs), Protein Kinase C (PKC) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, classical PKCs depend on
           calcium, DAG (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. Novel PKCs are
           calcium-independent, but require DAG and PS for
           activity, while atypical PKCs only require PS. PKCs
           phosphorylate and modify the activities of a wide
           variety of cellular proteins including receptors,
           enzymes, cytoskeletal proteins, transcription factors,
           and other kinases. They play a central role in signal
           transduction pathways that regulate cell migration and
           polarity, proliferation, differentiation, and apoptosis.
           Also included in this subfamily are the PKC-like
           proteins, called PKNs.
          Length = 318

 Score = 31.6 bits (72), Expect = 0.014
 Identities = 10/16 (62%), Positives = 13/16 (81%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTPDY+APE+L  Q +
Sbjct: 158 GTPDYIAPEILSYQPY 173


>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein
           Serine/Threonine Kinase, cGMP-dependent protein kinase. 
           Serine/Threonine Kinases (STKs), cGMP-dependent protein
           kinase (cGK or PKG) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The cGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Mammals have two cGK isoforms
           from different genes, cGKI and cGKII. cGKI exists as two
           splice variants, cGKI-alpha and cGKI-beta. cGK consists
           of an N-terminal regulatory domain containing a
           dimerization and an autoinhibitory pseudosubstrate
           region, two cGMP-binding domains, and a C-terminal
           catalytic domain. Binding of cGMP to both binding sites
           releases the inhibition of the catalytic center by the
           pseudosubstrate region, allowing autophosphorylation and
           activation of the kinase. cGKI is a  soluble protein
           expressed in all smooth muscles, platelets, cerebellum,
           and kidney. It is also expressed at lower concentrations
           in other tissues. cGKII is a membrane-bound protein that
           is most abundantly expressed in the intestine. It is
           also present in the brain nuclei, adrenal cortex,
           kidney, lung, and prostate. cGKI is involved in the
           regulation of smooth muscle tone, smooth cell
           proliferation, and platelet activation. cGKII plays a
           role in the regulation of secretion, such as renin
           secretion by the kidney and aldosterone secretion by the
           adrenal. It also regulates bone growth and the circadian
           rhythm.
          Length = 262

 Score = 31.4 bits (72), Expect = 0.015
 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 2/39 (5%)

Query: 31  KKIPFRTPKSVRIGKQASDNRILGTPDYLAPELLLGQDH 69
           K + F   K ++ G++       GTP+Y+APE++L + +
Sbjct: 133 KLVDFGFAKKLKSGQKTWT--FCGTPEYVAPEIILNKGY 169


>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase
           1-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Yeast protein kinase 1
           (YPK1)-like subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The YPK1-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           fungal proteins with similarity to the AGC STKs,
           Saccharomyces cerevisiae YPK1 and Schizosaccharomyces
           pombe Gad8p. YPK1 is required for cell growth and acts
           as a downstream kinase in the sphingolipid-mediated
           signaling pathway of yeast. It also plays a role in
           efficient endocytosis and in the maintenance of cell
           wall integrity. Gad8p is a downstream target of Tor1p,
           the fission yeast homolog of mTOR. It plays a role in
           cell growth and sexual development.
          Length = 312

 Score = 31.4 bits (71), Expect = 0.016
 Identities = 13/17 (76%), Positives = 14/17 (82%)

Query: 50  NRILGTPDYLAPELLLG 66
           N   GTP+YLAPELLLG
Sbjct: 151 NTFCGTPEYLAPELLLG 167


>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of
           Phototropin-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Phototropin-like
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           phototropin-like subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. Included in this subfamily
           are plant phototropins and predominantly uncharacterized
           fungal STKs whose catalytic domains resemble the
           phototropin kinase domain. One protein from Neurospora
           crassa is called nrc-2. Phototropins are blue-light
           receptors that control responses such as phototropism,
           stromatal opening, and chloroplast movement in order to
           optimize the photosynthetic efficiency of plants. They
           are light-activated STKs that contain an N-terminal
           photosensory domain and a C-terminal catalytic domain.
           The N-terminal domain contains two LOV (Light, Oxygen or
           Voltage) domains that binds FMN. Photoexcitation of the
           LOV domains results in autophosphorylation at multiple
           sites and activation of the catalytic domain. Neurospora
           crassa nrc-2 plays a role in growth and development by
           controlling entry into the conidiation program.
          Length = 316

 Score = 31.1 bits (71), Expect = 0.021
 Identities = 20/73 (27%), Positives = 28/73 (38%), Gaps = 10/73 (13%)

Query: 1   MLDDAEPKCPMASFPDPMSPVSPIATPHP-AKKIPFRT---PKSVRIGKQASDNRILGTP 56
           ML D +        P P+S      +       IP  T     S R       N  +GT 
Sbjct: 143 MLSDFDLSKQSDVEPPPVSKALRKGSRRSSVNSIPSETFSEEPSFR------SNSFVGTE 196

Query: 57  DYLAPELLLGQDH 69
           +Y+APE++ G  H
Sbjct: 197 EYIAPEVISGDGH 209


>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C delta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), delta isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta
           plays a role in cell cycle regulation and programmed
           cell death in many cell types. It slows down cell
           proliferation, inducing cell cycle arrest and enhancing
           cell differentiation. PKC-delta is also involved in the
           regulation of transcription as well as immune and
           inflammatory responses. It plays a central role in the
           genotoxic stress response that leads to DNA
           damaged-induced apoptosis.
          Length = 316

 Score = 31.1 bits (70), Expect = 0.026
 Identities = 10/16 (62%), Positives = 13/16 (81%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTPDY+APE+L G  +
Sbjct: 158 GTPDYIAPEILQGLKY 173


>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and
           Dbf2p-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), ROCK- and NDR-like
           subfamily, fungal Sid2p- and Dbf2p-like proteins,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sid2p- and
           Dbf2p-like group is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This group contains fungal kinases including
           Schizosaccharomyces pombe Sid2p and Saccharomyces
           cerevisiae Dbf2p. Group members show similarity to NDR
           kinases in that they contain an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Sid2p plays a
           crucial role in the septum initiation network (SIN) and
           in the initiation of cytokinesis. Dbf2p is important in
           regulating the mitotic exit network (MEN) and in
           cytokinesis.
          Length = 333

 Score = 30.1 bits (68), Expect = 0.046
 Identities = 10/18 (55%), Positives = 16/18 (88%)

Query: 50  NRILGTPDYLAPELLLGQ 67
           N ++G+PDY+APE+L G+
Sbjct: 156 NSVVGSPDYMAPEVLRGK 173


>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear
           Dbf2-Related kinase-like Protein Serine/Threonine
           Kinases.  Serine/Threonine Kinases (STKs), NDR kinase
           subfamily, fungal NDR-like proteins, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The NDR subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This group is
           composed of fungal NDR-like proteins including
           Saccharomyces cerevisiae CBK1 (or CBK1p),
           Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago
           maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like
           NDR kinase, group members contain an N-terminal
           regulatory (NTR) domain and an insert within the
           catalytic domain that contains an auto-inhibitory
           sequence. CBK1 is an essential component in the RAM
           (regulation of Ace2p activity and cellular
           morphogenesis) network. CBK1 and Orb6 play similar roles
           in coordinating cell morphology with cell cycle
           progression. Ukc1 is involved in morphogenesis,
           pathogenicity, and pigment formation. Cot1 plays a role
           in polar tip extension.
          Length = 377

 Score = 30.2 bits (68), Expect = 0.046
 Identities = 10/15 (66%), Positives = 13/15 (86%)

Query: 53  LGTPDYLAPELLLGQ 67
           +GTPDY+APE+ L Q
Sbjct: 209 VGTPDYIAPEIFLQQ 223


>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain. 
          Length = 260

 Score = 30.3 bits (69), Expect = 0.048
 Identities = 10/16 (62%), Positives = 13/16 (81%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP Y+APE+LLG + 
Sbjct: 160 GTPWYMAPEVLLGGNG 175


>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase.  Serine/Threonine Kinases
           (STKs), Rho-associated coiled-coil containing protein
           kinase (ROCK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The ROCK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. ROCK is also referred to as Rho-associated
           kinase or simply as Rho kinase. It contains an
           N-terminal extension, a catalytic kinase domain, and a
           long C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain. It is activated via interaction with Rho GTPases
           and is involved in many cellular functions including
           contraction, adhesion, migration, motility,
           proliferation, and apoptosis. The ROCK subfamily
           consists of two isoforms, ROCK1 and ROCK2, which may be
           functionally redundant in some systems, but exhibit
           different tissue distributions. Both isoforms are
           ubiquitously expressed in most tissues, but ROCK2 is
           more prominent in brain and skeletal muscle while ROCK1
           is more pronounced in the liver, testes, and kidney.
           Studies in knockout mice result in different phenotypes,
           suggesting that the two isoforms do not compensate for
           each other during embryonic development.
          Length = 370

 Score = 29.7 bits (67), Expect = 0.076
 Identities = 9/17 (52%), Positives = 13/17 (76%)

Query: 53  LGTPDYLAPELLLGQDH 69
           +GTPDY++PE+L  Q  
Sbjct: 204 VGTPDYISPEVLKSQGG 220


>gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein
           Serine/Threonine Kinase, Atypical Protein Kinase C.
           Serine/Threonine Kinases (STKs), Atypical Protein Kinase
           C (aPKC) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           aPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. aPKCs only require
           phosphatidylserine (PS) for activation. They contain a
           C2-like region, instead of a calcium-binding (C2) region
           found in classical PKCs, in their regulatory domain.
           There are two aPKC isoforms, zeta and iota. aPKCs are
           involved in many cellular functions including
           proliferation, migration, apoptosis, polarity
           maintenance and cytoskeletal regulation. They also play
           a critical role in the regulation of glucose metabolism
           and in the pathogenesis of type 2 diabetes.
          Length = 329

 Score = 29.4 bits (66), Expect = 0.086
 Identities = 10/16 (62%), Positives = 15/16 (93%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP+Y+APE+L G+D+
Sbjct: 158 GTPNYIAPEILRGEDY 173


>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases.
           Protein Kinases (PKs), STE family, catalytic (c) domain.
           PKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine or tyrosine residues on
           protein substrates. The STE family is part of a larger
           superfamily that includes the catalytic domains of other
           protein serine/threonine kinases (STKs), protein
           tyrosine kinases (PTKs), RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase (PI3K). This family is composed of STKs, and
           some dual-specificity PKs that phosphorylate both
           threonine and tyrosine residues of target proteins. Most
           members are kinases involved in mitogen-activated
           protein kinase (MAPK) signaling cascades, acting as MAPK
           kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK
           kinase kinase kinases (MAP4Ks). The MAPK signaling
           pathways are important mediators of cellular responses
           to extracellular signals. The pathways involve a triple
           kinase core cascade comprising of the MAPK, which is
           phosphorylated and activated by a MAPKK, which itself is
           phosphorylated and activated by a MAPKKK. Each MAPK
           cascade is activated either by a small GTP-binding
           protein or by an adaptor protein, which transmits the
           signal either directly to a MAPKKK to start the triple
           kinase core cascade or indirectly through a mediator
           kinase, a MAP4K. Other STE family members include
           p21-activated kinases (PAKs) and class III myosins,
           among others. PAKs are Rho family GTPase-regulated
           kinases that serve as important mediators in the
           function of Cdc42 (cell division cycle 42) and Rac.
           Class III myosins are motor proteins containing an
           N-terminal kinase catalytic domain and a C-terminal
           actin-binding domain, which can phosphorylate several
           cytoskeletal proteins, conventional myosin regulatory
           light chains, as well as autophosphorylate the
           C-terminal motor domain. They play an important role in
           maintaining the structural integrity of photoreceptor
           cell microvilli.
          Length = 253

 Score = 29.5 bits (67), Expect = 0.089
 Identities = 9/30 (30%), Positives = 20/30 (66%)

Query: 40  SVRIGKQASDNRILGTPDYLAPELLLGQDH 69
           S ++    + N ++GTP ++APE++ G+ +
Sbjct: 145 SAQLSDTKARNTMVGTPYWMAPEVINGKPY 174


>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases.  Protein Kinases
           (PKs), catalytic (c) domain. PKs catalyze the transfer
           of the gamma-phosphoryl group from ATP to
           serine/threonine or tyrosine residues on protein
           substrates. The PK family is part of a larger
           superfamily that includes the catalytic domains of RIO
           kinases, aminoglycoside phosphotransferase, choline
           kinase, phosphoinositide 3-kinase (PI3K), and
           actin-fragmin kinase. PKs make up a large family of
           serine/threonine kinases, protein tyrosine kinases
           (PTKs), and dual-specificity PKs that phosphorylate both
           serine/threonine and tyrosine residues of target
           proteins. Majority of protein phosphorylation, about
           95%, occurs on serine residues while only 1% occurs on
           tyrosine residues. Protein phosphorylation is a
           mechanism by which a wide variety of cellular proteins,
           such as enzymes and membrane channels, are reversibly
           regulated in response to certain stimuli. PKs often
           function as components of signal transduction pathways
           in which one kinase activates a second kinase, which in
           turn, may act on other kinases; this sequential action
           transmits a signal from the cell surface to target
           proteins, which results in cellular responses. The PK
           family is one of the largest known protein families with
           more than 100 homologous yeast enzymes and 550 human
           proteins. A fraction of PK family members are
           pseudokinases that lack crucial residues for catalytic
           activity. The mutiplicity of kinases allows for specific
           regulation according to substrate, tissue distribution,
           and cellular localization. PKs regulate many cellular
           processes including proliferation, division,
           differentiation, motility, survival, metabolism,
           cell-cycle progression, cytoskeletal rearrangement,
           immunity, and neuronal functions. Many kinases are
           implicated in the development of various human diseases
           including different types of cancer.
          Length = 215

 Score = 29.1 bits (66), Expect = 0.093
 Identities = 11/19 (57%), Positives = 15/19 (78%)

Query: 49  DNRILGTPDYLAPELLLGQ 67
              I+GTP Y+APE+LLG+
Sbjct: 150 LKTIVGTPAYMAPEVLLGK 168


>gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine
           Kinase, Serum- and Glucocorticoid-induced Kinase.
           Serine/Threonine Kinases (STKs), Serum- and
           Glucocorticoid-induced Kinase (SGK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The SGK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           isoforms of SGK, named SGK1, SGK2, and SGK3 (also called
           cytokine-independent survival kinase CISK). SGKs are
           activated by insulin and growth factors via
           phosphoinositide 3-kinase and PDK1. They activate ion
           channels, ion carriers, and the Na-K-ATPase, as well as
           regulate the activity of enzymes and transcription
           factors. SGKs play important roles in transport, hormone
           release, neuroexcitability, cell proliferation, and
           apoptosis.
          Length = 323

 Score = 29.4 bits (66), Expect = 0.10
 Identities = 10/16 (62%), Positives = 13/16 (81%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP+YLAPE+L  Q +
Sbjct: 158 GTPEYLAPEVLRKQPY 173


>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Phosphoinositide-dependent
           kinase 1.  Serine/Threonine Kinases (STKs),
           Phosphoinositide-dependent kinase 1 (PDK1) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PDK1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PDK1
           carries an N-terminal catalytic domain and a C-terminal
           pleckstrin homology (PH) domain that binds
           phosphoinositides. It phosphorylates the activation loop
           of AGC kinases that are regulated by PI3K such as PKB,
           SGK, and PKC, among others, and is crucial for their
           activation. Thus, it contributes in regulating many
           processes including metabolism, growth, proliferation,
           and survival. PDK1 also has the ability to
           autophosphorylate and is constitutively active in
           mammalian cells. PDK1 is essential for normal embryo
           development and is important in regulating cell volume.
          Length = 280

 Score = 29.1 bits (66), Expect = 0.11
 Identities = 7/15 (46%), Positives = 11/15 (73%)

Query: 54  GTPDYLAPELLLGQD 68
           GT +Y++PELL  + 
Sbjct: 184 GTAEYVSPELLNEKP 198


>gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein
           Serine/Threonine Kinase, Atypical Protein Kinase C iota.
            Serine/Threonine Kinases (STKs), Atypical Protein
           Kinase C (aPKC) subfamily, iota isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The aPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           aPKCs only require phosphatidylserine (PS) for
           activation. There are two aPKC isoforms, zeta and iota.
           PKC-iota is directly implicated in carcinogenesis. It is
           critical to oncogenic signaling mediated by Ras and
           Bcr-Abl. The PKC-iota gene is the target of
           tumor-specific gene amplification in many human cancers,
           and has been identified as a human oncogene. In addition
           to its role in transformed growth, PKC-iota also
           promotes invasion, chemoresistance, and tumor cell
           survival. Expression profiling of PKC-iota is a
           prognostic marker of poor clinical outcome in several
           human cancers. PKC-iota also plays a role in
           establishing cell polarity, and has critical embryonic
           functions.
          Length = 329

 Score = 29.3 bits (65), Expect = 0.12
 Identities = 10/16 (62%), Positives = 15/16 (93%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP+Y+APE+L G+D+
Sbjct: 158 GTPNYIAPEILRGEDY 173


>gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Atypical Protein Kinase C zeta.
            Serine/Threonine Kinases (STKs), Atypical Protein
           Kinase C (aPKC) subfamily, zeta isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The aPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           aPKCs only require phosphatidylserine (PS) for
           activation. There are two aPKC isoforms, zeta and iota.
           PKC-zeta plays a critical role in activating the glucose
           transport response. It is activated by glucose, insulin,
           and exercise through diverse pathways. PKC-zeta also
           plays a central role in maintaining cell polarity in
           yeast and mammalian cells. In addition, it affects actin
           remodeling in muscle cells.
          Length = 327

 Score = 28.5 bits (63), Expect = 0.18
 Identities = 10/27 (37%), Positives = 19/27 (70%)

Query: 43  IGKQASDNRILGTPDYLAPELLLGQDH 69
           +G   + +   GTP+Y+APE+L G+++
Sbjct: 147 LGPGDTTSTFCGTPNYIAPEILRGEEY 173


>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related
           kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related
           (NDR) kinase subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The NDR subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. NDR kinases
           regulate mitosis, cell growth, embryonic development,
           and neurological processes. They are also required for
           proper centrosome duplication. Higher eukaryotes contain
           two NDR isoforms, NDR1 and NDR2. This subfamily also
           contains fungal NDR-like kinases.
          Length = 364

 Score = 28.5 bits (64), Expect = 0.22
 Identities = 9/12 (75%), Positives = 11/12 (91%)

Query: 54  GTPDYLAPELLL 65
           GTPDY+APE+ L
Sbjct: 201 GTPDYIAPEVFL 212


>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Citron Rho-interacting kinase. 
           Serine/Threonine Kinases (STKs), Citron Rho-interacting
           kinase (CRIK) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The CRIK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CRIK is also called citron kinase. It contains
           a catalytic domain, a central coiled-coil domain, and a
           C-terminal region containing a Rho-binding domain (RBD),
           a zinc finger, and a pleckstrin homology (PH) domain, in
           addition to other motifs. CRIK, an effector of the small
           GTPase Rho, plays an important function during
           cytokinesis and affects its contractile process.
           CRIK-deficient mice show severe ataxia and epilepsy as a
           result of abnormal cytokinesis and massive apoptosis in
           neuronal precursors. A Down syndrome critical region
           protein TTC3 interacts with CRIK and inhibits
           CRIK-dependent neuronal differentiation and neurite
           extension.
          Length = 330

 Score = 28.2 bits (63), Expect = 0.24
 Identities = 9/16 (56%), Positives = 13/16 (81%)

Query: 53  LGTPDYLAPELLLGQD 68
           +GTPDY+APE+L   +
Sbjct: 164 VGTPDYIAPEVLTTMN 179


>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           LATS subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. LATS was originally identified in Drosophila
           using a screen for genes whose inactivation led to
           overproliferation of cells. In tetrapods, there are two
           LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in
           mice results in the development of various tumors,
           including sarcomas and ovarian cancer. LATS functions as
           a tumor suppressor and is implicated in cell cycle
           regulation.
          Length = 376

 Score = 28.2 bits (63), Expect = 0.24
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 16  DPMSPVSPIATPHPAKKIPFRTPKSVRIGKQASDNRILGTPDYLAPELLL 65
           D M P    +     +  P    +  R  ++   + ++GTP+Y+APE+LL
Sbjct: 169 DSMEPSEEWSEIDRCRLKPLER-RRKRQHQRCLAHSLVGTPNYIAPEVLL 217


>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), cAMP-dependent protein kinase (PKA) subfamily,
           PRKX-like kinases, catalytic (c) subunit. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The PKA
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. Members of this group include human PRKX (X
           chromosome-encoded protein kinase), Drosophila DC2, and
           similar proteins. PRKX is present in many tissues
           including fetal and adult brain, kidney, and lung. The
           PRKX gene is located in the Xp22.3 subregion and has a
           homolog called PRKY on the Y chromosome. An abnormal
           interchange between PRKX aand PRKY leads to the sex
           reversal disorder of XX males and XY females. PRKX is
           implicated in granulocyte/macrophage lineage
           differentiation, renal cell epithelial migration, and
           tubular morphogenesis in the developing kidney.
          Length = 291

 Score = 28.2 bits (63), Expect = 0.25
 Identities = 9/18 (50%), Positives = 14/18 (77%)

Query: 52  ILGTPDYLAPELLLGQDH 69
           + GTP+YLAPE++  + H
Sbjct: 158 LCGTPEYLAPEVIQSKGH 175


>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C.
           Serine/Threonine Kinases (STKs), Classical (or
           Conventional) Protein Kinase C (cPKC) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. cPKCs contain a
           calcium-binding C2 region in their regulatory domain.
           There are four cPKC isoforms, named alpha, betaI,
           betaII, and gamma. cPKCs are potent kinases for
           histones, myelin basic protein, and protamine. PKC-gamma
           is mainly expressed in neuronal tissues. It plays a role
           in protection from ischemia.
          Length = 324

 Score = 27.8 bits (62), Expect = 0.29
 Identities = 9/14 (64%), Positives = 12/14 (85%)

Query: 54  GTPDYLAPELLLGQ 67
           GTPDY+APE++  Q
Sbjct: 163 GTPDYIAPEIIAYQ 176


>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C epsilon.
            Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), epsilon isoform, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta.
           PKC-epsilon has been shown to behave as an oncoprotein.
           Its overexpression contributes to neoplastic
           transformation depending on the cell type. It
           contributes to oncogenesis by inducing disordered cell
           growth and inhibiting cell death. It also plays a role
           in tumor invasion and metastasis. PKC-epsilon has also
           been found to confer cardioprotection against ischemia
           and reperfusion-mediated damage. Other cellular
           functions include the regulation of gene expression,
           cell adhesion, and cell motility.
          Length = 321

 Score = 27.9 bits (62), Expect = 0.30
 Identities = 9/16 (56%), Positives = 13/16 (81%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTPDY+APE+L   ++
Sbjct: 158 GTPDYIAPEILQELEY 173


>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein
           Serine/Threonine Kinase, Mitogen-Activated Protein
           Kinase Kinase Kinase.  Serine/threonine kinases (STKs),
           mitogen-activated protein kinase (MAPK) kinase kinase
           (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MAPKKK subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called
           MAP/ERK kinase kinases (MEKKs) in some cases. They
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           This subfamily is composed of the Apoptosis
           Signal-regulating Kinases ASK1 (or MAPKKK5) and ASK2 (or
           MAPKKK6), MEKK1, MEKK2, MEKK3, MEKK4, as well as plant
           and fungal MAPKKKs. Also included in this subfamily are
           the cell division control proteins Schizosaccharomyces
           pombe Cdc7 and Saccharomyces cerevisiae Cdc15.
          Length = 260

 Score = 27.9 bits (63), Expect = 0.30
 Identities = 8/27 (29%), Positives = 16/27 (59%)

Query: 43  IGKQASDNRILGTPDYLAPELLLGQDH 69
           I        + GTP ++APE++ G+++
Sbjct: 154 IETGEGTGSVRGTPYWMAPEVIRGEEY 180


>gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic
           subunit; Provisional.
          Length = 340

 Score = 28.0 bits (62), Expect = 0.31
 Identities = 10/18 (55%), Positives = 14/18 (77%)

Query: 52  ILGTPDYLAPELLLGQDH 69
           + GTP+Y+APE+LL   H
Sbjct: 188 LCGTPEYIAPEILLNVGH 205


>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. 
           Serine/Threonine Kinases (STKs), NDR kinase subfamily,
           NDR2 isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The NDR
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. Higher eukaryotes
           contain two NDR isoforms, NDR1 and NDR2. Both isoforms
           play a role in proper centrosome duplication. In
           addition, NDR2 plays a role in regulating neuronal
           growth and differentiation, as well as in facilitating
           neurite outgrowth. It is also implicated in fear
           conditioning as it contributes to the coupling of
           neuronal morphological changes with fear-memory
           consolidation. NDR2 is also referred to as STK38-like.
          Length = 360

 Score = 27.7 bits (61), Expect = 0.34
 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 6/46 (13%)

Query: 26  TPHPAKKIPFRTPKSVRIGKQASDNR------ILGTPDYLAPELLL 65
           T +P     F+   S R  +    NR       +GTPDY+APE+ +
Sbjct: 164 THNPPSDFSFQNMNSKRKAETWKKNRRQLAYSTVGTPDYIAPEVFM 209


>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Yank1.  Serine/Threonine
           Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Yank1 subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. This subfamily
           contains uncharacterized STKs with similarity to the
           human protein designated Yank1 or STK32A.
          Length = 258

 Score = 27.7 bits (62), Expect = 0.35
 Identities = 9/16 (56%), Positives = 12/16 (75%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP Y+APE+L  Q +
Sbjct: 161 GTPGYMAPEVLCRQGY 176


>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine
           Kinase, Never In Mitosis gene A-related kinase.
           Serine/Threonine Kinases (STKs), Never In Mitosis gene A
           (NIMA)-related kinase (Nek) family, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek family is
           composed of 11 different mammalian members (Nek1-11)
           with similarity to the catalytic domain of Aspergillus
           nidulans NIMA kinase, the founding member of the Nek
           family which was identified in a screen for cell cycle
           mutants that were prevented from entering mitosis. Neks
           contain a conserved N-terminal catalytic domain and a
           more divergent C-terminal regulatory region of various
           sizes and structures. They are involved in the
           regulation of downstream processes following the
           activation of Cdc2, and many of their functions are cell
           cycle-related. They play critical roles in microtubule
           dynamics during ciliogenesis and mitosis.
          Length = 258

 Score = 27.5 bits (62), Expect = 0.49
 Identities = 8/16 (50%), Positives = 12/16 (75%)

Query: 52  ILGTPDYLAPELLLGQ 67
           ++GTP YL+PEL   +
Sbjct: 163 VVGTPYYLSPELCQNK 178


>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase B.  Serine/Threonine Kinases
           (STKs), Protein Kinase B (PKB) or Akt subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase (PI3K). There are
           three PKB isoforms from different genes, PKB-alpha (or
           Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. It is activated
           downstream of PI3K and plays important roles in diverse
           cellular functions including cell survival, growth,
           proliferation, angiogenesis, motility, and migration.
           PKB also has a central role in a variety of human
           cancers, having been implicated in tumor initiation,
           progression, and metastasis.
          Length = 323

 Score = 27.5 bits (61), Expect = 0.51
 Identities = 10/16 (62%), Positives = 13/16 (81%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP+YLAPE+L   D+
Sbjct: 157 GTPEYLAPEVLEDNDY 172


>gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, G protein-coupled Receptor
           Kinase 1.  Serine/Threonine Kinases (STKs), G
           protein-coupled Receptor Kinase (GRK) subfamily, GRK1
           isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The GRK
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. GRKs phosphorylate and regulate G
           protein-coupled receptors (GPCRs), the largest
           superfamily of cell surface receptors, which regulate
           some part of nearly all physiological functions.
           Phosphorylated GPCRs bind to arrestins, which prevents
           further G protein signaling despite the presence of
           activating ligand. There are seven types of GRKs, named
           GRK1 to GRK7. GRK1, also called rhodopsin kinase,
           belongs to the visual group of GRKs and is expressed in
           retinal cells. It phosphorylates rhodopsin in rod cells,
           which leads to termination of the phototransduction
           cascade. Mutations in GRK1 are associated to a
           recessively inherited form of stationary nightblindness
           called Oguchi disease.
          Length = 280

 Score = 27.1 bits (60), Expect = 0.52
 Identities = 9/16 (56%), Positives = 14/16 (87%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP ++APELL G+++
Sbjct: 159 GTPGFMAPELLQGEEY 174


>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B beta.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, beta (or Akt2) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-beta is the
           predominant PKB isoform expressed in insulin-responsive
           tissues. It plays a critical role in the regulation of
           glucose homeostasis. It is also implicated in muscle
           cell differentiation. Mice deficient in PKB-beta display
           normal growth weights but exhibit severe insulin
           resistance and diabetes, accompanied by lipoatrophy and
           B-cell failure.
          Length = 323

 Score = 27.3 bits (60), Expect = 0.52
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 43  IGKQASDNRILGTPDYLAPELLLGQDH 69
           I   A+     GTP+YLAPE+L   D+
Sbjct: 146 ISDGATMKTFCGTPEYLAPEVLEDNDY 172


>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit;
           Provisional.
          Length = 329

 Score = 27.1 bits (60), Expect = 0.56
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 12/40 (30%)

Query: 30  AKKIPFRTPKSVRIGKQASDNRILGTPDYLAPELLLGQDH 69
           AKK+P RT              + GTP+YLAPE++  + H
Sbjct: 165 AKKVPDRT------------FTLCGTPEYLAPEVIQSKGH 192


>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein
           Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2
           and similar domains.  Serine/Threonine Kinases (STKs),
           Chlamydomonas reinhardtii FA2-like subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Chlamydomonas
           reinhardtii FA2-like subfamily belongs to the
           (NIMA)-related kinase (Nek) family. The Nek family
           includes seven different Chlamydomonas Neks (CNKs 1-6
           and Fa2). This subfamily includes FA2 and CNK4.  The Nek
           family is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase.  Chlamydomonas reinhardtii FA2 was discovered
           in a genetic screen for deflagellation-defective
           mutants. It is essential for
           basal-body/centriole-associated microtubule severing,
           and plays a role in cell cycle progression. No cellular
           function has yet been ascribed to CNK4.
          Length = 256

 Score = 27.1 bits (60), Expect = 0.68
 Identities = 10/14 (71%), Positives = 12/14 (85%)

Query: 50  NRILGTPDYLAPEL 63
           N I+GTP YL+PEL
Sbjct: 159 NTIVGTPYYLSPEL 172


>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Novel Protein Kinase C eta.
           Serine/Threonine Kinases (STKs), Novel Protein Kinase C
           (nPKC), eta isoform, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           nPKC subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. PKCs are classified into three groups
           (classical, atypical, and novel) depending on their mode
           of activation and the structural characteristics of
           their regulatory domain. nPKCs are calcium-independent,
           but require DAG (1,2-diacylglycerol) and
           phosphatidylserine (PS) for activity. There are four
           nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta
           is predominantly expressed in squamous epithelia, where
           it plays a crucial role in the signaling of cell-type
           specific differentiation. It is also expressed in pro-B
           cells and early-stage thymocytes, and acts as a key
           regulator in early B-cell development. PKC-eta increases
           glioblastoma multiforme (GBM) proliferation and
           resistance to radiation, and is being developed as a
           therapeutic target for the management of GBM.
          Length = 320

 Score = 26.8 bits (59), Expect = 0.73
 Identities = 9/11 (81%), Positives = 11/11 (100%)

Query: 54  GTPDYLAPELL 64
           GTPDY+APE+L
Sbjct: 158 GTPDYIAPEIL 168


>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine
           Kinase, Protein Kinase N.  Serine/Threonine Kinases
           (STKs), Protein Kinase N (PKN) subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKN subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKN has a
           C-terminal catalytic domain that is highly homologous to
           PKCs. Its unique N-terminal regulatory region contains
           antiparallel coiled-coil (ACC) domains. In mammals,
           there are three PKN isoforms from different genes
           (designated PKN-alpha, beta, and gamma), which show
           different enzymatic properties, tissue distribution, and
           varied functions. PKN can be activated by the small
           GTPase Rho, and by fatty acids such as arachidonic and
           linoleic acids. It is involved in many biological
           processes including cytokeletal regulation, cell
           adhesion, vesicle transport, glucose transport,
           regulation of meiotic maturation and embryonic cell
           cycles, signaling to the nucleus, and tumorigenesis.
          Length = 324

 Score = 27.0 bits (60), Expect = 0.74
 Identities = 8/14 (57%), Positives = 11/14 (78%)

Query: 54  GTPDYLAPELLLGQ 67
           GTP++LAPE+L   
Sbjct: 163 GTPEFLAPEVLTET 176


>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of
           cAMP-dependent protein kinase-like Protein
           Serine/Threonine Kinases.  Serine/Threonine Kinases
           (STKs), Fission yeast Suppressor of loss of
           cAMP-dependent protein kinase (Sck1)-like subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Sck1-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of fungal proteins
           with similarity to the Schizosaccharomyces pombe STK
           Sck1. Sck1 plays a role in trehalase activation
           triggered by glucose and a nitrogen source. Trehalase
           catalyzes the cleavage of the disaccharide trehalose to
           glucose. Trehalose, as a carbohydrate reserve and stress
           metabolite, plays an important role in the response of
           yeast to environmental changes.
          Length = 330

 Score = 26.8 bits (59), Expect = 0.76
 Identities = 10/21 (47%), Positives = 13/21 (61%)

Query: 45  KQASDNRILGTPDYLAPELLL 65
              + N   GT +YLAPE+LL
Sbjct: 149 DNKTTNTFCGTTEYLAPEVLL 169


>gnl|CDD|173442 PTZ00153, PTZ00153, lipoamide dehydrogenase; Provisional.
          Length = 659

 Score = 26.8 bits (59), Expect = 0.79
 Identities = 9/46 (19%), Positives = 13/46 (28%)

Query: 13 SFPDPMSPVSPIATPHPAKKIPFRTPKSVRIGKQASDNRILGTPDY 58
           FP P+   +               P S+   KQ S   +   P  
Sbjct: 40 GFPVPLGKSTSSTFIRCNFVPSPANPISLGASKQESPGILTPMPSS 85


>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy
           protein kinase-like Protein Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Myotonic Dystrophy
           protein kinase (DMPK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The DMPK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. The DMPK-like subfamily is composed of DMPK
           and DMPK-related cell division control protein 42
           (Cdc42) binding kinase (MRCK). Three isoforms of MRCK
           are known, named alpha, beta and gamma. The DMPK gene is
           implicated in myotonic dystrophy 1 (DM1), an inherited
           multisystemic disorder with symptoms that include muscle
           hyperexcitability, progressive muscle weakness and
           wasting, cataract development, testicular atrophy, and
           cardiac conduction defects. The genetic basis for DM1 is
           the mutational expansion of a CTG repeat in the 3'-UTR
           of DMPK. DMPK is expressed in skeletal and cardiac
           muscles, and in central nervous tissues. The functional
           role of DMPK is not fully understood. It may play a role
           in the signal transduction and homeostasis of calcium.
           MRCK is activated via interaction with the small GTPase
           Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent
           cell motility. MRCKgamma is expressed in heart and
           skeletal muscles, unlike MRCKalpha and MRCKbeta, which
           are expressed ubiquitously.
          Length = 331

 Score = 26.7 bits (59), Expect = 0.95
 Identities = 8/12 (66%), Positives = 12/12 (100%)

Query: 53  LGTPDYLAPELL 64
           +GTPDY++PE+L
Sbjct: 164 VGTPDYISPEIL 175


>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein
           Serine/Threonine Kinases, Mammalian Ste20-like protein
           kinase 1 and 2.  Serine/threonine kinases (STKs),
           mammalian Ste20-like protein kinase 1 (MST1) and MST2
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MST1/2 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. This subfamily is composed of MST1, MST2, and
           related proteins including Drosophila Hippo and
           Dictyostelium discoideum Krs1 (kinase responsive to
           stress 1). MST1/2 and Hippo are involved in a conserved
           pathway that governs cell contact inhibition, organ size
           control, and tumor development. MST1 activates the
           mitogen-activated protein kinases (MAPKs) p38 and c-Jun
           N-terminal kinase (JNK) through MKK7 (a MAPK kinase) and
           MEKK1 (a MAPK kinase kinase) by acting as a MAPK kinase
           kinase kinase (MAPKKKK). Activation of JNK by MST1 leads
           to caspase activation and apoptosis. MST1 has also been
           implicated in cell proliferation and differentiation.
           Krs1 may regulate cell growth arrest and apoptosis in
           response to cellular stress.
          Length = 256

 Score = 26.5 bits (59), Expect = 0.95
 Identities = 8/27 (29%), Positives = 15/27 (55%)

Query: 43  IGKQASDNRILGTPDYLAPELLLGQDH 69
               A  N ++GTP ++APE++    +
Sbjct: 150 TDTMAKRNTVIGTPFWMAPEVIQEIGY 176


>gnl|CDD|236668 PRK10252, entF, enterobactin synthase subunit F; Provisional.
          Length = 1296

 Score = 26.5 bits (59), Expect = 1.00
 Identities = 15/57 (26%), Positives = 23/57 (40%), Gaps = 5/57 (8%)

Query: 2   LDDAEPKCPMASFPDPMSPVSPIATPHPAKKIPFRT-----PKSVRIGKQASDNRIL 53
           + D    C  A      +    ++ PH    I F +     PK V +G+ A  NR+L
Sbjct: 572 VPDLTSLCYNAPLAPQGAAPLQLSQPHHTAYIIFTSGSTGRPKGVMVGQTAIVNRLL 628


>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent
           protein Kinase-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase (CDK)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDKs are partly
           regulated by their subcellular localization, which
           defines substrate phosphorylation and the resulting
           specific function. CDK1, CDK2, CDK4, and CDK6 have
           well-defined functions in the cell cycle, such as the
           regulation of the early G1 phase by CDK4 or CDK6, the
           G1/S phase transition by CDK2, or the entry of mitosis
           by CDK1. They also exhibit overlapping cyclin
           specificity and functions in certain conditions.
           Knockout mice with a single CDK deleted remain viable
           with specific phenotypes, showing that some CDKs can
           compensate for each other. For example, CDK4 can
           compensate for the loss of CDK6, however, double
           knockout mice with both CDK4 and CDK6 deleted die in
           utero. CDK8 and CDK9 are mainly involved in
           transcription while CDK5 is implicated in neuronal
           function. CDK7 plays essential roles in both the cell
           cycle as a CDK-Activating Kinase (CAK) and in
           transcription as a component of the general
           transcription factor TFIIH.
          Length = 282

 Score = 26.3 bits (59), Expect = 1.0
 Identities = 8/12 (66%), Positives = 9/12 (75%)

Query: 58  YLAPELLLGQDH 69
           Y APE+LLG  H
Sbjct: 164 YRAPEILLGSKH 175


>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B alpha.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, alpha (or Akt1) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-alpha is
           predominantly expressed in endothelial cells. It is
           critical for the regulation of angiogenesis and the
           maintenance of vascular integrity. It also plays a role
           in adipocyte differentiation. Mice deficient in
           PKB-alpha exhibit perinatal morbidity, growth
           retardation, reduction in body weight accompanied by
           reduced sizes of multiple organs, and enhanced apoptosis
           in some cell types. PKB-alpha activity has been reported
           to be frequently elevated in breast and prostate
           cancers. In some cancer cells, PKB-alpha may act as a
           suppressor of metastasis.
          Length = 325

 Score = 26.1 bits (57), Expect = 1.2
 Identities = 10/16 (62%), Positives = 13/16 (81%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP+YLAPE+L   D+
Sbjct: 158 GTPEYLAPEVLEDNDY 173


>gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase 1.  Serine/Threonine Kinases
           (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. ROCK contains an
           N-terminal extension, a catalytic kinase domain, and a
           C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain, and is activated via interaction with Rho
           GTPases. ROCK1 is preferentially expressed in the liver,
           lung, spleen, testes, and kidney. It mediates signaling
           from Rho to the actin cytoskeleton. It is implicated in
           the development of cardiac fibrosis, cardiomyocyte
           apoptosis, and hyperglycemia. Mice deficient with ROCK1
           display eyelids open at birth (EOB) and omphalocele
           phenotypes due to the disorganization of actin filaments
           in the eyelids and the umbilical ring.
          Length = 371

 Score = 26.1 bits (57), Expect = 1.3
 Identities = 9/15 (60%), Positives = 13/15 (86%)

Query: 53  LGTPDYLAPELLLGQ 67
           +GTPDY++PE+L  Q
Sbjct: 204 VGTPDYISPEVLKSQ 218


>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine
           Kinase, p21-activated kinase.  Serine/threonine kinases
           (STKs), p21-activated kinase (PAK) subfamily, catalytic
           (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PAK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PAKs are Rho
           family GTPase-regulated kinases that serve as important
           mediators in the function of Cdc42 (cell division cycle
           42) and Rac. PAKs are implicated in the regulation of
           many cellular processes including growth factor
           receptor-mediated proliferation, cell polarity, cell
           motility, cell death and survival, and actin
           cytoskeleton organization. PAK deregulation is
           associated with tumor development. PAKs from higher
           eukaryotes are classified into two groups (I and II),
           according to their biochemical and structural features.
           Group I PAKs contain a PBD (p21-binding domain)
           overlapping with an AID (autoinhibitory domain), a
           C-terminal catalytic domain, SH3 binding sites and a
           non-classical SH3 binding site for PIX (PAK-interacting
           exchange factor). Group II PAKs contain a PBD and a
           catalytic domain, but lack other motifs found in group I
           PAKs. Since group II PAKs do not contain an obvious AID,
           they may be regulated differently from group I PAKs.
           Group I PAKs interact with the SH3 containing proteins
           Nck, Grb2 and PIX; no such binding has been demonstrated
           for group II PAKs.
          Length = 286

 Score = 26.0 bits (58), Expect = 1.4
 Identities = 8/19 (42%), Positives = 15/19 (78%)

Query: 50  NRILGTPDYLAPELLLGQD 68
           N ++GTP ++APE++  +D
Sbjct: 174 NSVVGTPYWMAPEVIKRKD 192


>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional.
          Length = 1021

 Score = 26.2 bits (57), Expect = 1.4
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 40  SVRIGKQASDNRILGTPDYLAPELLL 65
           S  IG ++  +  +GTP Y +PELLL
Sbjct: 189 SKNIGIESMAHSCVGTPYYWSPELLL 214


>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Rho-associated coiled-coil
           containing protein kinase 2.  Serine/Threonine Kinases
           (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The ROCK subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. ROCK contains an
           N-terminal extension, a catalytic kinase domain, and a
           C-terminal extension, which contains a coiled-coil
           region encompassing a Rho-binding domain (RBD) and a
           pleckstrin homology (PH) domain. ROCK is auto-inhibited
           by the RBD and PH domain interacting with the catalytic
           domain, and is activated via interaction with Rho
           GTPases. ROCK2 was the first identified target of
           activated RhoA, and was found to play a role in stress
           fiber and focal adhesion formation. It is prominently
           expressed in the brain, heart, and skeletal muscles. It
           is implicated in vascular and neurological disorders,
           such as hypertension and vasospasm of the coronary and
           cerebral arteries. ROCK2 is also activated by caspase-2
           cleavage, resulting in thrombin-induced microparticle
           generation in response to cell activation. Mice
           deficient in ROCK2 show intrauterine growth retardation
           and embryonic lethality because of placental
           dysfunction.
          Length = 370

 Score = 26.1 bits (57), Expect = 1.4
 Identities = 9/15 (60%), Positives = 13/15 (86%)

Query: 53  LGTPDYLAPELLLGQ 67
           +GTPDY++PE+L  Q
Sbjct: 204 VGTPDYISPEVLKSQ 218


>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein
           Serine/Threonine Kinase, Protein Kinase B gamma.
           Serine/Threonine Kinases (STKs), Protein Kinase B (PKB)
           or Akt subfamily, gamma (or Akt3) isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The PKB subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. There are three
           PKB isoforms from different genes, PKB-alpha (or Akt1),
           PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB
           contains an N-terminal pleckstrin homology (PH) domain
           and a C-terminal catalytic domain. PKB-gamma is
           predominantly expressed in neuronal tissues. Mice
           deficient in PKB-gamma show a reduction in brain weight
           due to the decreases in cell size and cell number.
           PKB-gamma has also been shown to be upregulated in
           estrogen-deficient breast cancer cells,
           androgen-independent prostate cancer cells, and primary
           ovarian tumors. It acts as a key mediator in the genesis
           of ovarian cancer.
          Length = 328

 Score = 26.2 bits (57), Expect = 1.4
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 43  IGKQASDNRILGTPDYLAPELLLGQDH 69
           I   A+     GTP+YLAPE+L   D+
Sbjct: 146 ITDAATMKTFCGTPEYLAPEVLEDNDY 172


>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor 1.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, LATS1 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The LATS subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. LATS functions as a tumor
           suppressor and is implicated in cell cycle regulation.
           Inactivation of LATS1 in mice results in the development
           of various tumors, including sarcomas and ovarian
           cancer. Promoter methylation, loss of heterozygosity,
           and missense mutations targeting the LATS1 gene have
           also been found in human sarcomas and ovarian cancers.
           In addition, decreased expression of LATS1 is associated
           with an aggressive phenotype and poor prognosis. LATS1
           induces G2 arrest and promotes cytokinesis. It may be a
           component of the mitotic exit network in higher
           eukaryotes.
          Length = 382

 Score = 26.1 bits (57), Expect = 1.5
 Identities = 10/27 (37%), Positives = 20/27 (74%)

Query: 39  KSVRIGKQASDNRILGTPDYLAPELLL 65
           ++ R  ++   + ++GTP+Y+APE+LL
Sbjct: 195 RAARQHQRCLAHSLVGTPNYIAPEVLL 221


>gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 2.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 2 (TAO2) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           Human TAO2 is also known as prostate-derived Ste20-like
           kinase (PSK) and was identified in a screen for
           overexpressed RNAs in prostate cancer. TAO2 activates
           both p38 and c-Jun N-terminal kinase (JNK), by
           phosphorylating and activating the respective MAP/ERK
           kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6
           and MKK4/MKK7. TAO2 contains a long C-terminal extension
           with autoinhibitory segments. It is activated by the
           release of this inhibition and the phosphorylation of
           its activation loop serine. TAO2 functions as a
           regulator of actin cytoskeletal and microtubule
           organization. In addition, it regulates the transforming
           growth factor-activated kinase 1 (TAK1), which is a
           MAPKKK that plays an essential role in the signaling
           pathways of tumor necrosis factor (TNF), interleukin 1
           (IL-1), and Toll-like receptor (TLR).
          Length = 308

 Score = 25.8 bits (56), Expect = 1.6
 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 6/45 (13%)

Query: 30  AKKIPFRTPKSVRIGKQASD------NRILGTPDYLAPELLLGQD 68
           A  I    P  V++G   S       N  +GTP ++APE++L  D
Sbjct: 143 AGNILLSEPGLVKLGDFGSASIMAPANXFVGTPYWMAPEVILAMD 187


>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase
           3-like Protein Serine/Threonine Kinases.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3
           (MEKK3)-like subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The MEKK3-like subfamily is part of a larger superfamily
           that includes the catalytic domains of other protein
           STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. This subfamily is composed of
           MEKK3, MEKK2, and related proteins, all containing an
           N-terminal PB1 domain, which mediates oligomerization,
           and a C-terminal catalytic domain. MEKK2 and MEKK3 are
           mitogen-activated protein kinase (MAPK) kinase kinases
           (MAPKKKs or MKKKs or MAP3Ks), proteins that
           phosphorylate and activate MAPK kinases (MAPKKs or MKKs
           or MAP2Ks), which in turn phosphorylate and activate
           MAPKs during signaling cascades that are important in
           mediating cellular responses to extracellular signals.
           MEKK2 and MEKK3 activate MEK5 (also called MKK5), which
           activates extracellular signal-regulated kinase 5
           (ERK5). The ERK5 cascade plays roles in promoting cell
           proliferation, differentiation, neuronal survival, and
           neuroprotection. MEKK3 plays an essential role in
           embryonic angiogenesis and early heart development.
           MEKK2 and MEKK3 can also activate the MAPKs, c-Jun
           N-terminal kinase (JNK) and p38, through their
           respective MAPKKs.
          Length = 263

 Score = 25.9 bits (57), Expect = 1.7
 Identities = 6/18 (33%), Positives = 14/18 (77%)

Query: 52  ILGTPDYLAPELLLGQDH 69
           + GTP +++PE++ G+ +
Sbjct: 167 VTGTPYWMSPEVISGEGY 184


>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein
           Serine/Threonine Kinase, MAP/ERK kinase kinase 4.
           Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4
           (MEKK4) subfamily, catalytic (c) domain. STKs catalyze
           the transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           MEKK4 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MEKK4 is a mitogen-activated protein kinase
           (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that
           phosphorylates and activates MAPK kinases (MAPKKs or
           MKKs or MAP2Ks), which in turn phosphorylate and
           activate MAPKs during signaling cascades that are
           important in mediating cellular responses to
           extracellular signals. MEKK4 activates the c-Jun
           N-terminal kinase (JNK) and p38 MAPK signaling pathways
           by directly activating their respective MAPKKs,
           MKK4/MKK7 and MKK3/MKK6. JNK and p38 are collectively
           known as stress-activated MAPKs, as they are activated
           in response to a variety of environmental stresses and
           pro-inflammatory cytokines. MEKK4 also plays roles in
           the re-polarization of the actin cytoskeleton in
           response to osmotic stress, in the proper closure of the
           neural tube, in cardiovascular development, and in
           immune responses.
          Length = 264

 Score = 25.8 bits (57), Expect = 1.7
 Identities = 8/15 (53%), Positives = 11/15 (73%)

Query: 53  LGTPDYLAPELLLGQ 67
            GTP Y+APE++ G 
Sbjct: 164 AGTPAYMAPEVITGG 178


>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Large Tumor Suppressor 2.
           Serine/Threonine Kinases (STKs), Large Tumor Suppressor
           (LATS) subfamily, LATS2 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The LATS subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. LATS functions as a tumor
           suppressor and is implicated in cell cycle regulation.
           LATS2 is an essential mitotic regulator responsible for
           coordinating accurate cytokinesis completion and
           governing the stabilization of other mitotic regulators.
           It is also critical in the maintenance of proper
           chromosome number, genomic stability, mitotic fidelity,
           and the integrity of centrosome duplication.
           Downregulation of LATS2 is associated with poor
           prognosis in acute lymphoblastic leukemia and breast
           cancer.
          Length = 381

 Score = 25.7 bits (56), Expect = 1.7
 Identities = 9/14 (64%), Positives = 14/14 (100%)

Query: 52  ILGTPDYLAPELLL 65
           ++GTP+Y+APE+LL
Sbjct: 208 LVGTPNYIAPEVLL 221


>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, DMPK-related cell division
           control protein 42 binding kinase beta.
           Serine/Threonine Kinases (STKs), DMPK-like subfamily,
           DMPK-related cell division control protein 42 (Cdc42)
           binding kinase (MRCK) beta isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The DMPK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MRCK is activated via interaction with the
           small GTPase Cdc42. MRCK/Cdc42 signaling mediates
           myosin-dependent cell motility. MRCKbeta is expressed
           ubiquitously in many tissues.
          Length = 331

 Score = 25.7 bits (56), Expect = 2.2
 Identities = 8/12 (66%), Positives = 12/12 (100%)

Query: 53  LGTPDYLAPELL 64
           +GTPDY++PE+L
Sbjct: 164 VGTPDYISPEIL 175


>gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent
           protein Kinase 8-like Serine/Threonine Kinases.
           Serine/Threonine Kinases (STKs), Cyclin-Dependent
           protein Kinase 8 (CDK8)-like subfamily, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The CDK8-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. This subfamily is
           composed of CDK8, CDC2L6, and similar proteins. CDK8
           functions as a negative or positive regulator of
           transcription, depending on the scenario. Together with
           its regulator, cyclin C, it reversibly associates with
           the multi-subunit core Mediator complex, a cofactor that
           is involved in regulating RNA polymerase II (RNAP
           II)-dependent transcription. CDC2L6 also associates with
           Mediator in complexes lacking CDK8. In VP16-dependent
           transcriptional activation, CDK8 and CDC2L6 exerts
           opposing effects by positive and negative regulation,
           respectively, in similar conditions.
          Length = 316

 Score = 25.3 bits (56), Expect = 2.2
 Identities = 11/23 (47%), Positives = 14/23 (60%)

Query: 47  ASDNRILGTPDYLAPELLLGQDH 69
           A  + ++ T  Y APELLLG  H
Sbjct: 170 ADLDPVVVTIWYRAPELLLGARH 192


>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. 
           Serine/Threonine Kinases (STKs), NDR kinase subfamily,
           NDR1 isoform, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The NDR
           subfamily is part of a larger superfamily that includes
           the catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. NDR kinase contains an N-terminal regulatory
           (NTR) domain and an insert within the catalytic domain
           that contains an auto-inhibitory sequence. Like many
           other AGC kinases, NDR kinase requires phosphorylation
           at two sites, the activation loop (A-loop) and the
           hydrophobic motif (HM), for activity. Higher eukaryotes
           contain two NDR isoforms, NDR1 and NDR2. Both isoforms
           play a role in proper centrosome duplication. NDR1 is
           highly expressed in thymus, muscle, lung and spleen. It
           is not an essential protein because mice deficient of
           NDR1 remain viable and fertile. However, these mice
           develop T-cell lymphomas and appear to be hypersenstive
           to carcinogenic treatment. NDR1 appears to act as a
           tumor suppressor. NDR1 is also called STK38.
          Length = 363

 Score = 25.4 bits (55), Expect = 2.4
 Identities = 8/13 (61%), Positives = 12/13 (92%)

Query: 53  LGTPDYLAPELLL 65
           +GTPDY+APE+ +
Sbjct: 197 VGTPDYIAPEVFM 209


>gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 3.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 3 (TAO3) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO3 is also known as JIK (JNK inhibitory kinase) or KFC
           (kinase from chicken). It specifically activates c-Jun
           N-terminal kinase (JNK), presumably by phosphorylating
           and activating MKK4/MKK7. In Saccharomyces cerevisiae,
           TAO3 is a component of the RAM (regulation of Ace2p
           activity and cellular morphogenesis) signaling pathway.
           TAO3 is upregulated in retinal ganglion cells after
           axotomy, and may play a role in apoptosis.
          Length = 313

 Score = 25.4 bits (55), Expect = 2.8
 Identities = 9/19 (47%), Positives = 14/19 (73%)

Query: 50  NRILGTPDYLAPELLLGQD 68
           N  +GTP ++APE++L  D
Sbjct: 175 NSFVGTPYWMAPEVILAMD 193


>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine
           Kinase, Thousand-and-one amino acids proteins.
           Serine/threonine kinases (STKs), thousand-and-one amino
           acids (TAO) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. They activate the MAPKs, p38 and c-Jun
           N-terminal kinase (JNK), by phosphorylating and
           activating the respective MAP/ERK kinases (MEKs, also
           known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK
           signaling cascades are important in mediating cellular
           responses to extracellular signals. Vertebrates contain
           three TAO subfamily members, named TAO1, TAO2, and TAO3.
          Length = 307

 Score = 25.2 bits (55), Expect = 2.9
 Identities = 9/19 (47%), Positives = 14/19 (73%)

Query: 50  NRILGTPDYLAPELLLGQD 68
           N  +GTP ++APE++L  D
Sbjct: 169 NSFVGTPYWMAPEVILAMD 187


>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C
           alpha.  Serine/Threonine Kinases (STKs), Classical
           Protein Kinase C (cPKC) subfamily, alpha isoform,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. There are four
           cPKC isoforms, named alpha, betaI, betaII, and gamma.
           PKC-alpha is expressed in many tissues and is associated
           with cell proliferation, apoptosis, and cell motility.
           It plays a role in the signaling of the growth factors
           PDGF, VEGF, EGF, and FGF. Abnormal levels of PKC-alpha
           have been detected in many transformed cell lines and
           several human tumors. In addition, PKC-alpha is required
           for HER2 dependent breast cancer invasion.
          Length = 323

 Score = 25.3 bits (55), Expect = 3.0
 Identities = 9/14 (64%), Positives = 12/14 (85%)

Query: 54  GTPDYLAPELLLGQ 67
           GTPDY+APE++  Q
Sbjct: 163 GTPDYIAPEIIAYQ 176


>gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 2.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK2 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more
           restricted distribution that SGK1 and is most abundantly
           expressed in epithelial tissues including kidney, liver,
           pancreas, and the choroid plexus of the brain. In vitro
           cellular assays show that SGK2 can stimulate the
           activity of ion channels, the glutamate transporter
           EEAT4, and the glutamate receptors, GluR6 and GLUR1.
          Length = 321

 Score = 25.3 bits (55), Expect = 3.0
 Identities = 9/14 (64%), Positives = 12/14 (85%)

Query: 54  GTPDYLAPELLLGQ 67
           GTP+YLAPE+L  +
Sbjct: 158 GTPEYLAPEVLRKE 171


>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine
           Kinase, G protein-coupled Receptor Kinase.
           Serine/Threonine Kinases (STKs), G protein-coupled
           Receptor Kinase (GRK) subfamily, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The GRK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. GRKs phosphorylate and
           regulate G protein-coupled receptors (GPCRs), the
           largest superfamily of cell surface receptors, which
           regulate some part of nearly all physiological
           functions. Phosphorylated GPCRs bind to arrestins, which
           prevents further G protein signaling despite the
           presence of activating ligand. GRKs contain a central
           catalytic domain, flanked by N- and C-terminal
           extensions. The N-terminus contains an RGS (regulator of
           G protein signaling) homology (RH) domain and several
           motifs. The C-terminus diverges among different groups
           of GRKs. There are seven types of GRKs, named GRK1 to
           GRK7. They are subdivided into three main groups: visual
           (GRK1/7); beta-adrenergic receptor kinases (GRK2/3); and
           GRK4-like (GRK4/5/6). Expression of GRK2/3/5/6 is
           widespread while GRK1/4/7 show a limited tissue
           distribution. The substrate spectrum of the widely
           expressed GRKs partially overlaps. GRKs play important
           roles in the cardiovascular, immune, respiratory,
           skeletal, and nervous systems.
          Length = 277

 Score = 25.2 bits (55), Expect = 3.2
 Identities = 9/16 (56%), Positives = 13/16 (81%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP Y+APE+L G+ +
Sbjct: 156 GTPGYMAPEVLQGEVY 171


>gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Thousand-and-one amino acids 1.
            Serine/threonine kinases (STKs), thousand-and-one amino
           acids 1 (TAO1) subfamily, catalytic (c) domain. STKs
           catalyze the transfer of the gamma-phosphoryl group from
           ATP to serine/threonine residues on protein substrates.
           The TAO subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. TAO proteins possess mitogen-activated protein
           kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK)
           activity. MAPK signaling cascades are important in
           mediating cellular responses to extracellular signals.
           TAO1 is sometimes referred to as prostate-derived
           sterile 20-like kinase 2 (PSK2). TAO1 activates the p38
           MAPK through direct interaction with and activation of
           MEK3. TAO1 is highly expressed in the brain and may play
           a role in neuronal apoptosis. TAO1 interacts with the
           checkpoint proteins BubR1 and Mad2, and plays an
           important role in regulating mitotic progression, which
           is required for both chromosome congression and
           checkpoint-induced anaphase delay. TAO1 may play a role
           in protecting genomic stability.
          Length = 317

 Score = 25.0 bits (54), Expect = 3.4
 Identities = 9/19 (47%), Positives = 14/19 (73%)

Query: 50  NRILGTPDYLAPELLLGQD 68
           N  +GTP ++APE++L  D
Sbjct: 179 NSFVGTPYWMAPEVILAMD 197


>gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein
           Serine/Threonine Kinase, DMPK-related cell division
           control protein 42 binding kinase alpha.
           Serine/Threonine Kinases (STKs), DMPK-like subfamily,
           DMPK-related cell division control protein 42 (Cdc42)
           binding kinase (MRCK) alpha isoform, catalytic (c)
           domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The DMPK-like subfamily
           is part of a larger superfamily that includes the
           catalytic domains of other protein STKs, protein
           tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. MRCK is activated via interaction with the
           small GTPase Cdc42. MRCK/Cdc42 signaling mediates
           myosin-dependent cell motility. MRCKalpha is expressed
           ubiquitously in many tissues. It plays a role in the
           regulation of peripheral actin reorganization and
           neurite outgrowth. It may also play a role in the
           transferrin iron uptake pathway.
          Length = 332

 Score = 25.0 bits (54), Expect = 3.8
 Identities = 8/12 (66%), Positives = 12/12 (100%)

Query: 53  LGTPDYLAPELL 64
           +GTPDY++PE+L
Sbjct: 164 VGTPDYISPEIL 175


>gnl|CDD|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein
           Serine/Threonine Kinase, Classical Protein Kinase C
           beta.  Serine/Threonine Kinases (STKs), Classical
           Protein Kinase C (cPKC) subfamily, beta isoforms,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The cPKC subfamily is
           part of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. PKCs are
           classified into three groups (classical, atypical, and
           novel) depending on their mode of activation and the
           structural characteristics of their regulatory domain.
           PKCs undergo three phosphorylations in order to take
           mature forms. In addition, cPKCs depend on calcium, DAG
           (1,2-diacylglycerol), and in most cases,
           phosphatidylserine (PS) for activation. There are four
           cPKC isoforms, named alpha, betaI, betaII, and gamma.
           The PKC beta isoforms (I and II), generated by
           alternative splicing of a single gene, are
           preferentially activated by hyperglycemia-induced DAG in
           retinal tissues. This is implicated in diabetic
           microangiopathy such as ischemia, neovascularization,
           and abnormal vasodilator function. PKC-beta also plays
           an important role in VEGF signaling. In addition,
           glucose regulates proliferation in retinal endothelial
           cells via PKC-betaI. PKC-beta is also being explored as
           a therapeutic target in cancer. It contributes to tumor
           formation and is involved in the tumor host mechanisms
           of inflammation and angiogenesis.
          Length = 323

 Score = 25.0 bits (54), Expect = 3.8
 Identities = 9/14 (64%), Positives = 12/14 (85%)

Query: 54  GTPDYLAPELLLGQ 67
           GTPDY+APE++  Q
Sbjct: 163 GTPDYIAPEIIAYQ 176


>gnl|CDD|79056 PRK12581, PRK12581, oxaloacetate decarboxylase; Provisional.
          Length = 468

 Score = 25.1 bits (54), Expect = 3.9
 Identities = 12/23 (52%), Positives = 14/23 (60%)

Query: 34  PFRTPKSVRIGKQASDNRILGTP 56
           P  TP S  +G QA+ N ILG P
Sbjct: 347 PLVTPLSQMVGTQAAMNVILGKP 369


>gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 3.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK3 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3 (also called
           cytokine-independent survival kinase CISK). SGK3 is
           expressed in most tissues and is most abundant in the
           embryo and adult heart and spleen. It was originally
           discovered in a screen for antiapoptotic genes. It
           phosphorylates and inhibits the proapoptotic proteins,
           Bad and FKHRL1. SGK3 also regulates many transporters,
           ion channels, and receptors. It plays a critical role in
           hair follicle morphogenesis and hair cycling.
          Length = 325

 Score = 25.0 bits (54), Expect = 4.0
 Identities = 9/14 (64%), Positives = 12/14 (85%)

Query: 54  GTPDYLAPELLLGQ 67
           GTP+YLAPE++  Q
Sbjct: 158 GTPEYLAPEVIRKQ 171


>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein
           Serine/Threonine Kinase, Never In Mitosis gene A-related
           kinase 2.  Serine/Threonine Kinases (STKs), Never In
           Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily,
           catalytic (c) domain. STKs catalyze the transfer of the
           gamma-phosphoryl group from ATP to serine/threonine
           residues on protein substrates. The Nek2 subfamily is
           one of a family of 11 different Neks (Nek1-11) that are
           involved in cell cycle control. The Nek family is part
           of a larger superfamily that includes the catalytic
           domains of other protein STKs, protein tyrosine kinases,
           RIO kinases, aminoglycoside phosphotransferase, choline
           kinase, and phosphoinositide 3-kinase. The Nek2
           subfamily includes Aspergillus nidulans NIMA kinase, the
           founding member of the Nek family, which was identified
           in a screen for cell cycle mutants prevented from
           entering mitosis. NIMA is essential for mitotic entry
           and progression through mitosis, and its degradation is
           essential for mitotic exit. NIMA is involved in nuclear
           membrane fission. Vertebrate Nek2 is a cell
           cycle-regulated STK, localized in centrosomes and
           kinetochores, that regulates centrosome splitting at the
           G2/M phase. It also interacts with other mitotic kinases
           such as Polo-like kinase 1 and may play a role in
           spindle checkpoint. An increase in the expression of the
           human NEK2 gene is strongly associated with the
           progression of non-Hodgkin lymphoma.
          Length = 265

 Score = 24.5 bits (54), Expect = 5.1
 Identities = 7/15 (46%), Positives = 10/15 (66%)

Query: 53  LGTPDYLAPELLLGQ 67
           +GTP Y++PE L   
Sbjct: 171 VGTPYYMSPEQLNHM 185


>gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein
           Serine/Threonine Kinase, Serum- and
           Glucocorticoid-induced Kinase 1.  Serine/Threonine
           Kinases (STKs), Serum- and Glucocorticoid-induced Kinase
           (SGK) subfamily, SGK1 isoform, catalytic (c) domain.
           STKs catalyze the transfer of the gamma-phosphoryl group
           from ATP to serine/threonine residues on protein
           substrates. The SGK subfamily is part of a larger
           superfamily that includes the catalytic domains of other
           protein STKs, protein tyrosine kinases, RIO kinases,
           aminoglycoside phosphotransferase, choline kinase, and
           phosphoinositide 3-kinase. There are three isoforms of
           SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously
           expressed and is under transcriptional control of
           numerous stimuli including cell stress (cell shrinkage),
           serum, hormones (gluco- and mineralocorticoids),
           gonadotropins, growth factors, interleukin-6, and other
           cytokines. It plays roles in sodium retention and
           potassium elimination in the kidney, nutrient transport,
           salt sensitivity, memory consolidation, and cardiac
           repolarization. A common SGK1 variant is associated with
           increased blood pressure and body weight. SGK1 may also
           contribute to tumor growth, neurodegeneration, fibrosing
           disease, and ischemia.
          Length = 325

 Score = 24.6 bits (53), Expect = 5.3
 Identities = 10/16 (62%), Positives = 13/16 (81%)

Query: 54  GTPDYLAPELLLGQDH 69
           GTP+YLAPE+L  Q +
Sbjct: 158 GTPEYLAPEVLHKQPY 173


>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function
           prediction only / Signal transduction mechanisms /
           Transcription / DNA replication, recombination, and
           repair].
          Length = 384

 Score = 24.7 bits (52), Expect = 5.4
 Identities = 10/18 (55%), Positives = 14/18 (77%)

Query: 50  NRILGTPDYLAPELLLGQ 67
           +  +GTP Y+APE+LLG 
Sbjct: 166 STSVGTPGYMAPEVLLGL 183


>gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein.
            This model represents proteins of 1350 in length, in
           multiple species of Burkholderia, in Acidovorax avenae
           subsp. citrulli AAC00-1 and Delftia acidovorans SPH-1,
           and in multiple copies in Sorangium cellulosum, in
           genomic neighborhoods that include a
           cyclodehydratase/docking scaffold fusion protein
           (TIGR03882) and a member of the thiazole/oxazole
           modified metabolite (TOMM) precursor family TIGR03795.
           It has a kinase domain in the N-terminal 300 amino
           acids, followed by a cyclase homology domain, followed
           by regions without named domain definitions. It is a
           probable bacteriocin-like metabolite biosynthesis
           protein [Cellular processes, Toxin production and
           resistance].
          Length = 1266

 Score = 24.4 bits (53), Expect = 5.6
 Identities = 10/16 (62%), Positives = 12/16 (75%)

Query: 52  ILGTPDYLAPELLLGQ 67
           +LGTP Y APE L G+
Sbjct: 149 VLGTPTYCAPEQLRGE 164


>gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine
           Kinase, Cell Division Cycle 2-like 1.  Serine/Threonine
           Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1)
           subfamily, catalytic (c) domain. STKs catalyze the
           transfer of the gamma-phosphoryl group from ATP to
           serine/threonine residues on protein substrates. The
           CDC2L1 subfamily is part of a larger superfamily that
           includes the catalytic domains of other protein STKs,
           protein tyrosine kinases, RIO kinases, aminoglycoside
           phosphotransferase, choline kinase, and phosphoinositide
           3-kinase. CDKs belong to a large family of STKs that are
           regulated by their cognate cyclins. Together, they are
           involved in the control of cell-cycle progression,
           transcription, and neuronal function. CDC2L1, also
           called PITSLRE, exists in different isoforms which are
           named using the alias CDK11(p). The CDC2L1 gene produces
           two protein products, CDK11(p110) and CDK11(p58). CDC2L1
           is also represented by the caspase-processed CDK11(p46).
           CDK11(p110), the major isoform, associates with cyclin L
           and is expressed throughout the cell cycle. It is
           involved in RNA processing and the regulation of
           transcription. CDK11(p58) associates with cyclin D3 and
           is expressed during the G2/M phase of the cell cycle. It
           plays roles in spindle morphogenesis, centrosome
           maturation, sister chromatid cohesion, and the
           completion of mitosis. CDK11(p46) is formed from the
           larger isoforms by caspases during TNFalpha- and
           Fas-induced apoptosis. It functions as a downstream
           effector kinase in apoptotic signaling pathways and
           interacts with eukaryotic initiation factor 3f (eIF3f), 
           p21-activated kinase (PAK1), and Ran-binding protein
           (RanBPM).
          Length = 293

 Score = 24.1 bits (53), Expect = 6.4
 Identities = 8/12 (66%), Positives = 8/12 (66%)

Query: 58  YLAPELLLGQDH 69
           Y APELLLG   
Sbjct: 172 YRAPELLLGAKE 183


>gnl|CDD|99992 cd03822, GT1_ecORF704_like, This family is most closely related to
           the GT1 family of glycosyltransferases. ORF704 in E.
           coli has been shown to be involved in the biosynthesis
           of O-specific mannose homopolysaccharides.
          Length = 366

 Score = 23.8 bits (52), Expect = 8.2
 Identities = 14/54 (25%), Positives = 20/54 (37%), Gaps = 6/54 (11%)

Query: 16  DPMSPVSPIATPHPAKKIPFRTPKSVRIGKQASDNRILGTPDYLAP----ELLL 65
                ++ I  PH     P   P+S++         +L T   L P    ELLL
Sbjct: 153 AYPEKIAVI--PHGVPDPPAEPPESLKALGGLDGRPVLLTFGLLRPYKGLELLL 204


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.316    0.136    0.421 

Gapped
Lambda     K      H
   0.267   0.0818    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 3,608,744
Number of extensions: 262644
Number of successful extensions: 393
Number of sequences better than 10.0: 1
Number of HSP's gapped: 392
Number of HSP's successfully gapped: 85
Length of query: 69
Length of database: 10,937,602
Length adjustment: 39
Effective length of query: 30
Effective length of database: 9,207,796
Effective search space: 276233880
Effective search space used: 276233880
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (24.0 bits)