Diaphorina citri psyllid: psy6264

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
MNSRHIALPGYEWKKRAYFHHTGYPGGVSWTLAWQLHEIDPTLVMKKAVRWELPRSLIKFRLMARLHIFPDQEVPEDLLKNVSSQIRQLRPVPRTLASYSDKEVDEFPKINDFPKDYILK
cccccEEECcccccccEEccccccccccHHccHHHHHHccHHHHHHHHHHHcccccHHHHHHHHcccccccccccHHHHcccccccccccccccccccccHHHHHccccccccccccccc
MNSRHIALPGYEWKKRAYFHHTGYPGGVSWTLAWQLHEIDPTLVMKKAVRWELPRSLIKFRLMARLHIFPDQEVPEDLLKNVSSQIRQL*P*******YS*KEVDEFPKINDFPKDYIL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSRHIALPGYEWKKRAYFHHTGYPGGVSWTLAWQLHEIDPTLVMKKAVRWELPRSLIKFRLMARLHIFPDQEVPEDLLKNVSSQIRQLRPVPRTLASYSDKEVDEFPKINDFPKDYILK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
39S ribosomal protein L13, mitochondrial confidentQ9VJ38
39S ribosomal protein L13, mitochondrial confidentQ9BYD1
39S ribosomal protein L13, mitochondrial confidentQ3SYS1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005761 [CC]mitochondrial ribosomeprobableGO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0030529, GO:0005759, GO:0000313, GO:0043231, GO:0032991, GO:0005840, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FTC, chain H
Confidence level:very confident
Coverage over the Query: 1-89
View the alignment between query and template
View the model in PyMOL