Query         psy627
Match_columns 89
No_of_seqs    109 out of 354
Neff          4.9 
Searched_HMMs 46136
Date          Fri Aug 16 22:05:36 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy627.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/627hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04800 ETC_C1_NDUFA4:  ETC co 100.0   1E-49 2.2E-54  268.4   6.0   86    1-86     13-99  (101)
  2 KOG3389|consensus              100.0 1.2E-43 2.7E-48  254.5   7.0   89    1-89     88-178 (178)
  3 PF09954 DUF2188:  Uncharacteri  91.5    0.14   3E-06   30.7   1.8   41   27-67     10-55  (62)
  4 PRK05370 argininosuccinate syn  87.0    0.44 9.5E-06   39.6   2.1   22   40-61    164-185 (447)
  5 PHA02552 4 head completion pro  85.9    0.75 1.6E-05   33.1   2.6   21   45-65    120-140 (151)
  6 PF07045 DUF1330:  Protein of u  81.7     1.5 3.2E-05   26.4   2.3   21   32-52     36-56  (65)
  7 PF08727 P3A:  Poliovirus 3A pr  81.0     1.1 2.3E-05   27.7   1.5   16   46-61     30-45  (57)
  8 PF08722 Tn7_Tnp_TnsA_N:  TnsA   79.0     2.5 5.4E-05   26.5   2.8   19   45-63     69-87  (88)
  9 PF11360 DUF3110:  Protein of u  78.4     2.1 4.5E-05   27.9   2.4   30   36-65     23-77  (86)
 10 PF05573 NosL:  NosL;  InterPro  77.4     2.2 4.7E-05   29.7   2.4   47    9-56     77-135 (149)
 11 PF06194 Phage_Orf51:  Phage Co  77.2     2.1 4.5E-05   28.0   2.0   26   36-61     48-73  (80)
 12 PF02844 GARS_N:  Phosphoribosy  74.0     3.8 8.1E-05   27.5   2.7   30   37-66     43-72  (100)
 13 cd01207 Ena-Vasp Enabled-VASP-  72.2     3.5 7.6E-05   28.2   2.3   22   34-55     82-103 (111)
 14 PRK04527 argininosuccinate syn  71.4     2.8 6.1E-05   34.2   1.9   22   38-59    146-168 (400)
 15 COG5470 Uncharacterized conser  69.9     5.2 0.00011   27.0   2.7   26   23-51     44-69  (96)
 16 KOG2854|consensus               69.4     4.2 9.1E-05   32.9   2.5   23   38-60    215-237 (343)
 17 PF05406 WGR:  WGR domain;  Int  69.1     3.6 7.8E-05   25.6   1.7   45    8-54     19-64  (81)
 18 PF03462 PCRF:  PCRF domain;  I  68.4     4.1 8.8E-05   27.3   1.9   15   49-63     73-87  (115)
 19 PF03108 DBD_Tnp_Mut:  MuDR fam  66.4     7.2 0.00016   23.2   2.6   35   33-67      1-39  (67)
 20 PF00568 WH1:  WH1 domain;  Int  66.2     6.4 0.00014   25.9   2.5   19   36-54     88-106 (111)
 21 PF12518 DUF3721:  Protein of u  65.6     6.5 0.00014   21.9   2.1   16   42-57      1-16  (34)
 22 KOG4748|consensus               65.5     4.6 9.9E-05   32.9   2.0   22   44-65    127-148 (364)
 23 cd00837 EVH1 EVH1 (Enabled, Va  63.7     7.8 0.00017   25.4   2.6   20   35-54     80-99  (104)
 24 PRK05773 3,4-dihydroxy-2-butan  62.3     7.3 0.00016   29.5   2.5   18   43-60    191-208 (219)
 25 smart00461 WH1 WASP homology r  61.7     8.7 0.00019   25.4   2.5   20   35-54     82-101 (106)
 26 PF01693 Cauli_VI:  Caulimoviru  61.5     8.4 0.00018   21.6   2.1   14   38-51     31-44  (44)
 27 PF01071 GARS_A:  Phosphoribosy  60.5      10 0.00022   28.0   3.0   26   39-64     20-45  (194)
 28 PRK09437 bcp thioredoxin-depen  59.4      13 0.00029   24.7   3.1   27   38-64     68-94  (154)
 29 COG0108 RibB 3,4-dihydroxy-2-b  59.3     8.6 0.00019   29.1   2.4   21   43-63    172-192 (203)
 30 COG0137 ArgG Argininosuccinate  59.1     7.4 0.00016   32.2   2.1   22   40-62    150-171 (403)
 31 PF13031 DUF3892:  Protein of u  58.4      10 0.00022   23.9   2.3   20   43-62     31-50  (85)
 32 PF07862 Nif11:  Nitrogen fixat  57.7     5.4 0.00012   22.6   0.8   19   43-61     27-45  (49)
 33 PF08803 ydhR:  Putative mono-o  57.2     8.1 0.00018   26.0   1.8   28   28-55     38-66  (97)
 34 PLN00139 hypothetical protein;  56.5      11 0.00023   29.6   2.6   25   40-64    195-219 (320)
 35 PF10566 Glyco_hydro_97:  Glyco  56.0     9.6 0.00021   29.6   2.2   26   39-64     28-53  (273)
 36 smart00156 PP2Ac Protein phosp  55.9      21 0.00045   27.1   4.0   41   20-64    176-219 (271)
 37 PF10075 PCI_Csn8:  COP9 signal  55.5     7.8 0.00017   26.3   1.5   20   40-60    107-126 (143)
 38 KOG1706|consensus               54.5     7.8 0.00017   31.8   1.6   23   41-63    154-176 (412)
 39 PF03793 PASTA:  PASTA domain;   53.4      17 0.00036   21.0   2.5   22   43-64      9-30  (63)
 40 PF03682 UPF0158:  Uncharacteri  52.6      11 0.00025   26.9   2.0   20   45-64    127-146 (163)
 41 PF12745 HGTP_anticodon2:  Anti  52.4      17 0.00036   28.1   3.1   23   43-65     44-66  (273)
 42 PF09383 NIL:  NIL domain;  Int  51.2      18 0.00038   21.9   2.5   29   34-62     44-76  (76)
 43 COG1225 Bcp Peroxiredoxin [Pos  50.6      13 0.00029   26.7   2.1   30   38-67     68-97  (157)
 44 cd03017 PRX_BCP Peroxiredoxin   50.5      24 0.00052   22.7   3.2   28   38-65     61-88  (140)
 45 COG3341 Predicted double-stran  49.9     9.8 0.00021   29.2   1.4   14   41-54     39-52  (225)
 46 PF13911 AhpC-TSA_2:  AhpC/TSA   49.6      18  0.0004   23.1   2.5   29   38-66     17-45  (115)
 47 PLN00200 argininosuccinate syn  49.1      14 0.00029   30.3   2.2   18   42-59    153-170 (404)
 48 TIGR00506 ribB 3,4-dihydroxy-2  48.7      17 0.00037   27.1   2.5   19   42-60    172-190 (199)
 49 cd07996 WGR_MMR_like WGR domai  48.6      51  0.0011   19.7   4.3   50    6-55     12-62  (74)
 50 PRK01792 ribB 3,4-dihydroxy-2-  48.4      17 0.00037   27.5   2.5   19   42-60    182-200 (214)
 51 PF05198 IF3_N:  Translation in  48.4      18  0.0004   22.9   2.3   26   42-67     27-52  (76)
 52 PRK00923 sirohydrochlorin coba  47.0      31 0.00068   22.6   3.4   25   40-64     43-67  (126)
 53 COG0290 InfC Translation initi  46.7      28 0.00061   25.8   3.3   33   43-75     34-68  (176)
 54 PF14259 RRM_6:  RNA recognitio  46.5      21 0.00046   20.4   2.2   20   37-56     41-60  (70)
 55 cd00913 PCD_DCoH_subfamily_a P  45.5      32 0.00069   21.2   3.0   29   27-55      1-30  (76)
 56 PRK13010 purU formyltetrahydro  45.4      32  0.0007   26.6   3.7   30   36-65    121-150 (289)
 57 PF02786 CPSase_L_D2:  Carbamoy  45.4      22 0.00048   26.1   2.6   21   43-63     25-45  (211)
 58 cd01206 Homer Homer type EVH1   45.0      21 0.00045   24.7   2.3   23   32-54     78-102 (111)
 59 KOG0081|consensus               44.6      19 0.00042   27.1   2.2   22   42-63    141-162 (219)
 60 PF05637 Glyco_transf_34:  gala  44.6      15 0.00033   27.4   1.7   18   45-62     30-47  (239)
 61 PRK00910 ribB 3,4-dihydroxy-2-  44.5      21 0.00046   27.0   2.5   20   42-61    183-202 (218)
 62 PF07014 Hs1pro-1_C:  Hs1pro-1   44.3     9.1  0.0002   29.8   0.5   23   29-51    228-253 (261)
 63 PF00926 DHBP_synthase:  3,4-di  44.2      22 0.00048   26.3   2.5   20   42-61    167-186 (194)
 64 KOG0855|consensus               44.0      19 0.00042   27.2   2.1   30   38-67    128-157 (211)
 65 PRK00823 phhB pterin-4-alpha-c  43.8      28 0.00062   22.5   2.7   34   23-56     16-50  (97)
 66 PF00764 Arginosuc_synth:  Argi  43.4      13 0.00029   30.3   1.3   17   45-61    147-163 (388)
 67 PRK13820 argininosuccinate syn  42.6      17 0.00037   29.6   1.8   18   44-61    148-165 (394)
 68 smart00757 CRA CT11-RanBPM. pr  42.3      20 0.00043   22.1   1.8   17   44-60      2-18  (99)
 69 cd01999 Argininosuccinate_Synt  42.2      20 0.00044   29.0   2.2   20   42-61    146-165 (385)
 70 smart00481 POLIIIAc DNA polyme  42.2      40 0.00087   19.6   3.0   24   43-66     15-38  (67)
 71 PF00076 RRM_1:  RNA recognitio  42.1      33 0.00071   19.0   2.5   20   38-57     42-62  (70)
 72 cd03012 TlpA_like_DipZ_like Tl  42.1      27 0.00059   22.5   2.5   43   43-85     71-117 (126)
 73 KOG2741|consensus               41.9      19 0.00042   29.2   2.0   21   38-58     36-56  (351)
 74 PRK00014 ribB 3,4-dihydroxy-2-  41.8      25 0.00054   27.0   2.5   19   42-60    187-205 (230)
 75 PRK06027 purU formyltetrahydro  41.5      36 0.00079   26.2   3.4   31   35-65    116-146 (286)
 76 COG4314 NosL Predicted lipopro  41.5      21 0.00045   26.4   2.0   23   38-60    129-151 (176)
 77 PRK11118 putative monooxygenas  41.3      36 0.00078   23.1   3.0   28   28-55     41-69  (100)
 78 cd06576 PASTA_Pbp2x-like_1 PAS  39.6      51  0.0011   17.6   3.0   22   43-64      8-29  (55)
 79 PF03960 ArsC:  ArsC family;  I  39.6      26 0.00057   22.6   2.1   21   44-64      8-28  (110)
 80 PTZ00056 glutathione peroxidas  39.5      31 0.00067   24.8   2.6   21   43-63     89-109 (199)
 81 cd00860 ThrRS_anticodon ThrRS   39.3      45 0.00097   19.8   3.0   24   41-64     36-59  (91)
 82 PF03795 YCII:  YCII-related do  39.2      21 0.00045   22.0   1.5   17   38-54     61-77  (95)
 83 cd07202 cPLA2_Grp-IVC Group IV  39.0      15 0.00033   30.5   1.0   22   42-63    321-342 (430)
 84 PF14657 Integrase_AP2:  AP2-li  38.7      28 0.00062   19.4   1.9   19   36-54     17-36  (46)
 85 PF00331 Glyco_hydro_10:  Glyco  38.6      20 0.00043   27.7   1.6   22   39-60     55-76  (320)
 86 PRK08179 prfH peptide chain re  38.6      25 0.00054   26.2   2.1   17   49-65     27-43  (200)
 87 KOG0097|consensus               38.5      25 0.00053   26.1   2.0   17   44-60    135-151 (215)
 88 cd03027 GRX_DEP Glutaredoxin (  38.5      40 0.00086   19.8   2.6   24   42-65     11-34  (73)
 89 COG5453 Uncharacterized conser  38.4      21 0.00046   24.1   1.5   18   41-58     68-85  (96)
 90 cd02977 ArsC_family Arsenate R  38.4      29 0.00064   22.0   2.1   22   43-64     10-31  (105)
 91 cd07238 Glo_EDI_BRP_like_5 Thi  37.7      76  0.0017   19.3   3.9   26   36-61     59-84  (112)
 92 cd02970 PRX_like2 Peroxiredoxi  37.5      55  0.0012   21.0   3.4   28   38-65     61-88  (149)
 93 cd07415 MPP_PP2A_PP4_PP6 PP2A,  37.4      67  0.0014   24.7   4.3   26   37-63    207-232 (285)
 94 PF14542 Acetyltransf_CG:  GCN5  37.0      33 0.00072   21.3   2.2   18   45-62     44-61  (78)
 95 PF10009 DUF2252:  Uncharacteri  36.9      25 0.00054   28.3   1.9   38   20-57    288-335 (385)
 96 PF07611 DUF1574:  Protein of u  36.7      20 0.00044   28.8   1.4   27   40-66    249-275 (345)
 97 PF02811 PHP:  PHP domain;  Int  36.3      40 0.00086   22.2   2.6   23   43-65     16-38  (175)
 98 TIGR03798 ocin_TIGR03798 bacte  36.2      17 0.00037   21.8   0.7   22   42-63     24-45  (64)
 99 PF11823 DUF3343:  Protein of u  36.1      48   0.001   20.1   2.8   24   39-62     46-69  (73)
100 cd04438 DEP_dishevelled DEP (D  35.9      45 0.00098   21.4   2.7   24   42-65     46-72  (84)
101 KOG0098|consensus               35.9      30 0.00065   26.4   2.1   18   43-60    129-146 (216)
102 PF01910 DUF77:  Domain of unkn  35.9      34 0.00074   22.2   2.1   18   46-63     20-37  (92)
103 PRK12354 carbamate kinase; Rev  35.8      32 0.00069   27.2   2.3   22   41-62    125-146 (307)
104 cd04908 ACT_Bt0572_1 N-termina  35.4      58  0.0013   18.8   2.9   24   36-59     41-64  (66)
105 PF03129 HGTP_anticodon:  Antic  35.3      55  0.0012   19.9   3.0   22   42-63     38-59  (94)
106 cd03412 CbiK_N Anaerobic cobal  35.2      49  0.0011   22.2   2.9   26   40-65     53-78  (127)
107 cd00859 HisRS_anticodon HisRS   35.2      56  0.0012   18.8   2.9   20   44-63     39-58  (91)
108 PRK06806 fructose-bisphosphate  34.9      47   0.001   25.6   3.1   26   37-62    147-172 (281)
109 cd07417 MPP_PP5_C PP5, C-termi  34.6      83  0.0018   24.7   4.5   26   38-64    227-252 (316)
110 PRK00509 argininosuccinate syn  34.5      32 0.00069   28.1   2.2   19   41-59    148-166 (399)
111 cd03018 PRX_AhpE_like Peroxire  34.5      61  0.0013   21.0   3.3   27   38-64     66-92  (149)
112 PRK03745 signal recognition pa  34.2   1E+02  0.0022   20.7   4.2   24   39-62     28-52  (100)
113 cd01992 PP-ATPase N-terminal d  34.0      44 0.00095   22.8   2.6   22   42-63    146-167 (185)
114 PF13669 Glyoxalase_4:  Glyoxal  33.9      36 0.00078   21.3   2.0   32   32-63     66-97  (109)
115 cd07419 MPP_Bsu1_C Arabidopsis  33.8      84  0.0018   24.4   4.4   23   42-64    239-261 (311)
116 PF12123 Amidase02_C:  N-acetyl  33.7      56  0.0012   19.0   2.6   18   44-61     28-45  (45)
117 cd07249 MMCE Methylmalonyl-CoA  33.6      66  0.0014   19.6   3.2   24   36-59     74-97  (128)
118 TIGR02432 lysidine_TilS_N tRNA  33.6      48   0.001   22.8   2.7   20   45-64     47-66  (189)
119 PF01329 Pterin_4a:  Pterin 4 a  33.5      38 0.00082   21.8   2.1   32   23-54     15-46  (95)
120 TIGR03072 release_prfH putativ  33.2      34 0.00074   25.5   2.0   17   49-65     26-42  (200)
121 PF04895 DUF651:  Archaeal prot  33.2      30 0.00065   23.6   1.6   22   34-55     62-83  (110)
122 KOG0369|consensus               32.9      40 0.00088   30.6   2.7   23   42-64    170-192 (1176)
123 PF05159 Capsule_synth:  Capsul  32.7      45 0.00097   24.5   2.6   23   43-65     11-33  (269)
124 TIGR00655 PurU formyltetrahydr  32.6      54  0.0012   25.3   3.1   29   36-64    112-140 (280)
125 COG3584 Uncharacterized protei  32.4      25 0.00055   24.2   1.1   29   26-54     70-103 (109)
126 cd01205 WASP WASP-type EVH1 do  32.4      48   0.001   22.4   2.5   19   36-54     82-100 (105)
127 PF10686 DUF2493:  Protein of u  32.4      53  0.0011   20.3   2.5   19   47-65     48-66  (71)
128 PF05389 MecA:  Negative regula  32.2      31 0.00067   25.2   1.6   21   37-57    131-151 (220)
129 COG0216 PrfA Protein chain rel  32.1      38 0.00082   27.8   2.2   19   49-67    139-157 (363)
130 COG5079 SAC3 Nuclear protein e  32.0      27 0.00058   30.4   1.4   25   39-63    356-380 (646)
131 cd08344 MhqB_like_N N-terminal  32.0      77  0.0017   19.5   3.3   28   33-60     54-83  (112)
132 cd00858 GlyRS_anticodon GlyRS   31.9      60  0.0013   21.2   2.9   23   40-63     62-84  (121)
133 PLN03097 FHY3 Protein FAR-RED   31.8      59  0.0013   29.2   3.5   28   36-63     74-105 (846)
134 cd08349 BLMA_like Bleomycin bi  31.7   1E+02  0.0022   18.3   3.7   29   37-65     61-89  (112)
135 cd06575 PASTA_Pbp2x-like_2 PAS  31.6      75  0.0016   16.7   2.8   21   43-63      8-28  (54)
136 KOG1769|consensus               31.5      26 0.00056   23.7   1.1   13   49-61     48-60  (99)
137 PRK10291 glyoxalase I; Provisi  31.4      68  0.0015   20.3   3.0   27   35-61     66-92  (129)
138 TIGR00385 dsbE periplasmic pro  31.2      43 0.00093   23.1   2.2   47   39-85     97-149 (173)
139 TIGR00269 conserved hypothetic  31.1      47   0.001   21.7   2.2   24   40-63      7-30  (104)
140 COG4862 MecA Negative regulato  31.0      42 0.00092   25.8   2.2   22   37-58    131-152 (224)
141 cd00914 PCD_DCoH_subfamily_b P  31.0      60  0.0013   20.0   2.6   29   27-55      1-30  (76)
142 PF00462 Glutaredoxin:  Glutare  31.0      63  0.0014   18.1   2.6   19   45-63     12-30  (60)
143 TIGR02540 gpx7 putative glutat  30.9      39 0.00084   22.6   1.9   21   43-63     72-93  (153)
144 PF00588 SpoU_methylase:  SpoU   30.7 1.1E+02  0.0025   20.1   4.1   25   40-64     59-83  (142)
145 PRK03353 ribB 3,4-dihydroxy-2-  30.5      48   0.001   24.9   2.5   18   43-60    183-200 (217)
146 COG1453 Predicted oxidoreducta  30.5      43 0.00094   27.7   2.4   20   47-66    187-206 (391)
147 PF08057 Ery_res_leader2:  Eryt  30.4      23 0.00051   16.0   0.5   10   36-45      3-12  (14)
148 cd03421 SirA_like_N SirA_like_  30.4      58  0.0013   19.1   2.4   20   45-64     38-57  (67)
149 PF09840 DUF2067:  Uncharacteri  30.4      47   0.001   24.4   2.4   17   38-54      1-17  (190)
150 cd07233 Glyoxalase_I Glyoxalas  30.4      92   0.002   18.9   3.4   28   34-61     70-97  (121)
151 cd03032 ArsC_Spx Arsenate Redu  30.3      51  0.0011   21.5   2.3   22   43-64     11-32  (115)
152 COG0656 ARA1 Aldo/keto reducta  30.2      59  0.0013   25.4   3.0   31   36-67    162-194 (280)
153 KOG4213|consensus               30.1      34 0.00074   25.9   1.6   24   37-60    152-175 (205)
154 PTZ00244 serine/threonine-prot  30.1 1.2E+02  0.0026   23.5   4.7   41   20-64    200-243 (294)
155 PF11387 DUF2795:  Protein of u  30.0      58  0.0013   18.4   2.2   21   43-63      8-28  (44)
156 PHA02087 hypothetical protein   30.0      52  0.0011   21.4   2.2   21   37-57      3-23  (83)
157 PRK11478 putative lyase; Provi  29.9      76  0.0017   19.7   3.0   25   36-60     77-101 (129)
158 TIGR00552 nadE NAD+ synthetase  29.4      44 0.00095   24.7   2.1   21   43-63     64-84  (250)
159 smart00034 CLECT C-type lectin  29.4      44 0.00095   20.3   1.8   19   43-61     20-38  (126)
160 TIGR03748 conj_PilL conjugativ  29.3      40 0.00087   23.0   1.7   23   32-54     18-46  (105)
161 cd03593 CLECT_NK_receptors_lik  29.1      41  0.0009   20.9   1.7   21   43-63     20-40  (116)
162 cd03414 CbiX_SirB_C Sirohydroc  29.0      77  0.0017   20.2   3.0   26   40-65     42-67  (117)
163 COG1979 Uncharacterized oxidor  29.0      34 0.00075   28.1   1.5   22   41-62     70-91  (384)
164 cd00861 ProRS_anticodon_short   28.9      48   0.001   20.0   1.9   22   42-63     40-61  (94)
165 PRK00522 tpx lipid hydroperoxi  28.8      59  0.0013   22.4   2.5   27   38-64     80-107 (167)
166 cd00738 HGTP_anticodon HGTP an  28.5      81  0.0017   18.7   2.9   22   43-64     41-62  (94)
167 KOG0638|consensus               28.3      44 0.00095   27.4   2.0   38   23-60     78-117 (381)
168 cd00488 PCD_DCoH PCD_DCoH: The  28.2      94   0.002   18.9   3.1   29   27-55      1-29  (75)
169 PF13263 PHP_C:  PHP-associated  28.1      64  0.0014   18.7   2.2   18   46-63      5-22  (56)
170 COG4668 MtlA Mannitol/fructose  28.1      37  0.0008   24.3   1.4   17   38-54     10-26  (142)
171 cd04882 ACT_Bt0572_2 C-termina  28.1      97  0.0021   17.1   3.0   24   36-59     41-64  (65)
172 TIGR01465 cobM_cbiF precorrin-  28.1      89  0.0019   22.2   3.4   30   30-64     78-107 (229)
173 PTZ00480 serine/threonine-prot  28.0 1.2E+02  0.0025   24.1   4.3   40   20-63    207-249 (320)
174 cd04448 DEP_PIKfyve DEP (Dishe  28.0      51  0.0011   20.9   1.9   24   42-65     44-70  (81)
175 PF11216 DUF3012:  Protein of u  27.9      44 0.00096   18.3   1.4   10   44-53     19-28  (32)
176 PF00059 Lectin_C:  Lectin C-ty  27.8      43 0.00093   19.7   1.5   20   44-63      4-23  (105)
177 cd04442 DEP_1_DEP6 DEP (Dishev  27.8      51  0.0011   21.2   1.9   21   43-63     45-68  (82)
178 PRK10696 tRNA 2-thiocytidine b  27.6      66  0.0014   23.9   2.7   21   44-64     75-95  (258)
179 COG0151 PurD Phosphoribosylami  27.5      72  0.0016   26.7   3.2   34   32-66     40-73  (428)
180 COG5171 YRB1 Ran GTPase-activa  27.5      43 0.00093   25.3   1.7   27   28-54    164-196 (211)
181 cd07416 MPP_PP2B PP2B, metallo  27.5 1.1E+02  0.0023   23.8   4.0   26   38-64    216-241 (305)
182 PRK12465 xylose isomerase; Pro  27.4      74  0.0016   26.8   3.2   30   45-74    221-251 (445)
183 PRK11235 bifunctional antitoxi  27.3      37  0.0008   21.9   1.2   22   37-58      5-26  (80)
184 PRK11370 YciI-like protein; Re  27.2      66  0.0014   20.6   2.4   18   37-54     60-77  (99)
185 cd03036 ArsC_like Arsenate Red  27.0      57  0.0012   21.2   2.1   21   43-63     10-30  (111)
186 COG2154 Pterin-4a-carbinolamin  26.9      80  0.0017   21.3   2.8   34   22-55     15-49  (101)
187 PF10827 DUF2552:  Protein of u  26.9      52  0.0011   21.4   1.8   16   40-55     56-71  (79)
188 cd04449 DEP_DEPDC5-like DEP (D  26.7      55  0.0012   20.6   1.9   22   42-63     46-70  (83)
189 COG4545 Glutaredoxin-related p  26.7      71  0.0015   21.1   2.4   21   43-63     13-33  (85)
190 cd03409 Chelatase_Class_II Cla  26.4      95  0.0021   19.0   3.0   24   42-65     44-67  (101)
191 KOG1380|consensus               26.4      27 0.00058   28.9   0.5   12   22-33    234-245 (409)
192 smart00633 Glyco_10 Glycosyl h  26.4      43 0.00093   24.7   1.6   21   39-59     12-32  (254)
193 PLN03181 glycosyltransferase;   26.3      48   0.001   27.9   2.0   20   45-64    154-173 (453)
194 PRK09732 hypothetical protein;  26.2      67  0.0015   22.3   2.4   18   45-62     16-33  (134)
195 KOG3048|consensus               26.2      46 0.00099   24.2   1.6   13   43-55     97-109 (153)
196 PF09691 PulS_OutS:  Bacterial   26.1      46 0.00099   22.7   1.5   13   47-59     54-66  (109)
197 COG0269 SgbH 3-hexulose-6-phos  26.0      73  0.0016   24.3   2.8   31   34-64      4-34  (217)
198 cd04440 DEP_2_P-Rex DEP (Dishe  26.0      56  0.0012   21.6   1.9   23   42-64     53-78  (93)
199 PF05172 Nup35_RRM:  Nup53/35/4  25.9      56  0.0012   21.7   1.9   22   38-59     57-78  (100)
200 KOG2564|consensus               25.8      41 0.00088   27.3   1.4   22   38-59    199-220 (343)
201 KOG0092|consensus               25.8      56  0.0012   24.7   2.1   52    9-64     97-149 (200)
202 cd04441 DEP_2_DEP6 DEP (Dishev  25.8      58  0.0013   21.1   1.9   22   42-63     48-72  (85)
203 PRK10638 glutaredoxin 3; Provi  25.7      67  0.0015   19.4   2.1   22   44-65     14-35  (83)
204 cd03416 CbiX_SirB_N Sirohydroc  25.5 1.1E+02  0.0024   19.0   3.2   26   39-64     40-65  (101)
205 COG1393 ArsC Arsenate reductas  25.5      60  0.0013   21.9   2.0   21   43-63     12-32  (117)
206 PF07476 MAAL_C:  Methylasparta  25.4      60  0.0013   25.3   2.2   17   45-61    178-194 (248)
207 PRK09314 bifunctional 3,4-dihy  25.3      65  0.0014   25.9   2.5   18   43-60    172-189 (339)
208 PF01171 ATP_bind_3:  PP-loop f  25.3      46   0.001   23.1   1.5   24   40-63    144-167 (182)
209 cd03592 CLECT_selectins_like C  25.3      59  0.0013   20.4   1.9   19   43-61     10-28  (115)
210 PF15649 Tox-REase-7:  Restrict  25.3      94   0.002   20.3   2.9   22   45-66     59-80  (87)
211 PF14555 UBA_4:  UBA-like domai  25.2      73  0.0016   17.5   2.1   16   44-59     14-29  (43)
212 PLN02923 xylose isomerase       25.2      75  0.0016   27.0   2.9   30   45-74    255-285 (478)
213 PF02177 APP_N:  Amyloid A4 N-t  25.1      61  0.0013   22.0   2.0   25   38-62     30-54  (102)
214 KOG2944|consensus               25.1 1.9E+02   0.004   21.4   4.6   42   30-72    109-152 (170)
215 PF03754 DUF313:  Domain of unk  25.1      43 0.00092   22.9   1.2   34   34-67     43-84  (114)
216 TIGR00168 infC translation ini  24.9   1E+02  0.0023   22.1   3.3   33   43-75     23-57  (165)
217 TIGR00746 arcC carbamate kinas  24.9      81  0.0017   24.8   2.9   21   41-61    131-151 (310)
218 PRK02315 adaptor protein; Prov  24.9      80  0.0017   23.6   2.8   23   35-57    138-160 (233)
219 PRK06746 peptide chain release  24.7      57  0.0012   26.2   2.1   16   49-64    113-128 (326)
220 COG0007 CysG Uroporphyrinogen-  24.5      99  0.0022   23.8   3.3   25   41-65     94-118 (244)
221 PF14370 Topo_C_assoc:  C-termi  24.4      50  0.0011   21.1   1.4   18   43-60     31-48  (71)
222 PRK11172 dkgB 2,5-diketo-D-glu  24.4      88  0.0019   23.1   2.9   23   44-66    160-182 (267)
223 KOG0091|consensus               24.3      70  0.0015   24.2   2.4   19   44-62    135-153 (213)
224 cd03413 CbiK_C Anaerobic cobal  24.3 1.1E+02  0.0023   20.0   3.0   25   41-65     40-64  (103)
225 PF04221 RelB:  RelB antitoxin;  24.2      41 0.00088   21.1   1.0   20   38-57      6-25  (83)
226 PRK12454 carbamate kinase-like  24.2      73  0.0016   25.3   2.6   20   41-60    134-153 (313)
227 cd00037 CLECT C-type lectin (C  24.2      68  0.0015   18.7   1.9   15   42-56      9-23  (116)
228 PRK12865 YciI-like protein; Re  24.1      79  0.0017   20.2   2.3   17   38-54     55-71  (97)
229 PF01922 SRP19:  SRP19 protein;  24.1 1.7E+02  0.0036   19.1   3.9   25   39-63     25-49  (95)
230 PF02407 Viral_Rep:  Putative v  24.0     8.8 0.00019   24.8  -2.2   12   43-54     74-85  (86)
231 PF02244 Propep_M14:  Carboxype  24.0   1E+02  0.0022   18.1   2.7   29   36-64     36-64  (74)
232 PF14277 DUF4364:  Domain of un  23.9      76  0.0016   22.7   2.4   23   32-54    124-146 (163)
233 cd08914 START_STARD15-like Lip  23.9      78  0.0017   24.2   2.6   33   33-65     34-66  (236)
234 TIGR01617 arsC_related transcr  23.9      71  0.0015   20.8   2.1   22   43-64     10-31  (117)
235 PRK13789 phosphoribosylamine--  23.8      89  0.0019   25.2   3.0   25   40-64    127-151 (426)
236 COG0151 PurD Phosphoribosylami  23.8      83  0.0018   26.3   2.9   24   40-63    122-145 (428)
237 PRK09318 bifunctional 3,4-dihy  23.8      71  0.0015   26.1   2.5   18   43-60    159-176 (387)
238 PRK00028 infC translation init  23.8 1.1E+02  0.0023   22.3   3.2   34   43-76     35-70  (177)
239 PRK02628 nadE NAD synthetase;   23.7      62  0.0013   27.8   2.2   20   44-63    409-428 (679)
240 PF11247 DUF2675:  Protein of u  23.7      41 0.00089   22.8   0.9   21   43-63     56-76  (98)
241 PF13539 Peptidase_M15_4:  D-al  23.6   1E+02  0.0022   18.5   2.6   38   13-58     15-52  (67)
242 PRK06186 hypothetical protein;  23.6      58  0.0013   24.7   1.8   18   43-60     69-86  (229)
243 KOG0781|consensus               23.5      81  0.0018   27.3   2.8   23   46-68    456-478 (587)
244 cd03418 GRX_GRXb_1_3_like Glut  23.4      94   0.002   17.8   2.4   22   43-64     11-32  (75)
245 PLN03199 delta6-acyl-lipid des  23.3      38 0.00083   27.9   0.9   40   24-63    407-455 (485)
246 PRK13307 bifunctional formalde  23.3      77  0.0017   25.8   2.6   37   20-56    156-195 (391)
247 PRK14019 bifunctional 3,4-dihy  23.1      67  0.0014   25.9   2.2   17   43-59    173-189 (367)
248 KOG2486|consensus               23.1      68  0.0015   25.9   2.2   23   43-65    235-257 (320)
249 cd03033 ArsC_15kD Arsenate Red  23.0      76  0.0016   21.1   2.1   20   44-63     12-31  (113)
250 cd05565 PTS_IIB_lactose PTS_II  22.9      72  0.0016   21.0   2.0   17   47-63     19-35  (99)
251 PF09633 DUF2023:  Protein of u  22.8      99  0.0021   21.0   2.7   22   44-65     26-47  (101)
252 PRK00578 prfB peptide chain re  22.8      65  0.0014   26.1   2.1   16   49-64    151-166 (367)
253 PF00071 Ras:  Ras family;  Int  22.8      95  0.0021   20.0   2.6   20   44-63    123-142 (162)
254 PF06356 DUF1064:  Protein of u  22.7      72  0.0016   21.9   2.0   43   39-81     13-71  (118)
255 cd08578 GDPD_NUC-2_fungi Putat  22.7      61  0.0013   25.3   1.9   24   40-63    226-249 (300)
256 TIGR02630 xylose_isom_A xylose  22.7   1E+02  0.0022   25.9   3.2   30   45-74    210-240 (434)
257 PTZ00175 diphthine synthase; P  22.7 1.4E+02   0.003   22.9   3.7   29   30-63     83-111 (270)
258 PTZ00323 NAD+ synthase; Provis  22.5      74  0.0016   24.8   2.3   21   44-64     93-113 (294)
259 PF12671 Amidase_6:  Putative a  22.5      62  0.0013   22.4   1.7   16   44-59      3-18  (157)
260 PRK15412 thiol:disulfide inter  22.4      98  0.0021   21.6   2.7   49   38-86    101-155 (185)
261 PF12760 Zn_Tnp_IS1595:  Transp  22.4      90   0.002   17.4   2.1   23   43-65      1-23  (46)
262 PRK09958 DNA-binding transcrip  22.4      70  0.0015   21.2   1.9   20   39-58    185-204 (204)
263 PF04343 DUF488:  Protein of un  22.3 1.1E+02  0.0024   20.1   2.8   23   41-63     29-51  (122)
264 PF02540 NAD_synthase:  NAD syn  22.3      67  0.0015   24.0   1.9   20   44-63     61-80  (242)
265 PRK12420 histidyl-tRNA synthet  22.3      99  0.0021   24.6   3.0   22   43-64    374-395 (423)
266 PRK12677 xylose isomerase; Pro  22.3 1.2E+02  0.0027   24.2   3.6   32   27-59     16-47  (384)
267 PRK00754 signal recognition pa  22.2 1.3E+02  0.0029   19.8   3.2   25   39-63     31-55  (95)
268 cd03588 CLECT_CSPGs C-type lec  22.2      73  0.0016   20.4   1.9   36   27-62      4-39  (124)
269 CHL00199 infC translation init  22.1 1.2E+02  0.0027   22.4   3.3   38   42-80     39-78  (182)
270 cd07414 MPP_PP1_PPKL PP1, PPKL  22.1 2.1E+02  0.0046   22.1   4.7   40   20-63    198-240 (293)
271 cd05564 PTS_IIB_chitobiose_lic  22.1 1.1E+02  0.0023   19.6   2.6   20   45-64     16-35  (96)
272 PRK03147 thiol-disulfide oxido  22.0 1.1E+02  0.0025   20.2   2.9   48   39-86     99-151 (173)
273 cd03034 ArsC_ArsC Arsenate Red  21.9      85  0.0018   20.5   2.2   21   43-63     10-30  (112)
274 PF09363 XFP_C:  XFP C-terminal  21.9      93   0.002   23.5   2.6   18   37-54      2-19  (203)
275 TIGR03662 Chlor_Arch_YYY Chlor  21.8      97  0.0021   27.3   3.0   33   38-70    661-695 (723)
276 TIGR00032 argG argininosuccina  21.7      93   0.002   25.3   2.8   20   44-63    147-166 (394)
277 TIGR00268 conserved hypothetic  21.7   1E+02  0.0022   22.9   2.8   20   45-64     54-73  (252)
278 smart00740 PASTA PASTA domain.  21.6 1.4E+02  0.0031   16.1   2.9   20   43-62     13-32  (66)
279 TIGR03645 glyox_marine lactoyl  21.6 1.2E+02  0.0027   20.5   3.0   24   38-61     97-120 (162)
280 TIGR02190 GlrX-dom Glutaredoxi  21.5      99  0.0021   18.5   2.3   21   43-63     19-39  (79)
281 PRK05474 xylose isomerase; Pro  21.5 1.1E+02  0.0025   25.6   3.3   29   46-74    212-241 (437)
282 TIGR01004 PulS_OutS lipoprotei  21.5      64  0.0014   22.8   1.6   13   47-59     70-82  (128)
283 PRK13813 orotidine 5'-phosphat  21.5 1.1E+02  0.0024   21.7   2.8   34   32-65      2-35  (215)
284 TIGR00442 hisS histidyl-tRNA s  21.4 1.1E+02  0.0024   23.8   3.1   21   43-63    359-379 (397)
285 PRK13011 formyltetrahydrofolat  21.3 1.2E+02  0.0027   23.3   3.3   29   36-64    117-145 (286)
286 PRK05589 peptide chain release  21.2      74  0.0016   25.5   2.1   16   49-64    112-127 (325)
287 PRK04247 hypothetical protein;  21.2 1.1E+02  0.0023   23.6   2.9   22   45-66    216-237 (238)
288 COG0504 PyrG CTP synthase (UTP  21.0      65  0.0014   27.7   1.8   17   44-60    360-376 (533)
289 cd02971 PRX_family Peroxiredox  20.9 1.4E+02  0.0031   18.9   3.1   27   38-64     60-87  (140)
290 KOG1502|consensus               20.9      98  0.0021   24.8   2.7   21   45-65    172-192 (327)
291 cd07420 MPP_RdgC Drosophila me  20.9 1.9E+02  0.0042   22.8   4.3   25   38-63    247-271 (321)
292 PRK11070 ssDNA exonuclease Rec  20.9   1E+02  0.0023   26.2   3.0   21   45-65    140-160 (575)
293 PF13380 CoA_binding_2:  CoA bi  20.8      90   0.002   20.5   2.2   17   43-59     89-105 (116)
294 TIGR00068 glyox_I lactoylgluta  20.8 1.2E+02  0.0026   19.9   2.7   26   35-60     87-112 (150)
295 PRK08057 cobalt-precorrin-6x r  20.7 1.4E+02  0.0031   22.6   3.4   27   40-66     49-75  (248)
296 cd04443 DEP_GPR155 DEP (Dishev  20.7      84  0.0018   20.1   1.9   22   42-63     46-70  (83)
297 PRK12485 bifunctional 3,4-dihy  20.6      88  0.0019   25.4   2.4   17   43-59    173-189 (369)
298 TIGR00011 YbaK_EbsC ybaK/ebsC   20.6      83  0.0018   21.3   2.0   17   47-63      2-18  (152)
299 PF14174 YycC:  YycC-like prote  20.4      95  0.0021   18.8   1.9   17   44-60      7-23  (53)
300 cd03078 GST_N_Metaxin1_like GS  20.3 1.6E+02  0.0035   17.7   3.1   21   43-63     17-37  (73)
301 TIGR00020 prfB peptide chain r  20.3      79  0.0017   25.7   2.1   16   49-64    151-166 (364)
302 cd00340 GSH_Peroxidase Glutath  20.3 1.1E+02  0.0024   20.4   2.5   21   43-63     71-92  (152)
303 PF14057 GGGtGRT:  GGGtGRT prot  20.2      84  0.0018   25.1   2.1   21   39-59     18-38  (328)
304 PRK08787 peptide chain release  20.2      80  0.0017   25.2   2.1   16   49-64     92-107 (313)
305 PRK07342 peptide chain release  20.1      80  0.0017   25.5   2.1   16   49-64    115-130 (339)
306 PRK00591 prfA peptide chain re  20.0      81  0.0017   25.6   2.1   17   49-65    138-154 (359)

No 1  
>PF04800 ETC_C1_NDUFA4:  ETC complex I subunit conserved region;  InterPro: IPR006885 This entry represents prokaryotic NADH-ubiquinone oxidoreductase subunits (1.6.5.3 from EC, 1.6.99.3 from EC) from complex I of the electron transport chain initially identified in Neurospora crassa as a 21 kDa protein [].; GO: 0016651 oxidoreductase activity, acting on NADH or NADPH, 0022900 electron transport chain, 0005743 mitochondrial inner membrane; PDB: 2JYA_A 2LJU_A.
Probab=100.00  E-value=1e-49  Score=268.43  Aligned_cols=86  Identities=63%  Similarity=1.152  Sum_probs=54.1

Q ss_pred             CCcccCCCCceEEEecCCCCccCCCCCCCCCCCCCCc-eeeecCCHHHHHHHHHHcCccEEEeccCCCCCCcccccccCC
Q psy627            1 MQSGTHNANNWFIQFDTRERWENPLMGWCSTGDPLSN-LALNFSSKEDAIQYCQKNGWKFFVEEPKWKTPKVKSYAFNFS   79 (89)
Q Consensus         1 mQSG~~~t~~W~lefe~~~~~~dPLMGWtss~D~~~q-v~l~F~s~e~Aiayae~~G~~Y~V~~p~~~~~~~ksYadNF~   79 (89)
                      ||||++++++|+||||..++|+|||||||||+||++| |+|.|+|+|+||+|||+|||+|+|++|+.+++++|||||||+
T Consensus        13 mQSG~~~t~~W~lefe~~~~~~~PLMGWtss~D~~~q~v~l~F~skE~Ai~yaer~G~~Y~V~~p~~r~~~~ksY~dNF~   92 (101)
T PF04800_consen   13 MQSGTANTKKWVLEFETRARWENPLMGWTSSGDPLSQSVRLKFDSKEDAIAYAERNGWDYEVEEPKKRKRRPKSYADNFS   92 (101)
T ss_dssp             STTTT-SS--EEEEEEESSS---TTT-SSSS--SEEE-CEEEESSHHHHHHHHHHCT-EEEEE-STT-------------
T ss_pred             CCCCCCCCCCEEEeecCcCCcCCCccCCCCCCChhhCeeEeeeCCHHHHHHHHHHcCCeEEEeCCCCCcCCcccHHHhCC
Confidence            8999999999999999889999999999999999998 999999999999999999999999999999999999999999


Q ss_pred             cCCCcce
Q psy627           80 WNKRTRT   86 (89)
Q Consensus        80 ~~r~~~~   86 (89)
                      |+|+++.
T Consensus        93 ~~r~~~~   99 (101)
T PF04800_consen   93 WNRRTRW   99 (101)
T ss_dssp             -------
T ss_pred             cCCCCCC
Confidence            9999874


No 2  
>KOG3389|consensus
Probab=100.00  E-value=1.2e-43  Score=254.48  Aligned_cols=89  Identities=62%  Similarity=1.052  Sum_probs=87.4

Q ss_pred             CCcccCCCCceEEEecCCCCccCCCCCCCCCCCCCCc--eeeecCCHHHHHHHHHHcCccEEEeccCCCCCCcccccccC
Q psy627            1 MQSGTHNANNWFIQFDTRERWENPLMGWCSTGDPLSN--LALNFSSKEDAIQYCQKNGWKFFVEEPKWKTPKVKSYAFNF   78 (89)
Q Consensus         1 mQSG~~~t~~W~lefe~~~~~~dPLMGWtss~D~~~q--v~l~F~s~e~Aiayae~~G~~Y~V~~p~~~~~~~ksYadNF   78 (89)
                      ||||.++++.|.|||+.+.+|+||||||+|++||+++  +.|.|+|+||||+|||+|||+|.|++|+.+++++|||||||
T Consensus        88 tQSg~gntkkWkiefd~r~rWENPLMGWtsTaDPlsNvgm~L~F~tkEdA~sFaEkngW~ydveep~~pk~K~KsYg~NF  167 (178)
T KOG3389|consen   88 TQSGSGNTKKWKIEFDSRLRWENPLMGWTSTADPLSNVGMALAFDTKEDAKSFAEKNGWDYDVEEPNTPKLKVKSYGDNF  167 (178)
T ss_pred             hhcccCCccceEEEecchhhccCccccccccCCcccccceeeeeccHHHHHHHHHHcCCcccccCCCCCccccccccccc
Confidence            7999999999999999999999999999999999999  58999999999999999999999999999999999999999


Q ss_pred             CcCCCcceecC
Q psy627           79 SWNKRTRTSTK   89 (89)
Q Consensus        79 ~~~r~~~~~~k   89 (89)
                      +|++++|..||
T Consensus       168 sWn~rtr~~tk  178 (178)
T KOG3389|consen  168 SWNGRTRPETK  178 (178)
T ss_pred             cccCCCCCCCC
Confidence            99999999987


No 3  
>PF09954 DUF2188:  Uncharacterized protein conserved in bacteria (DUF2188);  InterPro: IPR018691  This family has no known function. 
Probab=91.47  E-value=0.14  Score=30.71  Aligned_cols=41  Identities=20%  Similarity=0.415  Sum_probs=26.8

Q ss_pred             CCCCCCCCCCceeeecCCHHHHHHHHHH----c-CccEEEeccCCC
Q psy627           27 GWCSTGDPLSNLALNFSSKEDAIQYCQK----N-GWKFFVEEPKWK   67 (89)
Q Consensus        27 GWtss~D~~~qv~l~F~s~e~Aiayae~----~-G~~Y~V~~p~~~   67 (89)
                      ||.--.+.-......|+|+++||++|+.    + +-+..|.....+
T Consensus        10 ~W~v~~eg~~ra~~~~~Tk~eAi~~Ar~~a~~~~~~el~Ih~~dG~   55 (62)
T PF09954_consen   10 GWAVKKEGAKRASKTFDTKAEAIEAARELAKNQGGGELIIHGRDGK   55 (62)
T ss_pred             CceEEeCCCcccccccCcHHHHHHHHHHHHHhCCCcEEEEECCCCe
Confidence            4554444445557899999999998764    3 566666554433


No 4  
>PRK05370 argininosuccinate synthase; Validated
Probab=87.04  E-value=0.44  Score=39.59  Aligned_cols=22  Identities=5%  Similarity=0.318  Sum_probs=19.3

Q ss_pred             eecCCHHHHHHHHHHcCccEEE
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V   61 (89)
                      -.|+|+++.|+||++|||+..+
T Consensus       164 ~~f~sR~e~i~Ya~~hGIpv~~  185 (447)
T PRK05370        164 DELGGRAEMSEFLIAHGFDYKM  185 (447)
T ss_pred             cccCCHHHHHHHHHHcCCCCCc
Confidence            3689999999999999999754


No 5  
>PHA02552 4 head completion protein; Provisional
Probab=85.91  E-value=0.75  Score=33.06  Aligned_cols=21  Identities=33%  Similarity=0.673  Sum_probs=18.4

Q ss_pred             HHHHHHHHHHcCccEEEeccC
Q psy627           45 KEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      -++|.+||+++||.|.|....
T Consensus       120 ~~Aa~~~a~~~Gw~F~iiTE~  140 (151)
T PHA02552        120 WKAARALCEKKGWKFKIITED  140 (151)
T ss_pred             HHHHHHHHHHcCCEEEEEEHH
Confidence            478999999999999997754


No 6  
>PF07045 DUF1330:  Protein of unknown function (DUF1330);  InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.; PDB: 2FIU_B 3HHL_A 3DCA_D 3LO3_I.
Probab=81.69  E-value=1.5  Score=26.38  Aligned_cols=21  Identities=29%  Similarity=0.347  Sum_probs=16.2

Q ss_pred             CCCCCceeeecCCHHHHHHHH
Q psy627           32 GDPLSNLALNFSSKEDAIQYC   52 (89)
Q Consensus        32 ~D~~~qv~l~F~s~e~Aiaya   52 (89)
                      .++-.-|-|.|+|.++|+++-
T Consensus        36 ~~~~~~viieFPs~~aa~~~~   56 (65)
T PF07045_consen   36 WDPDRVVIIEFPSMEAAKAWY   56 (65)
T ss_dssp             -SSSEEEEEEESSHHHHHHHH
T ss_pred             CCCCeEEEEECCCHHHHHHHH
Confidence            444455899999999999873


No 7  
>PF08727 P3A:  Poliovirus 3A protein like;  InterPro: IPR014838 The 3A protein is found in positive-strand RNA viruses. It is a critical component of the poliovirus replication complex, and is also an inhibitor of host cell ER to Golgi transport. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0017111 nucleoside-triphosphatase activity; PDB: 1NG7_A.
Probab=80.99  E-value=1.1  Score=27.70  Aligned_cols=16  Identities=25%  Similarity=0.843  Sum_probs=10.7

Q ss_pred             HHHHHHHHHcCccEEE
Q psy627           46 EDAIQYCQKNGWKFFV   61 (89)
Q Consensus        46 e~Aiayae~~G~~Y~V   61 (89)
                      ++-+.||+++||-..+
T Consensus        30 ~eV~~YC~~~GWIip~   45 (57)
T PF08727_consen   30 PEVREYCEEQGWIIPA   45 (57)
T ss_dssp             HHHHHHHHHHT--TT-
T ss_pred             HHHHHHHHHCCccccC
Confidence            4589999999996443


No 8  
>PF08722 Tn7_Tnp_TnsA_N:  TnsA endonuclease N terminal;  InterPro: IPR014833 The Tn7 transposase is composed of proteins TnsA and TnsB. DNA breakage at the 5'-end of the transposon is carried out by TnsA, and breakage and joining at the 3'-end is carried out by TnsB. The N-terminal domain of TnsA is catalytic. ; PDB: 1F1Z_B 1T0F_B.
Probab=79.00  E-value=2.5  Score=26.50  Aligned_cols=19  Identities=21%  Similarity=0.291  Sum_probs=13.7

Q ss_pred             HHHHHHHHHHcCccEEEec
Q psy627           45 KEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~   63 (89)
                      .+.|-.||+++||+|.|..
T Consensus        69 ~~~~~~y~~~~g~~f~ivT   87 (88)
T PF08722_consen   69 LEIEREYWEEQGIPFRIVT   87 (88)
T ss_dssp             HHHHHHHHHHCT--EEEE-
T ss_pred             HHHHHHHHHHcCCeEEEEc
Confidence            4568899999999999864


No 9  
>PF11360 DUF3110:  Protein of unknown function (DUF3110);  InterPro: IPR021503  This family of proteins has no known function. 
Probab=78.40  E-value=2.1  Score=27.95  Aligned_cols=30  Identities=30%  Similarity=0.730  Sum_probs=23.8

Q ss_pred             CceeeecCCHHHHHHH-------------------------HHHcCccEEEeccC
Q psy627           36 SNLALNFSSKEDAIQY-------------------------CQKNGWKFFVEEPK   65 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiay-------------------------ae~~G~~Y~V~~p~   65 (89)
                      .++.|-|.+.+||.+|                         |+.+|+.|.|..+.
T Consensus        23 ~~~Vl~FE~edDA~RYa~lLEAqd~~~p~Ve~id~~~i~~fC~~~gy~~~iv~~g   77 (86)
T PF11360_consen   23 RNVVLMFEDEDDAERYAGLLEAQDFPDPTVEEIDPEEIEEFCRSAGYEYEIVPPG   77 (86)
T ss_pred             CCEEEEEccHHHHHHHHHHHHhcCCCCCCeEEECHHHHHHHHHHCCceEEEECCC
Confidence            7889999999999776                         56677777777665


No 10 
>PF05573 NosL:  NosL;  InterPro: IPR008719 NosL is one of the accessory proteins of the nos (nitrous oxide reductase) gene cluster. NosL is a monomeric protein of 18,540 MW that specifically and stoichiometrically binds Cu(I). The copper ion in NosL is ligated by a Cys residue, and one Met and one His are thought to serve as the other ligands. It is possible that NosL is a copper chaperone involved in metallocentre assembly []. This entry also contains HTH-type transcriptional repressors, including YcnK. YcnK may act as a negative transcriptional regulator of YcnJ in the presence of copper and may use copper as a corepressor. The gene, ycnK, is significantly induced under copper-limiting conditions.; PDB: 2HQ3_A 2HPU_A.
Probab=77.44  E-value=2.2  Score=29.71  Aligned_cols=47  Identities=26%  Similarity=0.596  Sum_probs=26.4

Q ss_pred             CceEEEecCCCCccCCCC-CCCCC-----------CCCCCceeeecCCHHHHHHHHHHcC
Q psy627            9 NNWFIQFDTRERWENPLM-GWCST-----------GDPLSNLALNFSSKEDAIQYCQKNG   56 (89)
Q Consensus         9 ~~W~lefe~~~~~~dPLM-GWtss-----------~D~~~qv~l~F~s~e~Aiayae~~G   56 (89)
                      ..||-+|.. ..|.+|-- -|...           .-|+.---+-|.++++|.+|+++||
T Consensus        77 ~~~V~D~~~-~~~~~p~~~~~Ida~~A~yV~gs~~~~pMg~~~~aF~~~~~A~~F~~~~G  135 (149)
T PF05573_consen   77 AIYVTDYST-TDWDQPGDGEWIDAKKAYYVVGSDVRGPMGPDLIAFASKEDAEAFAKEHG  135 (149)
T ss_dssp             EEEEEES-T-S-TT-S---EEEEGGGSEEEEESSSS-TTS--EEEES-HHHHHHHHHHTE
T ss_pred             EEEEEeccc-ccccCCCCCceEEcceEEEEECCCcCCCCCCcccccCCHHHHHHHHHHcC
Confidence            457888876 44444432 23322           1233334688999999999999998


No 11 
>PF06194 Phage_Orf51:  Phage Conserved Open Reading Frame 51;  InterPro: IPR009338 This entry is represented by the Staphylococcus phage PVL (bacteriophage phi-PVL), Orf51. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=77.16  E-value=2.1  Score=27.99  Aligned_cols=26  Identities=19%  Similarity=0.294  Sum_probs=23.3

Q ss_pred             CceeeecCCHHHHHHHHHHcCccEEE
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y~V   61 (89)
                      +.|+..|+|+++-..|-+.+++.|+=
T Consensus        48 ~gvKktFn~~~Ef~~Yi~~~~L~~ee   73 (80)
T PF06194_consen   48 KGVKKTFNNKEEFENYIKQHELYFEE   73 (80)
T ss_pred             cchhhhcCcHHHHHHHHHHcCCceeh
Confidence            45899999999999999999999863


No 12 
>PF02844 GARS_N:  Phosphoribosylglycinamide synthetase, N domain;  InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6.3.4.13 from EC) (GARS) (phosphoribosylamine glycine ligase) [] catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by phosphoribosylglycinamide synthetase is the ATP-dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide:  ATP + 5-phosphoribosylamine + glycine = ADP + Pi + 5'-phosphoribosylglycinamide  In bacteria, GARS is a monofunctional enzyme (encoded by the purD gene). In yeast, GARS is part of a bifunctional enzyme (encoded by the ADE5/7 gene) in conjunction with phosphoribosylformylglycinamidine cyclo-ligase (AIRS) (IPR000728 from INTERPRO). In higher eukaryotes, GARS is part of a trifunctional enzyme in conjunction with AIRS (IPR000728 from INTERPRO) and with phosphoribosylglycinamide formyltransferase (GART) (), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ....
Probab=73.99  E-value=3.8  Score=27.48  Aligned_cols=30  Identities=17%  Similarity=0.403  Sum_probs=23.8

Q ss_pred             ceeeecCCHHHHHHHHHHcCccEEEeccCC
Q psy627           37 NLALNFSSKEDAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G~~Y~V~~p~~   66 (89)
                      .+.+...+.++-++||+++++++.|.-|..
T Consensus        43 ~~~~~~~d~~~l~~~a~~~~idlvvvGPE~   72 (100)
T PF02844_consen   43 NVPIDITDPEELADFAKENKIDLVVVGPEA   72 (100)
T ss_dssp             EE-S-TT-HHHHHHHHHHTTESEEEESSHH
T ss_pred             ecCCCCCCHHHHHHHHHHcCCCEEEECChH
Confidence            356688999999999999999999998854


No 13 
>cd01207 Ena-Vasp Enabled-VASP-type homology (EVH1) domain. Enabled-VASP-type homology (EVH1) domain. The EVH1 domain binds to other proteins at proline rich sequences. It is found in proteins involved in cytoskeletal reorganization such as Enabled and VASP. Ena-VASP type EVH1 domains specifically recognize FPPPP motifs in the focal adhesion proteins zyxin and vinculin, and the ActA surface protein of Listeria monocytogenes.  It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=72.19  E-value=3.5  Score=28.22  Aligned_cols=22  Identities=36%  Similarity=0.448  Sum_probs=18.6

Q ss_pred             CCCceeeecCCHHHHHHHHHHc
Q psy627           34 PLSNLALNFSSKEDAIQYCQKN   55 (89)
Q Consensus        34 ~~~qv~l~F~s~e~Aiayae~~   55 (89)
                      ...+..|.|.|+|||-+|.+..
T Consensus        82 ~~~v~GLnF~Se~eA~~F~~~v  103 (111)
T cd01207          82 ARQVYGLNFGSKEDATMFASAM  103 (111)
T ss_pred             CCeEEeeccCCHHHHHHHHHHH
Confidence            3478899999999999998753


No 14 
>PRK04527 argininosuccinate synthase; Provisional
Probab=71.40  E-value=2.8  Score=34.23  Aligned_cols=22  Identities=9%  Similarity=0.291  Sum_probs=18.1

Q ss_pred             eeee-cCCHHHHHHHHHHcCccE
Q psy627           38 LALN-FSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        38 v~l~-F~s~e~Aiayae~~G~~Y   59 (89)
                      ..|. ++++++.|+||++|||+.
T Consensus       146 ~~~~k~~~R~~~i~ya~~~gipv  168 (400)
T PRK04527        146 IQKEHTQTRAYEQKYLEERGFGV  168 (400)
T ss_pred             hcCcccccHHHHHHHHHHcCCCC
Confidence            3443 469999999999999986


No 15 
>COG5470 Uncharacterized conserved protein [Function unknown]
Probab=69.94  E-value=5.2  Score=27.03  Aligned_cols=26  Identities=31%  Similarity=0.410  Sum_probs=20.3

Q ss_pred             CCCCCCCCCCCCCCceeeecCCHHHHHHH
Q psy627           23 NPLMGWCSTGDPLSNLALNFSSKEDAIQY   51 (89)
Q Consensus        23 dPLMGWtss~D~~~qv~l~F~s~e~Aiay   51 (89)
                      ++|=|   ..+|-..|.+.|+|+|.|.++
T Consensus        44 ~~lEG---~w~ptr~vviEFps~~~ar~~   69 (96)
T COG5470          44 ETLEG---EWRPTRNVVIEFPSLEAARDC   69 (96)
T ss_pred             eeccC---CCCcccEEEEEcCCHHHHHHH
Confidence            44444   357778899999999999876


No 16 
>KOG2854|consensus
Probab=69.43  E-value=4.2  Score=32.91  Aligned_cols=23  Identities=17%  Similarity=0.569  Sum_probs=20.7

Q ss_pred             eeeecCCHHHHHHHHHHcCccEE
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~   60 (89)
                      +-+-|.+.+||.+||+.+||+-.
T Consensus       215 ~DiifgNe~EA~af~~~~~~~t~  237 (343)
T KOG2854|consen  215 ADIIFGNEDEAAAFARAHGWETK  237 (343)
T ss_pred             ceEEEcCHHHHHHHHHhhCCccc
Confidence            57899999999999999999863


No 17 
>PF05406 WGR:  WGR domain;  InterPro: IPR008893 This domain is named after the most conserved central motif of the domain. It is found in a variety of polyA polymerases as well as the Escherichia coli molybdate metabolism regulator P33345 from SWISSPROT and other proteins of unknown function.The domain is found in isolation in proteins such as Q9JN21 from SWISSPROT and is between 70 and 80 residues in length. ; PDB: 2EOC_A 2RA8_A 4DQY_C 2CR9_A.
Probab=69.08  E-value=3.6  Score=25.61  Aligned_cols=45  Identities=22%  Similarity=0.262  Sum_probs=25.9

Q ss_pred             CCceEEEecCCCCcc-CCCCCCCCCCCCCCceeeecCCHHHHHHHHHH
Q psy627            8 ANNWFIQFDTRERWE-NPLMGWCSTGDPLSNLALNFSSKEDAIQYCQK   54 (89)
Q Consensus         8 t~~W~lefe~~~~~~-dPLMGWtss~D~~~qv~l~F~s~e~Aiayae~   54 (89)
                      .+.|.|+..+..-|. --==|-.|+. ...++ -.|+|.|+|++.+++
T Consensus        19 ~kfY~iql~~~~~~~v~~~wGRiG~~-gq~~~-~~f~s~~eA~~~f~~   64 (81)
T PF05406_consen   19 NKFYRIQLLPDLEWVVFRRWGRIGSK-GQTRI-KPFDSEEEAIKEFEK   64 (81)
T ss_dssp             EEEEEEEEEEETTEEEEEEEEETTSS-EEEEE-EEESSHHHHHHHHHH
T ss_pred             EEEEEEEEEeCCCeEEEEEECCCCCc-CcEEE-EeCCCHHHHHHHHHH
Confidence            456777776432110 1111334554 33444 489999999998875


No 18 
>PF03462 PCRF:  PCRF domain;  InterPro: IPR005139 This domain is found in peptide chain release factors. Peptide chain release factors are important for protein synthesis since they direct the termination of translation in response to the peptide chain termination codons UAG and UAA. These are structurally distinct but both contain the PCRF domain [].; GO: 0016149 translation release factor activity, codon specific, 0006415 translational termination, 0005737 cytoplasm; PDB: 3D5A_X 3D5C_X 3MR8_V 3MS0_V 3F1G_X 3F1E_X 1ZBT_A 2IHR_1 2X9R_Y 2X9T_Y ....
Probab=68.39  E-value=4.1  Score=27.31  Aligned_cols=15  Identities=33%  Similarity=0.802  Sum_probs=12.7

Q ss_pred             HHHHHHcCccEEEec
Q psy627           49 IQYCQKNGWKFFVEE   63 (89)
Q Consensus        49 iayae~~G~~Y~V~~   63 (89)
                      +.||+++||.++|..
T Consensus        73 ~~~a~~~gw~~~~l~   87 (115)
T PF03462_consen   73 QRYAERRGWKVEVLD   87 (115)
T ss_dssp             HHHHHHTT-EEEEEE
T ss_pred             HHHHHHcCCEEEEEe
Confidence            489999999999987


No 19 
>PF03108 DBD_Tnp_Mut:  MuDR family transposase;  InterPro: IPR004332 The plant MuDR transposase domain is present in plant proteins that are presumed to be the transposases for Mutator transposable elements [, ]. The function of these proteins is unknown. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=66.45  E-value=7.2  Score=23.20  Aligned_cols=35  Identities=34%  Similarity=0.553  Sum_probs=26.9

Q ss_pred             CCCCceeeecCCHHHH----HHHHHHcCccEEEeccCCC
Q psy627           33 DPLSNLALNFSSKEDA----IQYCQKNGWKFFVEEPKWK   67 (89)
Q Consensus        33 D~~~qv~l~F~s~e~A----iayae~~G~~Y~V~~p~~~   67 (89)
                      ||.=.+.+.|+|+++.    ..||-+++.+|.|..-...
T Consensus         1 n~~l~~G~~F~~~~e~k~av~~yai~~~~~~~v~ksd~~   39 (67)
T PF03108_consen    1 NPELEVGQTFPSKEEFKEAVREYAIKNGFEFKVKKSDKK   39 (67)
T ss_pred             CCccccCCEECCHHHHHHHHHHHHHhcCcEEEEeccCCE
Confidence            4555688999999876    4689999999998765443


No 20 
>PF00568 WH1:  WH1 domain;  InterPro: IPR000697 The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events. This domain of around 115 amino acids is present in species ranging from yeast to mammals. Many EVH1-containing proteins associate with actin-based structures and play a role in cytoskeletal organisation. EVH1 domains recognise and bind the proline-rich motif FPPPP with low-affinity, further interactions then form between flanking residues [][].  WASP family proteins contain a EVH1 (WH1) in their N-terminals which bind proline-rich sequences in the WASP interacting protein. Proteins of the RanBP1 family contain a WH1 domain in their N-terminal region, which seems to bind a different sequence motif present in the C-terminal part of RanGTP protein [,].  Tertiary structure of the WH1 domain of the Mena protein revealed structure similarities with the pleckstrin homology (PH) domain. The overall fold consists of a compact parallel beta-sandwich, closed along one edge by a long alpha-helix. A highly conserved cluster of three surface-exposed aromatic side-chains forms the recognition site for the molecules target ligands. [].; GO: 0005515 protein binding; PDB: 1I2H_A 1DDV_A 1DDW_A 1EGX_A 3SYX_A 1TJ6_B 1XOD_B 1EVH_A 1I7A_B 2JP2_A ....
Probab=66.18  E-value=6.4  Score=25.93  Aligned_cols=19  Identities=42%  Similarity=0.607  Sum_probs=17.2

Q ss_pred             CceeeecCCHHHHHHHHHH
Q psy627           36 SNLALNFSSKEDAIQYCQK   54 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~   54 (89)
                      ..+.|.|.|.+||-.|+++
T Consensus        88 ~~~GLnF~se~eA~~F~~~  106 (111)
T PF00568_consen   88 CVYGLNFASEEEADQFYKK  106 (111)
T ss_dssp             CEEEEEESSHHHHHHHHHH
T ss_pred             eEEEEecCCHHHHHHHHHH
Confidence            4889999999999999875


No 21 
>PF12518 DUF3721:  Protein of unknown function;  InterPro: IPR022196  This domain family is found in bacteria and eukaryotes, and is approximately 30 amino acids in length. There is a conserved WMPC sequence motif. There are two completely conserved residues (A and C) that may be functionally important. 
Probab=65.57  E-value=6.5  Score=21.86  Aligned_cols=16  Identities=19%  Similarity=0.378  Sum_probs=14.1

Q ss_pred             cCCHHHHHHHHHHcCc
Q psy627           42 FSSKEDAIQYCQKNGW   57 (89)
Q Consensus        42 F~s~e~Aiayae~~G~   57 (89)
                      |+|+++|.+=|.+.|-
T Consensus         1 y~tk~eAe~~A~~~GC   16 (34)
T PF12518_consen    1 YPTKAEAEKRAKELGC   16 (34)
T ss_pred             CCcHHHHHHHHHHcCC
Confidence            8999999999998774


No 22 
>KOG4748|consensus
Probab=65.52  E-value=4.6  Score=32.89  Aligned_cols=22  Identities=23%  Similarity=0.575  Sum_probs=18.5

Q ss_pred             CHHHHHHHHHHcCccEEEeccC
Q psy627           44 SKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      +-+-=|+||++||+++++..-.
T Consensus       127 ~ikNridYA~rHgy~~~~~~~~  148 (364)
T KOG4748|consen  127 SIKNRIDYARRHGYEFEYKNAT  148 (364)
T ss_pred             HHHhHHHHHHHhCCeEEEEecc
Confidence            6677799999999999987654


No 23 
>cd00837 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain. EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain. The EVH1 domain binds to other proteins at proline rich sequences in either FPPPP or PPXXF motifs. It is found in the cytoskeletal reorganization proteins Enabled VASP, and WASP, and in the synaptic scaffolding protein Homer. It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=63.74  E-value=7.8  Score=25.39  Aligned_cols=20  Identities=40%  Similarity=0.549  Sum_probs=17.5

Q ss_pred             CCceeeecCCHHHHHHHHHH
Q psy627           35 LSNLALNFSSKEDAIQYCQK   54 (89)
Q Consensus        35 ~~qv~l~F~s~e~Aiayae~   54 (89)
                      ...+.|.|.|.+||-+|.++
T Consensus        80 ~~~~GL~F~se~eA~~F~~~   99 (104)
T cd00837          80 NCVYGLNFASEEEAAQFRKK   99 (104)
T ss_pred             CcEEEEeeCCHHHHHHHHHH
Confidence            44789999999999999875


No 24 
>PRK05773 3,4-dihydroxy-2-butanone 4-phosphate synthase; Validated
Probab=62.35  E-value=7.3  Score=29.50  Aligned_cols=18  Identities=28%  Similarity=0.372  Sum_probs=16.2

Q ss_pred             CCHHHHHHHHHHcCccEE
Q psy627           43 SSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~   60 (89)
                      -++++|++||++||+++.
T Consensus       191 ~~~~~~~~fA~~~~l~~i  208 (219)
T PRK05773        191 LSKEKAKKIAKNLGFPLV  208 (219)
T ss_pred             cCHHHHHHHHHHcCCcEE
Confidence            479999999999999983


No 25 
>smart00461 WH1 WASP homology region 1. Region of the Wiskott-Aldrich syndrome protein (WASp) that contains point mutations in the majority of patients with WAS. Unknown function. Ena-like WH1 domains bind polyproline-containing peptides, and that Homer contains a WH1 domain.
Probab=61.67  E-value=8.7  Score=25.36  Aligned_cols=20  Identities=35%  Similarity=0.522  Sum_probs=17.4

Q ss_pred             CCceeeecCCHHHHHHHHHH
Q psy627           35 LSNLALNFSSKEDAIQYCQK   54 (89)
Q Consensus        35 ~~qv~l~F~s~e~Aiayae~   54 (89)
                      ...+.|.|.|.+||-+|.++
T Consensus        82 ~~~~GLnF~se~EA~~F~~~  101 (106)
T smart00461       82 KCVYGLNFASEEEAKKFRKK  101 (106)
T ss_pred             CeEEEeecCCHHHHHHHHHH
Confidence            34689999999999999876


No 26 
>PF01693 Cauli_VI:  Caulimovirus viroplasmin;  InterPro: IPR011320 This entry represents the N-terminal domain of RNase HI, which has a 3-layer alpha/beta/alpha structure []. This domain is lacking in retroviral and prokaryotic enzymes, but shows a striking structural similarity to the ribosomal protein L9 N-terminal domain, and may function as a regulatory RNA-binding module. However, the topology of this domain differs from structures of known RNA binding domains such as the double-stranded RNA binding domain (dsRBD), the hnRNP K homology (KH) domain and the RNP motif. Eukaryotic RNases HI possess either one or two copies of this small N-terminal domain, in addition to the well-conserved catalytic RNase H domain. RNase HI belongs to the family of ribonuclease H enzymes that recognise RNA:DNA hybrids and degrade the RNA component. ; PDB: 1QHK_A 3BSU_C.
Probab=61.46  E-value=8.4  Score=21.62  Aligned_cols=14  Identities=21%  Similarity=0.560  Sum_probs=12.4

Q ss_pred             eeeecCCHHHHHHH
Q psy627           38 LALNFSSKEDAIQY   51 (89)
Q Consensus        38 v~l~F~s~e~Aiay   51 (89)
                      +...|+|.|+|.+|
T Consensus        31 ~~k~F~t~~eA~~~   44 (44)
T PF01693_consen   31 IYKSFKTREEAEEF   44 (44)
T ss_dssp             EEEEESSHHHHHHH
T ss_pred             eECCcCCHHHHhhC
Confidence            47899999999986


No 27 
>PF01071 GARS_A:  Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain;  InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6.3.4.13 from EC) (GARS) (phosphoribosylamine glycine ligase) [] catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by phosphoribosylglycinamide synthetase is the ATP-dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide:  ATP + 5-phosphoribosylamine + glycine = ADP + Pi + 5'-phosphoribosylglycinamide  In bacteria, GARS is a monofunctional enzyme (encoded by the purD gene). In yeast, GARS is part of a bifunctional enzyme (encoded by the ADE5/7 gene) in conjunction with phosphoribosylformylglycinamidine cyclo-ligase (AIRS) (IPR000728 from INTERPRO). In higher eukaryotes, GARS is part of a trifunctional enzyme in conjunction with AIRS (IPR000728 from INTERPRO) and with phosphoribosylglycinamide formyltransferase (GART) (), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ....
Probab=60.52  E-value=10  Score=28.02  Aligned_cols=26  Identities=23%  Similarity=0.526  Sum_probs=21.7

Q ss_pred             eeecCCHHHHHHHHHHcCccEEEecc
Q psy627           39 ALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      --.|.+.++|++|.+.++.++.|+.+
T Consensus        20 ~~~f~~~~~A~~~l~~~~~p~~ViKa   45 (194)
T PF01071_consen   20 YKVFTDYEEALEYLEEQGYPYVVIKA   45 (194)
T ss_dssp             EEEESSHHHHHHHHHHHSSSEEEEEE
T ss_pred             eeEECCHHHHHHHHHhcCCCceEEcc
Confidence            35799999999999999999955444


No 28 
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed
Probab=59.39  E-value=13  Score=24.74  Aligned_cols=27  Identities=15%  Similarity=0.236  Sum_probs=24.1

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      |.+..++.+++.+|++++|++|.+...
T Consensus        68 i~Is~d~~~~~~~~~~~~~~~~~~l~D   94 (154)
T PRK09437         68 LGISTDKPEKLSRFAEKELLNFTLLSD   94 (154)
T ss_pred             EEEcCCCHHHHHHHHHHhCCCCeEEEC
Confidence            578889999999999999999988764


No 29 
>COG0108 RibB 3,4-dihydroxy-2-butanone 4-phosphate synthase [Coenzyme metabolism]
Probab=59.31  E-value=8.6  Score=29.05  Aligned_cols=21  Identities=10%  Similarity=0.249  Sum_probs=17.3

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      ..++++++||++||+++.-.+
T Consensus       172 ar~~~~~~fa~~h~l~~iti~  192 (203)
T COG0108         172 ARLPELEEFAKEHGLPVITIE  192 (203)
T ss_pred             cChHHHHHHHHHcCCcEEEHH
Confidence            468999999999999986433


No 30 
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism]
Probab=59.07  E-value=7.4  Score=32.16  Aligned_cols=22  Identities=23%  Similarity=0.527  Sum_probs=19.2

Q ss_pred             eecCCHHHHHHHHHHcCccEEEe
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~   62 (89)
                      ..|. +|+.|+||+++||++.+.
T Consensus       150 w~~~-R~~~i~Ya~~~gipv~~~  171 (403)
T COG0137         150 WNLT-REEEIEYAEEHGIPVKAT  171 (403)
T ss_pred             hccC-hHHHHHHHHHcCCCcccc
Confidence            4566 999999999999998776


No 31 
>PF13031 DUF3892:  Protein of unknown function (DUF3892)
Probab=58.43  E-value=10  Score=23.89  Aligned_cols=20  Identities=40%  Similarity=0.895  Sum_probs=18.0

Q ss_pred             CCHHHHHHHHHHcCccEEEe
Q psy627           43 SSKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~   62 (89)
                      -|+++||+++|...+.|.|.
T Consensus        31 ~s~~~~i~~ie~g~~~~yv~   50 (85)
T PF13031_consen   31 YSREEAIAWIENGKWSFYVE   50 (85)
T ss_pred             ccHHHHHHHHHcCCceEEeC
Confidence            48999999999988888887


No 32 
>PF07862 Nif11:  Nitrogen fixation protein of unknown function;  InterPro: IPR012903 This domain is found in the cyanobacteria, and the nitrogen-fixing proteobacterium Azotobacter vinelandii and may be involved in nitrogen fixation, but no role has been assigned []. 
Probab=57.73  E-value=5.4  Score=22.64  Aligned_cols=19  Identities=16%  Similarity=0.471  Sum_probs=17.0

Q ss_pred             CCHHHHHHHHHHcCccEEE
Q psy627           43 SSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V   61 (89)
                      .+.|+-|++|+.+|+.+..
T Consensus        27 ~~~~e~~~lA~~~Gy~ft~   45 (49)
T PF07862_consen   27 QNPEEVVALAREAGYDFTE   45 (49)
T ss_pred             CCHHHHHHHHHHcCCCCCH
Confidence            5999999999999998864


No 33 
>PF08803 ydhR:  Putative mono-oxygenase ydhR;  InterPro: IPR014910 YdhR is a homodimeric protein that comprises of a central four-stranded beta sheet and four surrounding alpha helices []. It shows structural homology to the ActVA-Orf6 and YgiN proteins which indicates it could be a mono-oxygenase. ; PDB: 1WD6_B 2HIQ_B 2ASY_B.
Probab=57.21  E-value=8.1  Score=26.02  Aligned_cols=28  Identities=14%  Similarity=0.245  Sum_probs=20.6

Q ss_pred             CCCCCCCCCc-eeeecCCHHHHHHHHHHc
Q psy627           28 WCSTGDPLSN-LALNFSSKEDAIQYCQKN   55 (89)
Q Consensus        28 Wtss~D~~~q-v~l~F~s~e~Aiayae~~   55 (89)
                      ||.+.++..- =-.-|+|+++|.+|+++|
T Consensus        38 Wten~~t~eaGGiYLFe~e~~A~aY~~~h   66 (97)
T PF08803_consen   38 WTENEETGEAGGIYLFEDEASAEAYLEMH   66 (97)
T ss_dssp             EEEETTTTEEEEEEEESSHHHHHHHHHHH
T ss_pred             EEecCCCCccceEEEECCHHHHHHHHHHH
Confidence            6666665432 135589999999999987


No 34 
>PLN00139 hypothetical protein; Provisional
Probab=56.52  E-value=11  Score=29.61  Aligned_cols=25  Identities=16%  Similarity=0.053  Sum_probs=21.0

Q ss_pred             eecCCHHHHHHHHHHcCccEEEecc
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ..-++++++.+||.++|+.|+-.+.
T Consensus       195 F~t~d~~eve~~~~~~g~~~eW~~d  219 (320)
T PLN00139        195 FGTSDKAEAERRAKALGMDMEWLPN  219 (320)
T ss_pred             hCCCCHHHHHHHHHHcCCeEEEcCC
Confidence            3347899999999999999987654


No 35 
>PF10566 Glyco_hydro_97:  Glycoside hydrolase 97  ;  InterPro: IPR019563 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site.  This is the 97th family of glycosidases, in this case bacterial. The central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, most probably form two additional non-catalytic domains with as yet unknown functions. The non-catalytic domains of glycosidases from the alpha-galactosidase and alpha-glucosidase superfamilies are also predominantly composed of beta-strands, and at least some of these domains are involved in oligomerisation and carbohydrate binding. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands []. ; PDB: 2JKP_A 2JKE_A 2D73_B 2ZQ0_B 2JKA_A 3A24_A.
Probab=55.98  E-value=9.6  Score=29.63  Aligned_cols=26  Identities=8%  Similarity=0.295  Sum_probs=21.0

Q ss_pred             eeecCCHHHHHHHHHHcCccEEEecc
Q psy627           39 ALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .+.+++-..=|+||.++||+|.+...
T Consensus        28 g~~t~~~k~yIDfAa~~G~eYvlvD~   53 (273)
T PF10566_consen   28 GATTETQKRYIDFAAEMGIEYVLVDA   53 (273)
T ss_dssp             SSSHHHHHHHHHHHHHTT-SEEEEBT
T ss_pred             CCCHHHHHHHHHHHHHcCCCEEEecc
Confidence            45677888889999999999999853


No 36 
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain. Large family of serine/threonine phosphatases, that includes PP1, PP2A and PP2B (calcineurin) family members.
Probab=55.91  E-value=21  Score=27.14  Aligned_cols=41  Identities=17%  Similarity=0.442  Sum_probs=28.4

Q ss_pred             CccCC---CCCCCCCCCCCCceeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           20 RWENP---LMGWCSTGDPLSNLALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        20 ~~~dP---LMGWtss~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      -|.||   .-||..|  + ......|. .+++.+|++++|+.+.|..-
T Consensus       176 lWsDP~~~~~~~~~~--~-Rg~g~~fg-~~~~~~Fl~~n~l~~iiR~H  219 (271)
T smart00156      176 LWSDPDQPVDGFQPS--I-RGASYYFG-PDAVDEFLKKNNLKLIIRAH  219 (271)
T ss_pred             eecCCCcccCCCccC--C-CCCccccC-HHHHHHHHHHCCCeEEEecC
Confidence            46676   3455544  2 33556674 78888999999999998653


No 37 
>PF10075 PCI_Csn8:  COP9 signalosome, subunit CSN8;  InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8. In the complex, Cops8, which is the smallest subunit, probably interacts directly with Cops3, Cops4 and Cops7 (Cops7A or Cops7B). This signalosome is homologous to the lid subcomplex of the 26S proteasome and regulates the ubiquitin-proteasome pathway. It functions as a structural scaffold for subunit-subunit interactions within the complex and is a key regulator of photomorphogenic development [].; PDB: 1RZ4_A.
Probab=55.49  E-value=7.8  Score=26.25  Aligned_cols=20  Identities=25%  Similarity=0.602  Sum_probs=15.0

Q ss_pred             eecCCHHHHHHHHHHcCccEE
Q psy627           40 LNFSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~   60 (89)
                      |-|+ .+++++||+++||.++
T Consensus       107 Lg~~-~~el~~~~~~~gW~~d  126 (143)
T PF10075_consen  107 LGLS-EEELEKFIKSRGWTVD  126 (143)
T ss_dssp             TTS--HHHHHHHHHHHT-EE-
T ss_pred             hCCC-HHHHHHHHHHcCCEEC
Confidence            4556 8999999999999985


No 38 
>KOG1706|consensus
Probab=54.53  E-value=7.8  Score=31.77  Aligned_cols=23  Identities=22%  Similarity=0.515  Sum_probs=19.9

Q ss_pred             ecCCHHHHHHHHHHcCccEEEec
Q psy627           41 NFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +|.-++|+++||++|||+.-|..
T Consensus       154 rf~Gr~Dl~eYakq~giPvpvT~  176 (412)
T KOG1706|consen  154 RFKGRKDLLEYAKQHGIPVPVTP  176 (412)
T ss_pred             hhcCchHHHHHHHhcCCCccccC
Confidence            58889999999999999976643


No 39 
>PF03793 PASTA:  PASTA domain;  InterPro: IPR005543 The PASTA domain is found at the C-termini of several Penicillin-binding proteins (PBP) and bacterial serine/threonine kinases. It binds the beta-lactam stem, which implicates it in sensing D-alanyl-D-alanine - the PBP transpeptidase substrate. In PknB of Mycobacterium tuberculosis (P71584 from SWISSPROT), all of the extracellular portion is predicted to be made up of four PASTA domains, which strongly suggests that it is a signal-binding sensor domain. The domain has also been found in proteins involved in cell wall biosynthesis, where it is implicated in localizing the biosynthesis complex to unlinked peptidoglycan. PASTA is a small globular fold consisting of 3 beta-sheets and an alpha-helix, with a loop region of variable length between the first and second beta-strands. The name PASTA is derived from PBP and Serine/Threonine kinase Associated domain [].; GO: 0008658 penicillin binding; PDB: 2ZC3_C 1QME_A 1RP5_B 2Z2M_C 2Z2L_F 2ZC4_C 1QMF_A 3M9G_A 3PY9_A 1K25_B ....
Probab=53.36  E-value=17  Score=20.97  Aligned_cols=22  Identities=18%  Similarity=0.158  Sum_probs=17.6

Q ss_pred             CCHHHHHHHHHHcCccEEEecc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      -|.++|.+..+..||.+.+...
T Consensus         9 ~~~~~a~~~l~~~g~~~~~~~~   30 (63)
T PF03793_consen    9 MTYDEAKSILEAAGLTVNVVEE   30 (63)
T ss_dssp             SBHHHHHHHHHHTT-EEEEEEE
T ss_pred             CcHHHHHHHHHHCCCEEEEEEE
Confidence            4789999999999998877653


No 40 
>PF03682 UPF0158:  Uncharacterised protein family (UPF0158);  InterPro: IPR005361 This is a small family of hypothetical bacterial proteins of unknown function.
Probab=52.60  E-value=11  Score=26.89  Aligned_cols=20  Identities=35%  Similarity=0.539  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHcCccEEEecc
Q psy627           45 KEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ++.|+..|+.|||.|...++
T Consensus       127 r~~a~eWleen~I~~~~~~~  146 (163)
T PF03682_consen  127 RERAIEWLEENGIEPVFEED  146 (163)
T ss_pred             HHHHHHHHHHcCCCcccccc
Confidence            67899999999999988775


No 41 
>PF12745 HGTP_anticodon2:  Anticodon binding domain of tRNAs;  InterPro: IPR024435 This is an anticodon binding domain, found largely on Gcn2 proteins which bind tRNA to down regulate translation in certain stress situations [].; GO: 0000049 tRNA binding
Probab=52.42  E-value=17  Score=28.09  Aligned_cols=23  Identities=26%  Similarity=0.582  Sum_probs=20.3

Q ss_pred             CCHHHHHHHHHHcCccEEEeccC
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      .|.||.+.+|..+|+.|.|.--.
T Consensus        44 ~S~Eel~~~~~~~gi~wiViikq   66 (273)
T PF12745_consen   44 PSQEELQSYCREDGISWIVIIKQ   66 (273)
T ss_pred             CCHHHHHHHHHHCCCCEEEEEec
Confidence            59999999999999999987633


No 42 
>PF09383 NIL:  NIL domain;  InterPro: IPR018449 This domain is found at the C terminus of ABC transporter proteins involved in D-methionine transport as well as a number of ferredoxin-like proteins. This domain is likely to act as a substrate binding domain. The domain has been named after a conserved sequence in some members of the family. ; PDB: 2QRR_A 3CED_A 2QSW_A 3TUZ_D 3TUJ_D 3DHX_B 3TUI_H 3DHW_D.
Probab=51.24  E-value=18  Score=21.88  Aligned_cols=29  Identities=31%  Similarity=0.436  Sum_probs=21.1

Q ss_pred             CCCceeeecC----CHHHHHHHHHHcCccEEEe
Q psy627           34 PLSNLALNFS----SKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        34 ~~~qv~l~F~----s~e~Aiayae~~G~~Y~V~   62 (89)
                      |+..+.|.++    ..++|++|.+.+|+..+|.
T Consensus        44 ~~G~l~l~l~g~~~~~~~a~~~L~~~~v~vEvl   76 (76)
T PF09383_consen   44 PFGILILELPGDDEEIEKAIAYLREQGVEVEVL   76 (76)
T ss_dssp             EEEEEEEEEES-HHHHHHHHHHHHHTTEEEEEE
T ss_pred             eEEEEEEEEECCHHHHHHHHHHHHHCCCeEEEC
Confidence            3445566662    2468999999999998874


No 43 
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]
Probab=50.62  E-value=13  Score=26.73  Aligned_cols=30  Identities=17%  Similarity=0.236  Sum_probs=26.4

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEeccCCC
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEEPKWK   67 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~p~~~   67 (89)
                      +.++-+|.++=-+||+++|++|.+.....+
T Consensus        68 ~GIS~Ds~~~~~~F~~k~~L~f~LLSD~~~   97 (157)
T COG1225          68 LGISPDSPKSHKKFAEKHGLTFPLLSDEDG   97 (157)
T ss_pred             EEEeCCCHHHHHHHHHHhCCCceeeECCcH
Confidence            479999999999999999999999876543


No 44 
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of  thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides. The protein was named BCP based on its electrophoretic mobility before its function was known. BCP shows substrate selectivity toward fatty acid hydroperoxides rather than hydrogen peroxide or alkyl hydroperoxides. BCP contains the peroxidatic cysteine but appears not to possess a resolving cysteine (some sequences, not all, contain a second cysteine but its role is still unknown). Unlike other PRXs, BCP exists as a monomer. The plant homolog of BCP is PRX Q, which is expressed only in leaves and is cellularly localized in the chloroplasts and the guard cells of stomata. Also included in this subfamily is the fungal nuclear protein,  Dot5p (for disrupter of telomere silencing protein 5), w
Probab=50.51  E-value=24  Score=22.68  Aligned_cols=28  Identities=18%  Similarity=0.272  Sum_probs=24.1

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEeccC
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      |.+.-++.+++.+|++++|+.|.|....
T Consensus        61 v~is~d~~~~~~~~~~~~~~~~~~l~D~   88 (140)
T cd03017          61 IGVSPDSVESHAKFAEKYGLPFPLLSDP   88 (140)
T ss_pred             EEEcCCCHHHHHHHHHHhCCCceEEECC
Confidence            5677889999999999999999887643


No 45 
>COG3341 Predicted double-stranded RNA/RNA-DNA hybrid binding protein [General function prediction only]
Probab=49.87  E-value=9.8  Score=29.21  Aligned_cols=14  Identities=43%  Similarity=0.805  Sum_probs=12.9

Q ss_pred             ecCCHHHHHHHHHH
Q psy627           41 NFSSKEDAIQYCQK   54 (89)
Q Consensus        41 ~F~s~e~Aiayae~   54 (89)
                      +|+|.|+|.+||+-
T Consensus        39 sf~s~EeA~a~~~g   52 (225)
T COG3341          39 SFKSYEEAEAYCEG   52 (225)
T ss_pred             ccccHHHHHHHhcc
Confidence            49999999999995


No 46 
>PF13911 AhpC-TSA_2:  AhpC/TSA antioxidant enzyme
Probab=49.61  E-value=18  Score=23.12  Aligned_cols=29  Identities=17%  Similarity=0.336  Sum_probs=24.2

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEeccCC
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~p~~   66 (89)
                      |-+...+.+.+-+||+..++++.|.....
T Consensus        17 v~I~~g~~~~~~~f~~~~~~p~~ly~D~~   45 (115)
T PF13911_consen   17 VVIGCGSPEGIEKFCELTGFPFPLYVDPE   45 (115)
T ss_pred             EEEEcCCHHHHHHHHhccCCCCcEEEeCc
Confidence            46778999889999999999999866444


No 47 
>PLN00200 argininosuccinate synthase; Provisional
Probab=49.10  E-value=14  Score=30.28  Aligned_cols=18  Identities=28%  Similarity=0.543  Sum_probs=16.2

Q ss_pred             cCCHHHHHHHHHHcCccE
Q psy627           42 FSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y   59 (89)
                      |.|+++.++||+++|++.
T Consensus       153 ~~~r~e~~~~A~~~Gipv  170 (404)
T PLN00200        153 IKGREDLIEYAKKHNIPV  170 (404)
T ss_pred             CCCHHHHHHHHHHcCCCC
Confidence            559999999999999974


No 48 
>TIGR00506 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase. Several members of the family are bifunctional, involving both ribA and ribB function. In these cases, ribA tends to be on the C-terminal end of the protein and ribB tends to be on the N-terminal.
Probab=48.71  E-value=17  Score=27.10  Aligned_cols=19  Identities=21%  Similarity=0.545  Sum_probs=16.7

Q ss_pred             cCCHHHHHHHHHHcCccEE
Q psy627           42 FSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~   60 (89)
                      -.+++++.+||++||+++.
T Consensus       172 m~~~~~~~~fA~~~~l~~i  190 (199)
T TIGR00506       172 MARKPELMEYAKKHNLKLI  190 (199)
T ss_pred             ccCHHHHHHHHHHcCCcEE
Confidence            4678999999999999983


No 49 
>cd07996 WGR_MMR_like WGR domain of molybdate metabolism regulator and related proteins. The WGR domain is found in the putative Escherichia coli molybdate metabolism regulator and related bacterial proteins, as well as in various other bacterial proteins of unknown function. It has been called WGR after the most conserved central motif of the domain. The domain appears to occur in single-domain proteins and in a variety of domain architectures, together with ATP-dependent DNA ligase domains, WD40 repeats, leucine-rich repeats, and other domains. It has been proposed to function as a nucleic acid binding domain.
Probab=48.55  E-value=51  Score=19.73  Aligned_cols=50  Identities=18%  Similarity=0.197  Sum_probs=29.6

Q ss_pred             CCCCceEEEecCCCCc-cCCCCCCCCCCCCCCceeeecCCHHHHHHHHHHc
Q psy627            6 HNANNWFIQFDTRERW-ENPLMGWCSTGDPLSNLALNFSSKEDAIQYCQKN   55 (89)
Q Consensus         6 ~~t~~W~lefe~~~~~-~dPLMGWtss~D~~~qv~l~F~s~e~Aiayae~~   55 (89)
                      ...+.|.|+..+...- ..-+.=|---+..-+.....|+|.++|++.+++.
T Consensus        12 n~~kfy~i~l~~~lfg~~~v~~~wGRiG~~Gq~~~~~~~s~~~A~~~~~k~   62 (74)
T cd07996          12 NSARFYEIELEGDLFGEWSLVRRWGRIGTKGQSRTKTFDSEEEALKAAEKL   62 (74)
T ss_pred             CCCcEEEEEEcccCCCCEEEEEEECCCCCCCceEEEECCCHHHHHHHHHHH
Confidence            3446788888763111 1223334333433233457799999999988763


No 50 
>PRK01792 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional
Probab=48.45  E-value=17  Score=27.47  Aligned_cols=19  Identities=11%  Similarity=0.466  Sum_probs=16.9

Q ss_pred             cCCHHHHHHHHHHcCccEE
Q psy627           42 FSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~   60 (89)
                      ..+++++++||++||+++.
T Consensus       182 ma~~~~~~~fA~~~~l~~i  200 (214)
T PRK01792        182 MARTPEIVEFAKKFGYAVV  200 (214)
T ss_pred             ccCHHHHHHHHHHcCCcEE
Confidence            4679999999999999984


No 51 
>PF05198 IF3_N:  Translation initiation factor IF-3, N-terminal domain;  InterPro: IPR019814 Initiation factor 3 (IF-3) (gene infC) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-3 is thought to function as a fidelity factor during the assembly of the ternary initiation complex which consist of the 30S ribosomal subunit, the initiator tRNA and the messenger RNA. IF-3 is a basic protein that binds to the 30S ribosomal subunit []. The chloroplast initiation factor IF-3(chl) is a protein that enhances the poly(A,U,G)-dependent binding of the initiator tRNA to chloroplast ribosomal 30s subunits in which the central section is evolutionary related to the sequence of bacterial IF-3 []. ; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 1TIF_A.
Probab=48.45  E-value=18  Score=22.85  Aligned_cols=26  Identities=15%  Similarity=0.294  Sum_probs=20.4

Q ss_pred             cCCHHHHHHHHHHcCccEEEeccCCC
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEEPKWK   67 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~p~~~   67 (89)
                      .=+.++|++-|++.|++-....|...
T Consensus        27 v~~~~eAl~~A~~~~lDLV~v~~~~~   52 (76)
T PF05198_consen   27 VMSLREALRLAKEKGLDLVEVSPNAD   52 (76)
T ss_dssp             EEEHHHHHHHHHHTT-EEEEEETTSS
T ss_pred             eEEHHHHHHHHHHcCCcEEEEcCCCC
Confidence            34689999999999999988776543


No 52 
>PRK00923 sirohydrochlorin cobaltochelatase; Reviewed
Probab=47.00  E-value=31  Score=22.61  Aligned_cols=25  Identities=16%  Similarity=0.170  Sum_probs=21.9

Q ss_pred             eecCCHHHHHHHHHHcCccEEEecc
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      +..+|.+++|+-|.+.|..-.|..|
T Consensus        43 ~~~P~l~~~l~~l~~~g~~~v~vvP   67 (126)
T PRK00923         43 FNEPTIPEALKKLIGTGADKIIVVP   67 (126)
T ss_pred             cCCCCHHHHHHHHHHcCCCEEEEEc
Confidence            4568999999999999999877776


No 53 
>COG0290 InfC Translation initiation factor 3 (IF-3) [Translation, ribosomal structure and biogenesis]
Probab=46.72  E-value=28  Score=25.81  Aligned_cols=33  Identities=24%  Similarity=0.384  Sum_probs=26.8

Q ss_pred             CCHHHHHHHHHHcCccEEEeccCCC--CCCccccc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPKWK--TPKVKSYA   75 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~~~--~~~~ksYa   75 (89)
                      -|.++|+..|+..|++..+..|+..  .-+.-.||
T Consensus        34 v~~~eAL~lA~e~~LDLV~Ispna~PPVcKImDYG   68 (176)
T COG0290          34 VSIEEALKLAEEAGLDLVEISPNAKPPVCKIMDYG   68 (176)
T ss_pred             eeHHHHHHHHHHcCCCEEEECCCCCCCeeEeeecc
Confidence            4789999999999999999998743  33556676


No 54 
>PF14259 RRM_6:  RNA recognition motif (a.k.a. RRM, RBD, or RNP domain); PDB: 2DNN_A 1WI6_A 2EVZ_A 2ADC_A 1QM9_A 2KG1_A 2HGN_A 1U2F_A 2G4B_A 2HZC_A ....
Probab=46.48  E-value=21  Score=20.38  Aligned_cols=20  Identities=30%  Similarity=0.204  Sum_probs=17.5

Q ss_pred             ceeeecCCHHHHHHHHHHcC
Q psy627           37 NLALNFSSKEDAIQYCQKNG   56 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G   56 (89)
                      ..-+.|.|.|+|...++.++
T Consensus        41 ~a~v~f~~~~~a~~al~~~~   60 (70)
T PF14259_consen   41 FAFVEFSSEEDAKRALELLN   60 (70)
T ss_dssp             EEEEEESSHHHHHHHHHHHT
T ss_pred             EEEEEeCCHHHHHHHHHHCC
Confidence            35699999999999999877


No 55 
>cd00913 PCD_DCoH_subfamily_a PCD_DCoH: The bifunctional protein pterin-4alpha-carbinolamine dehydratase (PCD), also known as DCoH  (dimerization cofactor of hepatocyte nuclear factor-1), is both a transcription activator and a metabolic enzyme.  DCoH stimulates gene expression by associating with specific DNA binding proteins such as HNF-1alpha (hepatocyte nuclear factor-1) and Xenopus enhancer of rudimentary homologue (XERH).  DCoH also catalyzes the dehydration of 4alpha- hydroxy- tetrahydrobiopterin (4alpha-OH-BH4) to quinoiddihydrobiopterin, a percursor of the phenylalanine hydroxylase cofactor BH4 (tetrahydrobiopterin). The DCoH homodimer has a saddle-shaped structure similar to that of TBP (TATA binding protein).
Probab=45.48  E-value=32  Score=21.22  Aligned_cols=29  Identities=21%  Similarity=0.445  Sum_probs=22.3

Q ss_pred             CCCCCCCCC-CceeeecCCHHHHHHHHHHc
Q psy627           27 GWCSTGDPL-SNLALNFSSKEDAIQYCQKN   55 (89)
Q Consensus        27 GWtss~D~~-~qv~l~F~s~e~Aiayae~~   55 (89)
                      ||.-..|+. -.-+..|++-.+|++|+.+-
T Consensus         1 gW~~~~~~~~l~r~f~f~~f~~a~~f~~~v   30 (76)
T cd00913           1 GWELADDGLKLERTFRFKNFVEALEFVNAV   30 (76)
T ss_pred             CCcCcCCCCeEEEEEEcCCHHHHHHHHHHH
Confidence            788777753 34578899999999998763


No 56 
>PRK13010 purU formyltetrahydrofolate deformylase; Reviewed
Probab=45.36  E-value=32  Score=26.65  Aligned_cols=30  Identities=10%  Similarity=0.018  Sum_probs=25.8

Q ss_pred             CceeeecCCHHHHHHHHHHcCccEEEeccC
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      ..+.+-..++.+|.++|+++||++.+....
T Consensus       121 ~~i~~visn~~~~~~~A~~~gIp~~~~~~~  150 (289)
T PRK13010        121 MDIVGIISNHPDLQPLAVQHDIPFHHLPVT  150 (289)
T ss_pred             cEEEEEEECChhHHHHHHHcCCCEEEeCCC
Confidence            567888899999999999999999986543


No 57 
>PF02786 CPSase_L_D2:  Carbamoyl-phosphate synthase L chain, ATP binding domain;  InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below). CPSase catalyses the synthesis of carbamoyl phosphate from biocarbonate, ATP and glutamine (6.3.5.5 from EC) or ammonia (6.3.4.16 from EC), and represents the first committed step in pyrimidine and arginine biosynthesis in prokaryotes and eukaryotes, and in the urea cycle in most terrestrial vertebrates [, ]. CPSase has three active sites, one in the small subunit and two in the large subunit. The small subunit contains the glutamine binding site and catalyses the hydrolysis of glutamine to glutamate and ammonia. The large subunit has two homologous carboxy phosphate domains, both of which have ATP-binding sites; however, the N-terminal carboxy phosphate domain catalyses the phosphorylation of biocarbonate, while the C-terminal domain catalyses the phosphorylation of the carbamate intermediate []. The carboxy phosphate domain found duplicated in the large subunit of CPSase is also present as a single copy in the biotin-dependent enzymes acetyl-CoA carboxylase (6.4.1.2 from EC) (ACC), propionyl-CoA carboxylase (6.4.1.3 from EC) (PCCase), pyruvate carboxylase (6.4.1.1 from EC) (PC) and urea carboxylase (6.3.4.6 from EC). Most prokaryotes carry one form of CPSase that participates in both arginine and pyrimidine biosynthesis, however certain bacteria can have separate forms. The large subunit in bacterial CPSase has four structural domains: the carboxy phosphate domain 1, the oligomerisation domain, the carbamoyl phosphate domain 2 and the allosteric domain []. CPSase heterodimers from Escherichia coli contain two molecular tunnels: an ammonia tunnel and a carbamate tunnel. These inter-domain tunnels connect the three distinct active sites, and function as conduits for the transport of unstable reaction intermediates (ammonia and carbamate) between successive active sites []. The catalytic mechanism of CPSase involves the diffusion of carbamate through the interior of the enzyme from the site of synthesis within the N-terminal domain of the large subunit to the site of phosphorylation within the C-terminal domain. Eukaryotes have two distinct forms of CPSase: a mitochondrial enzyme (CPSase I) that participates in both arginine biosynthesis and the urea cycle; and a cytosolic enzyme (CPSase II) involved in pyrimidine biosynthesis. CPSase II occurs as part of a multi-enzyme complex along with aspartate transcarbamoylase and dihydroorotase; this complex is referred to as the CAD protein []. The hepatic expression of CPSase is transcriptionally regulated by glucocorticoids and/or cAMP []. There is a third form of the enzyme, CPSase III, found in fish, which uses glutamine as a nitrogen source instead of ammonia []. CPSase III is closely related to CPSase I, and is composed of a single polypeptide that may have arisen from gene fusion of the glutaminase and synthetase domains [].  This entry represents the ATP-binding domain found in the large subunit of carbamoyl phosphate synthase, as well as in related proteins.; GO: 0003824 catalytic activity, 0005524 ATP binding, 0008152 metabolic process; PDB: 3U9S_A 3U9T_A 2C00_B 2VQD_A 1W96_B 1W93_A 1M6V_C 1CS0_C 1C30_E 1C3O_G ....
Probab=45.36  E-value=22  Score=26.08  Aligned_cols=21  Identities=24%  Similarity=0.605  Sum_probs=17.7

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .|.|+|+++|++.|++..|..
T Consensus        25 ~~~eea~~~a~~iGyPVliKa   45 (211)
T PF02786_consen   25 SSVEEALEFAEEIGYPVLIKA   45 (211)
T ss_dssp             SSHHHHHHHHHHH-SSEEEEE
T ss_pred             CCHHHHHHHHHhcCCceEEee
Confidence            689999999999999987754


No 58 
>cd01206 Homer Homer type EVH1 domain. Homer type EVH1 domain. Homer is a synaptic scaffolding protein, involved in neuronal signaling. It contains an  EVH1 domain, which binds to both neurotransmitter receptors, such as the metabotropic glutamate receptor (mGluR) and to other scaffolding proteins via PPXXF motifs, in order to target them to the synaptic junction. It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=44.96  E-value=21  Score=24.69  Aligned_cols=23  Identities=26%  Similarity=0.538  Sum_probs=18.3

Q ss_pred             CCCCC-ce-eeecCCHHHHHHHHHH
Q psy627           32 GDPLS-NL-ALNFSSKEDAIQYCQK   54 (89)
Q Consensus        32 ~D~~~-qv-~l~F~s~e~Aiayae~   54 (89)
                      .|+.. +| .|.|.|+|||-.|+++
T Consensus        78 rD~R~~tVyGLnF~Sk~ea~~F~~~  102 (111)
T cd01206          78 ADSRANTVYGLGFSSEQQLTKFAEK  102 (111)
T ss_pred             cccccceeeecccCCHHHHHHHHHH
Confidence            36663 33 7999999999999875


No 59 
>KOG0081|consensus
Probab=44.60  E-value=19  Score=27.14  Aligned_cols=22  Identities=23%  Similarity=0.400  Sum_probs=18.2

Q ss_pred             cCCHHHHHHHHHHcCccEEEec
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      --|.+.|++.|++.|++|.-..
T Consensus       141 ~Vs~~qa~~La~kyglPYfETS  162 (219)
T KOG0081|consen  141 VVSEDQAAALADKYGLPYFETS  162 (219)
T ss_pred             hhhHHHHHHHHHHhCCCeeeec
Confidence            3478999999999999996443


No 60 
>PF05637 Glyco_transf_34:  galactosyl transferase GMA12/MNN10 family;  InterPro: IPR008630 This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of Caenorhabditis elegans homologues where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.; GO: 0016758 transferase activity, transferring hexosyl groups, 0016021 integral to membrane; PDB: 2P72_B 2P73_A 2P6W_A.
Probab=44.59  E-value=15  Score=27.41  Aligned_cols=18  Identities=11%  Similarity=0.676  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHcCccEEEe
Q psy627           45 KEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~   62 (89)
                      .+-=+.||++||++|.+.
T Consensus        30 ~~Nr~~Ya~~HgY~~~~~   47 (239)
T PF05637_consen   30 IQNRVDYARRHGYDLYYR   47 (239)
T ss_dssp             ---HHHHHHHHT-EEEEE
T ss_pred             HHHHHHHHHhcCCEEEEE
Confidence            334468999999999984


No 61 
>PRK00910 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional
Probab=44.47  E-value=21  Score=27.02  Aligned_cols=20  Identities=5%  Similarity=0.214  Sum_probs=17.4

Q ss_pred             cCCHHHHHHHHHHcCccEEE
Q psy627           42 FSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V   61 (89)
                      ..+++++++||++||+++.-
T Consensus       183 ma~~~~l~~fA~~h~l~~is  202 (218)
T PRK00910        183 MAKTPEIIAFGKLHNMPVLT  202 (218)
T ss_pred             cCCHHHHHHHHHHcCCcEEE
Confidence            56899999999999999843


No 62 
>PF07014 Hs1pro-1_C:  Hs1pro-1 protein C-terminus;  InterPro: IPR009743 This entry represents the C terminus (approximately 270 residues) of a number of plant Hs1pro-1 proteins, which are believed to confer nematode resistance [].
Probab=44.33  E-value=9.1  Score=29.79  Aligned_cols=23  Identities=26%  Similarity=0.381  Sum_probs=19.9

Q ss_pred             CCCCCCCCcee---eecCCHHHHHHH
Q psy627           29 CSTGDPLSNLA---LNFSSKEDAIQY   51 (89)
Q Consensus        29 tss~D~~~qv~---l~F~s~e~Aiay   51 (89)
                      ++++|+++|+-   -+|+|+++|--|
T Consensus       228 ~~~~D~Lsq~flEPtYfPSLDaAKTF  253 (261)
T PF07014_consen  228 IESADSLSQIFLEPTYFPSLDAAKTF  253 (261)
T ss_pred             ccccchHHHHhcCCCCCCchhHHHHH
Confidence            57799999985   579999999887


No 63 
>PF00926 DHBP_synthase:  3,4-dihydroxy-2-butanone 4-phosphate synthase;  InterPro: IPR000422 3,4-dihydroxy-2-butanone 4-phosphate synthase (4.1.99.12 from EC) (DHBP synthase) (RibB) catalyses the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate, the latter serving as the biosynthetic precursor for the xylene ring of riboflavin []. In Photobacterium leiognathi, the riboflavin synthesis genes ribB (DHBP synthase), ribE (riboflavin synthase), ribH (lumazone synthase) and ribA (GTP cyclohydrolase II) all reside in the lux operon []. RibB is sometimes found as a bifunctional enzyme with GTP cyclohydrolase II that catalyses the first committed step in the biosynthesis of riboflavin (IPR000926 from INTERPRO). No sequences with significant homology to DHBP synthase are found in the metazoa.; GO: 0008686 3,4-dihydroxy-2-butanone-4-phosphate synthase activity, 0009231 riboflavin biosynthetic process; PDB: 1K4O_A 1K4L_A 1K4P_A 1K49_A 1K4I_A 1TKU_A 1TKS_B 2RIS_A 2RIU_A 3MIO_A ....
Probab=44.18  E-value=22  Score=26.32  Aligned_cols=20  Identities=10%  Similarity=0.423  Sum_probs=16.0

Q ss_pred             cCCHHHHHHHHHHcCccEEE
Q psy627           42 FSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V   61 (89)
                      -.+++++.+||++||+++.-
T Consensus       167 ~~~~~~~~~fA~~~~l~~vs  186 (194)
T PF00926_consen  167 MARRDELEEFAKKHGLPIVS  186 (194)
T ss_dssp             BHCHHHHHHHHHHTT-EEEE
T ss_pred             cCCHHHHHHHHHHcCCcEEE
Confidence            35789999999999998753


No 64 
>KOG0855|consensus
Probab=43.99  E-value=19  Score=27.16  Aligned_cols=30  Identities=7%  Similarity=0.125  Sum_probs=26.3

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEeccCCC
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEEPKWK   67 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~p~~~   67 (89)
                      +.|+|++-.+--+|+-+++++|.+.....+
T Consensus       128 ~GlS~D~s~sqKaF~sKqnlPYhLLSDpk~  157 (211)
T KOG0855|consen  128 IGLSGDDSASQKAFASKQNLPYHLLSDPKN  157 (211)
T ss_pred             EeeccCchHHHHHhhhhccCCeeeecCcch
Confidence            579999999999999999999999875443


No 65 
>PRK00823 phhB pterin-4-alpha-carbinolamine dehydratase; Validated
Probab=43.84  E-value=28  Score=22.49  Aligned_cols=34  Identities=21%  Similarity=0.421  Sum_probs=25.7

Q ss_pred             CCCCCCCCCCCCC-CceeeecCCHHHHHHHHHHcC
Q psy627           23 NPLMGWCSTGDPL-SNLALNFSSKEDAIQYCQKNG   56 (89)
Q Consensus        23 dPLMGWtss~D~~-~qv~l~F~s~e~Aiayae~~G   56 (89)
                      ..|-||.-..|+. -.-...|++-.+|++|+.+-+
T Consensus        16 ~~l~gW~~~~~~~~l~r~f~f~~f~~a~~f~~~Va   50 (97)
T PRK00823         16 PQLPGWTLVGDRDAIERTFKFKNFNEAFAFMNRVA   50 (97)
T ss_pred             hcCCCCeEeCCcCeEEEEEEeCCHHHHHHHHHHHH
Confidence            4577999887753 334688999999999987644


No 66 
>PF00764 Arginosuc_synth:  Arginosuccinate synthase;  InterPro: IPR001518 Argininosuccinate synthase (6.3.4.5 from EC) (AS) is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate [, ]. In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterised by severe vomiting spells and mental retardation. AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity.; GO: 0004055 argininosuccinate synthase activity, 0005524 ATP binding, 0006526 arginine biosynthetic process; PDB: 1K97_A 1KP2_A 1K92_A 1KP3_A 2NZ2_A 1VL2_A 1J1Z_D 1KOR_C 1J20_D 1KH2_C ....
Probab=43.37  E-value=13  Score=30.29  Aligned_cols=17  Identities=35%  Similarity=0.643  Sum_probs=12.4

Q ss_pred             HHHHHHHHHHcCccEEE
Q psy627           45 KEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V   61 (89)
                      +|+.|+||+++||+..+
T Consensus       147 R~~~i~ya~~~gIpv~~  163 (388)
T PF00764_consen  147 REEEIEYAKKHGIPVPV  163 (388)
T ss_dssp             HHHHHHHHHHTT----S
T ss_pred             HHHHHHHHHHcCCCCCC
Confidence            99999999999998654


No 67 
>PRK13820 argininosuccinate synthase; Provisional
Probab=42.55  E-value=17  Score=29.57  Aligned_cols=18  Identities=28%  Similarity=0.446  Sum_probs=16.5

Q ss_pred             CHHHHHHHHHHcCccEEE
Q psy627           44 SKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V   61 (89)
                      |+++-++||+++|+++.+
T Consensus       148 tK~ei~~ya~~~gip~~~  165 (394)
T PRK13820        148 TREWEIEYAKEKGIPVPV  165 (394)
T ss_pred             CHHHHHHHHHHcCCCCCc
Confidence            999999999999999853


No 68 
>smart00757 CRA CT11-RanBPM. protein-protein interaction domain present in crown eukaryotes (plants, animals, fungi)
Probab=42.28  E-value=20  Score=22.14  Aligned_cols=17  Identities=24%  Similarity=0.264  Sum_probs=13.4

Q ss_pred             CHHHHHHHHHHcCccEE
Q psy627           44 SKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~   60 (89)
                      +.++||.||+++=-+|.
T Consensus         2 ~~~eAi~yar~~l~~~~   18 (99)
T smart00757        2 KIEEALAYARELLAPFA   18 (99)
T ss_pred             cHHHHHHHHHHHHhhhc
Confidence            46899999998866654


No 69 
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase. The Argininosuccinate synthase is a urea cycle enzyme that catalyzes the penultimate step in arginine biosynthesis: the ATP-dependent ligation of citrulline to aspartate to form argininosuccinate, AMP and pyrophosphate .  In humans, a defect in the AS gene causes citrullinemia, a genetic disease characterized by severe vomiting spells and mental retardation. AS is a homotetrameric enzyme of chains of about 400 amino-acid residues. An arginine seems to be important for the enzyme's catalytic mechanism. The sequences of AS from various prokaryotes, archaebacteria and eukaryotes show significant similarity
Probab=42.25  E-value=20  Score=28.96  Aligned_cols=20  Identities=35%  Similarity=0.635  Sum_probs=17.8

Q ss_pred             cCCHHHHHHHHHHcCccEEE
Q psy627           42 FSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V   61 (89)
                      +-|+++-++||+++|+++..
T Consensus       146 ~~sr~ev~~~A~~~Gip~~~  165 (385)
T cd01999         146 FLSREEEIEYAEEHGIPVPV  165 (385)
T ss_pred             cCCHHHHHHHHHHcCCCCcc
Confidence            56999999999999998754


No 70 
>smart00481 POLIIIAc DNA polymerase alpha chain like domain. DNA polymerase alpha chain like domain, incl. family of hypothetical proteins
Probab=42.15  E-value=40  Score=19.58  Aligned_cols=24  Identities=17%  Similarity=0.122  Sum_probs=20.7

Q ss_pred             CCHHHHHHHHHHcCccEEEeccCC
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~~   66 (89)
                      .+.++.|+.|+++|++......+.
T Consensus        15 ~~~~~~~~~a~~~g~~~v~iTDh~   38 (67)
T smart00481       15 LSPEELVKRAKELGLKAIAITDHG   38 (67)
T ss_pred             CCHHHHHHHHHHcCCCEEEEeeCC
Confidence            368999999999999998877664


No 71 
>PF00076 RRM_1:  RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain);  InterPro: IPR000504 Many eukaryotic proteins containing one or more copies of a putative RNA-binding domain of about 90 amino acids are known to bind single-stranded RNAs [, , ]. The largest group of single strand RNA-binding proteins is the eukaryotic RNA recognition motif (RRM) family that contains an eight amino acid RNP-1 consensus sequence [, ]. RRM proteins have a variety of RNA binding preferences and functions, and include heterogeneous nuclear ribonucleoproteins (hnRNPs), proteins implicated in regulation of alternative splicing (SR, U2AF, Sxl), protein components of small nuclear ribonucleoproteins (U1 and U2 snRNPs), and proteins that regulate RNA stability and translation (PABP, La, Hu) [, , ]. The RRM in heterodimeric splicing factor U2 snRNP auxiliary factor (U2AF) appears to have two RRM-like domains with specialised features for protein recognition []. The motif also appears in a few single stranded DNA binding proteins. The typical RRM consists of four anti-parallel beta-strands and two alpha-helices arranged in a beta-alpha-beta-beta-alpha-beta fold with side chains that stack with RNA bases. Specificity of RNA binding is determined by multiple contacts with surrounding amino acids. A third helix is present during RNA binding in some cases []. The RRM is reviewed in a number of publications [, , ].; GO: 0003676 nucleic acid binding; PDB: 2RNE_A 2DGO_A 2DO4_A 1YTY_B 2VOO_B 2VOP_A 2VON_B 1ZH5_B 2VOD_A 1S79_A ....
Probab=42.11  E-value=33  Score=19.03  Aligned_cols=20  Identities=35%  Similarity=0.370  Sum_probs=16.4

Q ss_pred             eeeecCCHHHHHHHHH-HcCc
Q psy627           38 LALNFSSKEDAIQYCQ-KNGW   57 (89)
Q Consensus        38 v~l~F~s~e~Aiayae-~~G~   57 (89)
                      .-+.|.+.++|....+ -+|.
T Consensus        42 a~V~F~~~~~a~~a~~~l~g~   62 (70)
T PF00076_consen   42 AFVEFESEEDAEKALEELNGK   62 (70)
T ss_dssp             EEEEESSHHHHHHHHHHHTTE
T ss_pred             EEEEEcCHHHHHHHHHHcCCC
Confidence            4699999999999888 5663


No 72 
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain. Some members show domain architectures similar to that of E. coli DipZ protein (also known as DsbD). The only eukaryotic members of the TlpA family belong to this subfamily. TlpA is a disulfide reductase known to have a crucial role in the biogenesis of cytochrome aa3.
Probab=42.08  E-value=27  Score=22.49  Aligned_cols=43  Identities=5%  Similarity=-0.043  Sum_probs=27.5

Q ss_pred             CCHHHHHHHHHHcCccEEEeccCCC----CCCcccccccCCcCCCcc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPKWK----TPKVKSYAFNFSWNKRTR   85 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~~~----~~~~ksYadNF~~~r~~~   85 (89)
                      ++.++..+|++++|+.|.+......    .......-..|..++..+
T Consensus        71 ~~~~~~~~~~~~~~~~~p~~~D~~~~~~~~~~v~~~P~~~vid~~G~  117 (126)
T cd03012          71 RDLANVKSAVLRYGITYPVANDNDYATWRAYGNQYWPALYLIDPTGN  117 (126)
T ss_pred             cCHHHHHHHHHHcCCCCCEEECCchHHHHHhCCCcCCeEEEECCCCc
Confidence            4688999999999999987664321    123333444555554443


No 73 
>KOG2741|consensus
Probab=41.92  E-value=19  Score=29.25  Aligned_cols=21  Identities=24%  Similarity=0.275  Sum_probs=17.6

Q ss_pred             eeeecCCHHHHHHHHHHcCcc
Q psy627           38 LALNFSSKEDAIQYCQKNGWK   58 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~   58 (89)
                      |.+.=+|.|-|++||++|+|+
T Consensus        36 vava~~s~~~A~~fAq~~~~~   56 (351)
T KOG2741|consen   36 VAVADPSLERAKEFAQRHNIP   56 (351)
T ss_pred             EEEecccHHHHHHHHHhcCCC
Confidence            345567999999999999994


No 74 
>PRK00014 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional
Probab=41.76  E-value=25  Score=26.95  Aligned_cols=19  Identities=16%  Similarity=0.232  Sum_probs=16.9

Q ss_pred             cCCHHHHHHHHHHcCccEE
Q psy627           42 FSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~   60 (89)
                      ..+++++++||++||+++.
T Consensus       187 ma~~~~l~~fA~~~~l~ii  205 (230)
T PRK00014        187 MMRGASLERYAAKEGLVAL  205 (230)
T ss_pred             ccCHHHHHHHHHHcCCcEE
Confidence            4679999999999999984


No 75 
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed
Probab=41.51  E-value=36  Score=26.17  Aligned_cols=31  Identities=16%  Similarity=0.157  Sum_probs=26.5

Q ss_pred             CCceeeecCCHHHHHHHHHHcCccEEEeccC
Q psy627           35 LSNLALNFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        35 ~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      -.+|.+-+.++++|-++|+++||++.+..++
T Consensus       116 ~~~i~~visn~~~~~~lA~~~gIp~~~~~~~  146 (286)
T PRK06027        116 PVEIAAVISNHDDLRSLVERFGIPFHHVPVT  146 (286)
T ss_pred             CcEEEEEEEcChhHHHHHHHhCCCEEEeccC
Confidence            3568888899999999999999999886654


No 76 
>COG4314 NosL Predicted lipoprotein involved in nitrous oxide reduction [Energy production and conversion]
Probab=41.50  E-value=21  Score=26.44  Aligned_cols=23  Identities=35%  Similarity=0.521  Sum_probs=19.4

Q ss_pred             eeeecCCHHHHHHHHHHcCccEE
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~   60 (89)
                      .-+-|.++|+|.+||.++|=...
T Consensus       129 ~A~pF~~e~aA~~faa~~GGrvl  151 (176)
T COG4314         129 LASPFSDEEAAERFAADNGGRVL  151 (176)
T ss_pred             hcccccCHHHHHHHHHhcCCeEE
Confidence            45669999999999999997653


No 77 
>PRK11118 putative monooxygenase; Provisional
Probab=41.31  E-value=36  Score=23.11  Aligned_cols=28  Identities=14%  Similarity=0.252  Sum_probs=21.3

Q ss_pred             CCCCCCCCCc-eeeecCCHHHHHHHHHHc
Q psy627           28 WCSTGDPLSN-LALNFSSKEDAIQYCQKN   55 (89)
Q Consensus        28 Wtss~D~~~q-v~l~F~s~e~Aiayae~~   55 (89)
                      ||.+.++..- =-.-|++.++|-+|.+.|
T Consensus        41 WTen~~t~eaGGiYlF~~e~~a~aYl~mH   69 (100)
T PRK11118         41 WTENEKTQEAGGIYLFEDEASAEAYLEMH   69 (100)
T ss_pred             eecCCCCcccceEEEECCHHHHHHHHHHH
Confidence            7777776533 245689999999999876


No 78 
>cd06576 PASTA_Pbp2x-like_1 PASTA domain of PBP2x-like proteins, first repeat. Penicillin-binding proteins (PBPs) are the major targets for beta-lactam antibiotics, like penicillins and cephalosporins. Beta-lactam antibiotics specifically inhibit transpeptidase activity by acylating the active site serine. PBPs catalyze key steps in the synthesis of the peptidoglycan, such as the interconnecting of glycan chains (polymers of N-glucosamine and N-acetylmuramic acid residues) and the cross-linking (transpeptidation) of short stem peptides, which are connected to glycan chains. Peptidoglycan is essential in cell division and protects bacteria from osmotic shock and lysis. PBP2x is one of the two monofunctional high molecular mass PBPs in Streptococcus pneumoniae and has been seen as the primary PBP target in beta-lactam-resistant strains. The PASTA domain is found at the C-termini of several PBPs and bacterial serine/threonine kinases. The name PASTA is derived from PBP and Serine/Threonine
Probab=39.65  E-value=51  Score=17.64  Aligned_cols=22  Identities=23%  Similarity=0.148  Sum_probs=18.6

Q ss_pred             CCHHHHHHHHHHcCccEEEecc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .+.++|.+.+++.|+.+++..+
T Consensus         8 ~~~~~a~~~l~~~g~~~~~~~~   29 (55)
T cd06576           8 KSVEEAKKELKEAGLQPVVIGN   29 (55)
T ss_pred             CCHHHHHHHHHHCCCEEEEeCC
Confidence            4789999999999999977653


No 79 
>PF03960 ArsC:  ArsC family;  InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite []. This system transports arsenite and antimonite out of the cell. The pump is composed of two polypeptides, the products of the arsA and arsB genes. This two-subunit enzyme produces resistance to arsenite and antimonite. Arsenate, however, must first be reduced to arsenite before it is extruded. A third gene, arsC, expands the substrate specificity to allow for arsenate pumping and resistance. ArsC is an approximately 150-residue arsenate reductase that uses reduced glutathione (GSH) to convert arsenate to arsenite with a redox active cysteine residue in the active site. ArsC forms an active quaternary complex with GSH, arsenate, and glutaredoxin 1 (Grx1). The three ligands must be present simultaneously for reduction to occur []. The arsC family also comprises the Spx proteins which are GRAM-positive bacterial transcription factors that regulate the transcription of multiple genes in response to disulphide stress []. The arsC protein structure has been solved []. It belongs to the thioredoxin superfamily fold which is defined by a beta-sheet core surrounded by alpha-helices. The active cysteine residue of ArsC is located in the loop between the first beta-strand and the first helix, which is also conserved in the Spx protein and its homologues.; PDB: 2KOK_A 1SK1_A 1SK2_A 1JZW_A 1J9B_A 1S3C_A 1SD8_A 1SD9_A 1I9D_A 1SK0_A ....
Probab=39.63  E-value=26  Score=22.61  Aligned_cols=21  Identities=14%  Similarity=0.316  Sum_probs=15.8

Q ss_pred             CHHHHHHHHHHcCccEEEecc
Q psy627           44 SKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      |...|+++.+.+|++|++..=
T Consensus         8 t~rka~~~L~~~gi~~~~~d~   28 (110)
T PF03960_consen    8 TCRKALKWLEENGIEYEFIDY   28 (110)
T ss_dssp             HHHHHHHHHHHTT--EEEEET
T ss_pred             HHHHHHHHHHHcCCCeEeehh
Confidence            456799999999999998763


No 80 
>PTZ00056 glutathione peroxidase; Provisional
Probab=39.49  E-value=31  Score=24.83  Aligned_cols=21  Identities=24%  Similarity=0.302  Sum_probs=18.8

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      ++.|++.+|++++|+.|.|..
T Consensus        89 d~~e~~~~f~~~~~~~fpvl~  109 (199)
T PTZ00056         89 PNTKDIRKFNDKNKIKYNFFE  109 (199)
T ss_pred             CCHHHHHHHHHHcCCCceeee
Confidence            688999999999999999853


No 81 
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain. ThrRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=39.28  E-value=45  Score=19.81  Aligned_cols=24  Identities=8%  Similarity=-0.021  Sum_probs=19.8

Q ss_pred             ecCCHHHHHHHHHHcCccEEEecc
Q psy627           41 NFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .=.+....+.||++.|++|.|.-.
T Consensus        36 ~~~~~~~~~~~a~~~g~~~~iiig   59 (91)
T cd00860          36 RNEKLGKKIREAQLQKIPYILVVG   59 (91)
T ss_pred             CCCCHHHHHHHHHHcCCCEEEEEC
Confidence            346788999999999999988664


No 82 
>PF03795 YCII:  YCII-related domain;  InterPro: IPR005545 The majority of proteins in this group contain a single copy of this domain, though it is also found as a repeat (e.g. in Q9AJZ7 from SWISSPROT). A strongly conserved histidine and a aspartate suggest that the domain has an enzymatic function. This entry also covers what was previously known as the DGPF domain (COG3795). Although its function is unknown it is found fused to a sigma-70 factor family domain in Q9A8M4 from SWISSPROT, suggesting that this domain may plays a role in transcription initiation. This domain is named after the most conserved motif in the alignment.; PDB: 1S7I_A 1MWQ_A.
Probab=39.24  E-value=21  Score=22.01  Aligned_cols=17  Identities=18%  Similarity=0.348  Sum_probs=14.9

Q ss_pred             eeeecCCHHHHHHHHHH
Q psy627           38 LALNFSSKEDAIQYCQK   54 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~   54 (89)
                      +-+..+|+|+|+++|++
T Consensus        61 ~i~~a~s~e~A~~~~~~   77 (95)
T PF03795_consen   61 IIVEAESREEAEEIAKE   77 (95)
T ss_dssp             EEEEESSHHHHHHHHCT
T ss_pred             EEEEeCCHHHHHHHHHh
Confidence            47899999999999875


No 83 
>cd07202 cPLA2_Grp-IVC Group IVC cytoplasmic phospholipase A2; catalytic domain; Ca-independent. Group IVC cPLA2, a small 61 kDa protein, is a single domain alpha/beta hydrolase. It lacks a C2 domain; therefore, it has no Ca-dependence. Group IVC cPLA2 is also referred to as cPLA2-gamma. The cPLA2-gamma enzyme is predominantly found in cardiac and skeletal muscles, and to a lesser extent in the brain. Human cPLA2-gamma is approximately 30% identical to cPLA2-alpha. The catalytic domain of cytosolic phospholipase A2 (PLA2; EC 3.1.1.4) hydrolyzes the sn-2-acyl ester bond of phospholipids to release arachidonic acid. At the active site, cPLA2 contains a serine nucleophile through which the catalytic mechanism is initiated. The active site is partially covered by a solvent-accessible flexible lid. cPLA2 displays interfacial activation as it exists in both "closed lid" and "open lid" forms. Movement of the cPLA2 lid possibly exposes a greater hydrophobic surface and the active site. cPLA2 be
Probab=39.02  E-value=15  Score=30.53  Aligned_cols=22  Identities=27%  Similarity=0.602  Sum_probs=17.7

Q ss_pred             cCCHHHHHHHHHHcCccEEEec
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      |.+...|-+||++|||+|-=++
T Consensus       321 f~~l~~~~~~c~~~~ipfp~i~  342 (430)
T cd07202         321 FETIKDTAEYCRKHNIPFPQVD  342 (430)
T ss_pred             hHHHHHHHHHHHHcCCCCCCcC
Confidence            5577899999999999994333


No 84 
>PF14657 Integrase_AP2:  AP2-like DNA-binding integrase domain
Probab=38.72  E-value=28  Score=19.42  Aligned_cols=19  Identities=21%  Similarity=0.242  Sum_probs=15.1

Q ss_pred             Cceeee-cCCHHHHHHHHHH
Q psy627           36 SNLALN-FSSKEDAIQYCQK   54 (89)
Q Consensus        36 ~qv~l~-F~s~e~Aiayae~   54 (89)
                      .++.-+ |.|+.||.+++.+
T Consensus        17 k~~~k~GF~TkkeA~~~~~~   36 (46)
T PF14657_consen   17 KQKTKRGFKTKKEAEKALAK   36 (46)
T ss_pred             EEEEcCCCCcHHHHHHHHHH
Confidence            345556 9999999999875


No 85 
>PF00331 Glyco_hydro_10:  Glycosyl hydrolase family 10;  InterPro: IPR001000 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 10 GH10 from CAZY comprises enzymes with a number of known activities; xylanase (3.2.1.8 from EC); endo-1,3-beta-xylanase (3.2.1.32 from EC); cellobiohydrolase (3.2.1.91 from EC). These enzymes were formerly known as cellulase family F.  The microbial degradation of cellulose and xylans requires several types of enzymes such as endoglucanases (3.2.1.4 from EC), cellobiohydrolases (3.2.1.91 from EC) (exoglucanases), or xylanases (3.2.1.8 from EC) [, ]. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family F [] or as the glycosyl hydrolases family 10 []. ; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1UQZ_A 1UQY_A 1UR2_A 1UR1_A 2CNC_A 1OD8_A 1E0W_A 1E0V_A 1V0M_A 1E0X_B ....
Probab=38.61  E-value=20  Score=27.72  Aligned_cols=22  Identities=27%  Similarity=0.539  Sum_probs=18.7

Q ss_pred             eeecCCHHHHHHHHHHcCccEE
Q psy627           39 ALNFSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y~   60 (89)
                      ++.|.+.++.++||+++|+...
T Consensus        55 ~~~~~~~D~~~~~a~~~g~~vr   76 (320)
T PF00331_consen   55 RFNFESADAILDWARENGIKVR   76 (320)
T ss_dssp             BEE-HHHHHHHHHHHHTT-EEE
T ss_pred             ccCccchhHHHHHHHhcCccee
Confidence            7899999999999999999986


No 86 
>PRK08179 prfH peptide chain release factor-like protein; Reviewed
Probab=38.60  E-value=25  Score=26.24  Aligned_cols=17  Identities=18%  Similarity=0.303  Sum_probs=14.6

Q ss_pred             HHHHHHcCccEEEeccC
Q psy627           49 IQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        49 iayae~~G~~Y~V~~p~   65 (89)
                      +.||+++||.++|.+-.
T Consensus        27 ~~~a~~~g~~~~ii~~~   43 (200)
T PRK08179         27 LKEAARQGVRVTVLETE   43 (200)
T ss_pred             HHHHHHcCCeEEEEeCC
Confidence            57999999999998743


No 87 
>KOG0097|consensus
Probab=38.51  E-value=25  Score=26.13  Aligned_cols=17  Identities=29%  Similarity=0.657  Sum_probs=15.0

Q ss_pred             CHHHHHHHHHHcCccEE
Q psy627           44 SKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~   60 (89)
                      +-|+|-+|||.||+-|-
T Consensus       135 ~yeeak~faeengl~fl  151 (215)
T KOG0097|consen  135 TYEEAKEFAEENGLMFL  151 (215)
T ss_pred             cHHHHHHHHhhcCeEEE
Confidence            56899999999999874


No 88 
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions.  GRX is a glutathione (GSH) dependent reductase containing a redox active CXXC motif in a TRX fold. It has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. By altering the redox state of target proteins, GRX is involved in many cellular functions.
Probab=38.45  E-value=40  Score=19.79  Aligned_cols=24  Identities=4%  Similarity=0.066  Sum_probs=20.0

Q ss_pred             cCCHHHHHHHHHHcCccEEEeccC
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      .+....|..+.+++|++|++..-.
T Consensus        11 C~~C~ka~~~L~~~gi~~~~~di~   34 (73)
T cd03027          11 CEDCTAVRLFLREKGLPYVEINID   34 (73)
T ss_pred             ChhHHHHHHHHHHCCCceEEEECC
Confidence            356788999999999999987643


No 89 
>COG5453 Uncharacterized conserved protein [Function unknown]
Probab=38.39  E-value=21  Score=24.06  Aligned_cols=18  Identities=33%  Similarity=0.536  Sum_probs=16.0

Q ss_pred             ecCCHHHHHHHHHHcCcc
Q psy627           41 NFSSKEDAIQYCQKNGWK   58 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~   58 (89)
                      .|.+++|||+++-+.|.-
T Consensus        68 ~ft~~~DAve~~lkKg~q   85 (96)
T COG5453          68 LFTSLDDAVEIALKKGRQ   85 (96)
T ss_pred             hccchhHHHHHHHHHHHH
Confidence            589999999999998865


No 90 
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX), through a single catalytic cysteine. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases. Spx is a general regulator that exerts negative and positive control over transcription initiation by binding to the C-terminal domain of the alpha subunit of RNA polymerase.
Probab=38.38  E-value=29  Score=22.02  Aligned_cols=22  Identities=14%  Similarity=0.314  Sum_probs=18.4

Q ss_pred             CCHHHHHHHHHHcCccEEEecc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ++...|.+|.+.+|++|++..-
T Consensus        10 ~~c~ka~~~L~~~~i~~~~idi   31 (105)
T cd02977          10 STSRKALAWLEEHGIEYEFIDY   31 (105)
T ss_pred             HHHHHHHHHHHHcCCCcEEEee
Confidence            3567899999999999988764


No 91 
>cd07238 Glo_EDI_BRP_like_5 This conserved domain belongs to a superfamily including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. This protein family belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. A bound metal ion is required for protein activities for the members of this superfamily. A variety of metal ions have been found in the catalytic centers of these proteins including Fe(II), Mn(II), Zn(II), Ni(II) and Mg(II). The protein superfamily contains members with or without domain swapping. The structure of this family is a that of a strand-swapped dimer.
Probab=37.74  E-value=76  Score=19.29  Aligned_cols=26  Identities=12%  Similarity=0.316  Sum_probs=22.3

Q ss_pred             CceeeecCCHHHHHHHHHHcCccEEE
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y~V   61 (89)
                      ..+.+.-++.+++++.+++.|+.+..
T Consensus        59 ~~i~~~v~d~~~~~~~l~~~G~~~~~   84 (112)
T cd07238          59 PDLSIEVDDVDAALARAVAAGFAIVY   84 (112)
T ss_pred             CEEEEEeCCHHHHHHHHHhcCCeEec
Confidence            46788889999999999999998653


No 92 
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs. Members of this group contain a CXXC motif, similar to TRX. The second cysteine in the motif corresponds to the peroxidatic cysteine of PRX, however, these proteins do not contain the other two residues of the catalytic triad of PRX. PRXs confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. TRXs alter the redox state of target proteins by catalyzing the reduction of their disulfide bonds via the CXXC motif using reducing equivalents derived from either NADPH or ferredoxins.
Probab=37.50  E-value=55  Score=21.00  Aligned_cols=28  Identities=18%  Similarity=0.045  Sum_probs=23.4

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEeccC
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      |.+..++.+++.+|+++++++|.|....
T Consensus        61 v~V~~~~~~~~~~~~~~~~~~~p~~~D~   88 (149)
T cd02970          61 VAVGPESPEKLEAFDKGKFLPFPVYADP   88 (149)
T ss_pred             EEEeCCCHHHHHHHHHhcCCCCeEEECC
Confidence            4677888888999999999999887643


No 93 
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain. PP2A-like family of phosphoprotein phosphatases (PPP's) including PP4 and PP6.  PP2A (Protein phosphatase 2A) is a critical regulator of many cellular activities.  PP2A comprises about 1% of total cellular proteins.  PP2A, together with protein phosphatase 1 (PP1), accounts for more than 90% of all serine/threonine phosphatase activities in most cells and tissues. The PP2A subunit  in addition to having a catalytic domain homologous to PP1, has a unique C-terminal tail, containing a motif that is conserved in the catalytic subunits of all PP2A-like phosphatases including PP4 and PP6, and has an important role in PP2A regulation.  The PP2A-like family of phosphatases all share a similar heterotrimeric architecture, that includes: a 65kDa scaffolding subunit (A), a 36kDa catalytic subunit (C), and one of 18 regulatory subunits (B).  The PPP (phosphoprotein phosphatase) family, to which PP2
Probab=37.38  E-value=67  Score=24.74  Aligned_cols=26  Identities=12%  Similarity=0.296  Sum_probs=21.1

Q ss_pred             ceeeecCCHHHHHHHHHHcCccEEEec
Q psy627           37 NLALNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .....|. .+++.+|++++|+.+.|..
T Consensus       207 g~g~~fg-~~~~~~Fl~~n~l~~iiR~  232 (285)
T cd07415         207 GAGYLFG-QDVVEEFNHNNGLTLICRA  232 (285)
T ss_pred             CCccccC-HHHHHHHHHHCCCeEEEEc
Confidence            3455665 7899999999999999865


No 94 
>PF14542 Acetyltransf_CG:  GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A.
Probab=36.99  E-value=33  Score=21.25  Aligned_cols=18  Identities=33%  Similarity=0.554  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHcCccEEEe
Q psy627           45 KEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~   62 (89)
                      .++|++||+++|+.....
T Consensus        44 ~~~~l~~a~~~~~kv~p~   61 (78)
T PF14542_consen   44 VEAALDYARENGLKVVPT   61 (78)
T ss_dssp             HHHHHHHHHHTT-EEEET
T ss_pred             HHHHHHHHHHCCCEEEEE
Confidence            378999999999986543


No 95 
>PF10009 DUF2252:  Uncharacterized protein conserved in bacteria (DUF2252);  InterPro: IPR018721 This domain has no known function.
Probab=36.87  E-value=25  Score=28.29  Aligned_cols=38  Identities=18%  Similarity=0.430  Sum_probs=24.8

Q ss_pred             CccCCCCCCCCCCCC------CCceeeecC----CHHHHHHHHHHcCc
Q psy627           20 RWENPLMGWCSTGDP------LSNLALNFS----SKEDAIQYCQKNGW   57 (89)
Q Consensus        20 ~~~dPLMGWtss~D~------~~qv~l~F~----s~e~Aiayae~~G~   57 (89)
                      .-.||++||++.++-      ++..+.+++    +.++.+.||+-.|+
T Consensus       288 ~~sD~~LG~~~~~g~~f~VRql~p~k~~~d~~~l~~~~~~~~a~~~g~  335 (385)
T PF10009_consen  288 AASDPFLGWVTIDGRDFYVRQLRPMKGSVDLEDLDPEELQDYARLCGR  335 (385)
T ss_pred             hcCCcccCceeeCCceEEEEECCCcCCCcChhhCCHHHHHHHHHHHHH
Confidence            345999999998762      122222222    67888888887765


No 96 
>PF07611 DUF1574:  Protein of unknown function (DUF1574);  InterPro: IPR011468 This is a family of hypothetical proteins found in Leptospira interrogans and other bacteria.
Probab=36.72  E-value=20  Score=28.82  Aligned_cols=27  Identities=22%  Similarity=0.219  Sum_probs=22.7

Q ss_pred             eecCCHHHHHHHHHHcCccEEEeccCC
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~p~~   66 (89)
                      +.|.-.|++++.||++||++.|.-|.-
T Consensus       249 ~q~~F~e~~L~~ake~~I~~vl~~P~V  275 (345)
T PF07611_consen  249 TQFFFLEKFLKLAKENGIPVVLWWPKV  275 (345)
T ss_pred             hHHHHHHHHHHHHHHcCCcEEEEEecc
Confidence            445568999999999999999988863


No 97 
>PF02811 PHP:  PHP domain;  InterPro: IPR004013 The PHP (Polymerase and Histidinol Phosphatase) domain is a putative phosphoesterase domain. This family is often associated with an N-terminal region IPR003141 from INTERPRO.; GO: 0003824 catalytic activity; PDB: 2WJE_A 3QY8_A 2WJD_A 2WJF_A 1PB0_B 1M68_A 1M65_A 3E38_B 2W9M_A 3E0F_A ....
Probab=36.27  E-value=40  Score=22.24  Aligned_cols=23  Identities=13%  Similarity=0.228  Sum_probs=21.0

Q ss_pred             CCHHHHHHHHHHcCccEEEeccC
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      .+.|+.|+.|+++|+......++
T Consensus        16 ~~~~e~v~~A~~~Gl~~i~iTDH   38 (175)
T PF02811_consen   16 DSPEEYVEQAKEKGLDAIAITDH   38 (175)
T ss_dssp             SSHHHHHHHHHHTTESEEEEEEE
T ss_pred             CCHHHHHHHHHHcCCCEEEEcCC
Confidence            48999999999999999888877


No 98 
>TIGR03798 ocin_TIGR03798 bacteriocin propeptide, TIGR03798 family. This model describes a conserved, fairly long (about 65 residue) propeptide region for a family of putative microcins, that is, bacteriocins of small size. Members of the seed alignment tend to have the Gly-Gly motif as the last two residues of the matched region. This is a cleavage site for a combination processing/export ABC transporter with a peptidase domain.
Probab=36.20  E-value=17  Score=21.80  Aligned_cols=22  Identities=23%  Similarity=0.453  Sum_probs=18.9

Q ss_pred             cCCHHHHHHHHHHcCccEEEec
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      ..+.++-|++|+.+|+.+...+
T Consensus        24 ~~~~e~~~~lA~~~Gf~ft~~e   45 (64)
T TIGR03798        24 AEDPEDRVAIAKEAGFEFTGED   45 (64)
T ss_pred             cCCHHHHHHHHHHcCCCCCHHH
Confidence            4789999999999999987654


No 99 
>PF11823 DUF3343:  Protein of unknown function (DUF3343);  InterPro: IPR021778  This family of proteins are functionally uncharacterised. This protein is found in bacteria and archaea. Proteins in this family are typically between 78 to 102 amino acids in length. 
Probab=36.11  E-value=48  Score=20.05  Aligned_cols=24  Identities=13%  Similarity=0.081  Sum_probs=19.1

Q ss_pred             eeecCCHHHHHHHHHHcCccEEEe
Q psy627           39 ALNFSSKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y~V~   62 (89)
                      ++.....|.+++..+++|+.|+=.
T Consensus        46 ~~~~~d~~~i~~~l~~~~i~~~~i   69 (73)
T PF11823_consen   46 RFEPEDLEKIKEILEENGIEYEGI   69 (73)
T ss_pred             EEChhhHHHHHHHHHHCCCCeeEE
Confidence            444477999999999999998643


No 100
>cd04438 DEP_dishevelled DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in dishevelled-like proteins.  Dishevelled-like proteins play a key role in the transduction of the Wnt signal from the cell surface to the nucleus, which in turn is an important regulatory pathway for cellular development and growth. They contain an N-terminal DIX domain, a central PDZ domain, and a C-terminal DEP domain.
Probab=35.92  E-value=45  Score=21.35  Aligned_cols=24  Identities=17%  Similarity=0.301  Sum_probs=19.4

Q ss_pred             cCCHHHHHHHHH---HcCccEEEeccC
Q psy627           42 FSSKEDAIQYCQ---KNGWKFFVEEPK   65 (89)
Q Consensus        42 F~s~e~Aiayae---~~G~~Y~V~~p~   65 (89)
                      ..|+++|+.||.   ++|+=+.|...+
T Consensus        46 ~~~R~eAv~~g~~Ll~~G~i~HV~~~h   72 (84)
T cd04438          46 LTDRREARKYASSLLKLGYIRHTVNKI   72 (84)
T ss_pred             CCCHHHHHHHHHHHHHCCcEEecCCCc
Confidence            479999999998   688888886543


No 101
>KOG0098|consensus
Probab=35.89  E-value=30  Score=26.44  Aligned_cols=18  Identities=28%  Similarity=0.560  Sum_probs=16.2

Q ss_pred             CCHHHHHHHHHHcCccEE
Q psy627           43 SSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~   60 (89)
                      =|+||-.+||+.||+-|-
T Consensus       129 Vs~EEGeaFA~ehgLifm  146 (216)
T KOG0098|consen  129 VSKEEGEAFAREHGLIFM  146 (216)
T ss_pred             ccHHHHHHHHHHcCceee
Confidence            478999999999999885


No 102
>PF01910 DUF77:  Domain of unknown function DUF77;  InterPro: IPR002767 This entry contains several hypothetical proteins of unknown function found in archaebacteria, eukaryotes and eubacteria. The structures of YBL001c from Saccharomyces cerevisiae and its homologue MTH1187 from the archaea Methanobacterium thermoautotrophicum have been determined []. These proteins have a ferredoxin-like alpha/beta sandwich structure with anti-parallel beta-sheets. Generally, they have two domains that form a single beta-sheet dimer, where two dimers pack sheet-to-sheet into a tetramer, some proteins having an extra C-terminal helix. ; PDB: 1LXJ_A 1YQH_A 2EKY_G 2EPI_A 1VK8_D 2IBO_C 1LXN_B.
Probab=35.87  E-value=34  Score=22.17  Aligned_cols=18  Identities=28%  Similarity=0.457  Sum_probs=15.9

Q ss_pred             HHHHHHHHHcCccEEEec
Q psy627           46 EDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        46 e~Aiayae~~G~~Y~V~~   63 (89)
                      .+||++.++.|++|+|-.
T Consensus        20 ~~~i~~i~~sgl~y~v~p   37 (92)
T PF01910_consen   20 AEAIEVIKESGLKYEVGP   37 (92)
T ss_dssp             HHHHHHHHTSSSEEEEET
T ss_pred             HHHHHHHHHcCCceEEcC
Confidence            689999999999999853


No 103
>PRK12354 carbamate kinase; Reviewed
Probab=35.75  E-value=32  Score=27.22  Aligned_cols=22  Identities=14%  Similarity=0.376  Sum_probs=19.0

Q ss_pred             ecCCHHHHHHHHHHcCccEEEe
Q psy627           41 NFSSKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y~V~   62 (89)
                      .|-|+|+|.+.++++||.+...
T Consensus       125 ~~y~~~~a~~~~~e~g~~~~~d  146 (307)
T PRK12354        125 PVYDEAEAERLAAEKGWTIKPD  146 (307)
T ss_pred             cccCHHHHHHHHHhcCCEEeec
Confidence            5889999999999999976554


No 104
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains. Included in this CD is the N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains as seen in the uncharacterized structure (pdb 2F06) of the Bt0572 protein from Bacteroides thetaiotaomicron and related ACT domains. These tandem ACT domain proteins belong to the superfamily of ACT regulatory domains.
Probab=35.37  E-value=58  Score=18.82  Aligned_cols=24  Identities=21%  Similarity=0.254  Sum_probs=20.6

Q ss_pred             CceeeecCCHHHHHHHHHHcCccE
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y   59 (89)
                      .-++|.+++.|.|++--+++|+..
T Consensus        41 ~~~rl~~~~~~~~~~~L~~~G~~v   64 (66)
T cd04908          41 GILRLIVSDPDKAKEALKEAGFAV   64 (66)
T ss_pred             CEEEEEECCHHHHHHHHHHCCCEE
Confidence            567899999999999999999764


No 105
>PF03129 HGTP_anticodon:  Anticodon binding domain;  InterPro: IPR004154 tRNA synthetases, or tRNA ligases are involved in protein synthesis. This domain is found in histidyl, glycyl, threonyl and prolyl tRNA synthetases [] it is probably the anticodon binding domain [].; GO: 0004812 aminoacyl-tRNA ligase activity, 0005524 ATP binding; PDB: 1KOG_B 1EVL_D 1EVK_B 1QF6_A 1FYF_B 2I4O_A 2I4M_A 2I4N_A 2I4L_A 1HC7_D ....
Probab=35.33  E-value=55  Score=19.89  Aligned_cols=22  Identities=27%  Similarity=0.304  Sum_probs=18.6

Q ss_pred             cCCHHHHHHHHHHcCccEEEec
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      =.+.-..+.+|++.|++|.|.-
T Consensus        38 ~~~~~k~~~~a~~~g~p~~iii   59 (94)
T PF03129_consen   38 DKSLGKQIKYADKLGIPFIIII   59 (94)
T ss_dssp             SSTHHHHHHHHHHTTESEEEEE
T ss_pred             CCchhHHHHHHhhcCCeEEEEE
Confidence            3567789999999999998865


No 106
>cd03412 CbiK_N Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), N-terminal domain. CbiK is part of the cobalt-early path for cobalamin biosynthesis. It catalyzes the insertion of cobalt into the oxidized form of precorrin-2, factor II (sirohydrochlorin), the second step of the anaerobic branch of vitamin B12 biosynthesis. CbiK belongs to the class II family of chelatases and is a homomeric enzyme that does not require ATP for its enzymatic activity.
Probab=35.16  E-value=49  Score=22.21  Aligned_cols=26  Identities=12%  Similarity=0.293  Sum_probs=23.2

Q ss_pred             eecCCHHHHHHHHHHcCccEEEeccC
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      +.++|.++|++-+.++|+.=.|..|-
T Consensus        53 ~~~p~~~eaL~~l~~~G~~~V~V~Pl   78 (127)
T cd03412          53 IEVDTPEEALAKLAADGYTEVIVQSL   78 (127)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEEEeC
Confidence            56899999999999999999888874


No 107
>cd00859 HisRS_anticodon HisRS Histidyl-anticodon binding domain. HisRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=35.16  E-value=56  Score=18.83  Aligned_cols=20  Identities=20%  Similarity=0.386  Sum_probs=17.3

Q ss_pred             CHHHHHHHHHHcCccEEEec
Q psy627           44 SKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +....+.||++.|+++.|..
T Consensus        39 ~~~~~~~~a~~~~~~~~i~i   58 (91)
T cd00859          39 KLKKQFKYADRSGARFAVIL   58 (91)
T ss_pred             CHHHHHHHHHHcCCCEEEEE
Confidence            67899999999999986654


No 108
>PRK06806 fructose-bisphosphate aldolase; Provisional
Probab=34.92  E-value=47  Score=25.59  Aligned_cols=26  Identities=8%  Similarity=0.257  Sum_probs=23.0

Q ss_pred             ceeeecCCHHHHHHHHHHcCccEEEe
Q psy627           37 NLALNFSSKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G~~Y~V~   62 (89)
                      .+.+.+.|.|+|++|+++-|.+|.-.
T Consensus       147 ~~g~s~t~~eea~~f~~~tg~DyLAv  172 (281)
T PRK06806        147 DIEMLLTSTTEAKRFAEETDVDALAV  172 (281)
T ss_pred             cccceeCCHHHHHHHHHhhCCCEEEE
Confidence            34677899999999999999999887


No 109
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain. Serine/threonine protein phosphatase-5 (PP5) is a member of the PPP gene family of protein phosphatases that is highly conserved among eukaryotes and widely expressed in mammalian tissues. PP5 has a C-terminal phosphatase domain and an extended N-terminal TPR (tetratricopeptide repeat) domain containing three TPR motifs.  The PPP (phosphoprotein phosphatase) family, to which PP5 belongs, is one of two known protein phosphatase families specific for serine and threonine.  The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes.  Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cel
Probab=34.57  E-value=83  Score=24.66  Aligned_cols=26  Identities=8%  Similarity=0.360  Sum_probs=20.8

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      +...| ..+++.+|+++||+.+.|..-
T Consensus       227 ~g~~f-g~~~~~~Fl~~n~l~~iiR~H  252 (316)
T cd07417         227 VGCQF-GPDVTKRFLEENNLEYIIRSH  252 (316)
T ss_pred             CceEe-CHHHHHHHHHHcCCcEEEECC
Confidence            45566 677788999999999998653


No 110
>PRK00509 argininosuccinate synthase; Provisional
Probab=34.49  E-value=32  Score=28.09  Aligned_cols=19  Identities=26%  Similarity=0.627  Sum_probs=16.7

Q ss_pred             ecCCHHHHHHHHHHcCccE
Q psy627           41 NFSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y   59 (89)
                      .|.|+++-++||+++|++.
T Consensus       148 ~~~tK~eir~~A~~~Gipv  166 (399)
T PRK00509        148 DLKSREELIAYAEEHGIPI  166 (399)
T ss_pred             CCCCHHHHHHHHHHcCCCC
Confidence            3559999999999999975


No 111
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE. AhpE is described as a 1-cys PRX because of the absence of a resolving cysteine. The structure and sequence of AhpE, however, show greater similarity to 2-cys PRXs than 1-cys PRXs. PRXs are thiol-specific antioxidant (TSA) proteins that confer a protective role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either thioredoxin, glutathione, trypanothione and AhpF. The first step of catalysis is the nucleophilic attack by the peroxidatic cysteine on the peroxide leading to the formation of a cysteine sulfenic acid intermediate. The absence of a resolving cysteine suggests that functional AhpE is regenerated by an external reductant. The solution behavior and crystal structure of AhpE show that it forms dimers and octamers.
Probab=34.48  E-value=61  Score=21.01  Aligned_cols=27  Identities=19%  Similarity=0.276  Sum_probs=23.0

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      +.+..++.+++.+|++++++.|.+...
T Consensus        66 i~vs~d~~~~~~~~~~~~~~~~~~~~D   92 (149)
T cd03018          66 LGISVDSPFSLRAWAEENGLTFPLLSD   92 (149)
T ss_pred             EEecCCCHHHHHHHHHhcCCCceEecC
Confidence            356778999999999999999998764


No 112
>PRK03745 signal recognition particle protein Srp19; Provisional
Probab=34.16  E-value=1e+02  Score=20.74  Aligned_cols=24  Identities=21%  Similarity=0.396  Sum_probs=19.3

Q ss_pred             eeecCCHHHHHHHHHHcCccEE-Ee
Q psy627           39 ALNFSSKEDAIQYCQKNGWKFF-VE   62 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y~-V~   62 (89)
                      .+.=++.++=++-|++.|++|. |+
T Consensus        28 aV~~P~~~EI~~a~~~lgl~~~~~E   52 (100)
T PRK03745         28 AVERPTLEEIVDAAEALGFKVIEVD   52 (100)
T ss_pred             cccCCCHHHHHHHHHHcCCCcEeec
Confidence            3445788999999999999995 54


No 113
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This domain has  a strongly conserved motif SGGXD at the N terminus.
Probab=34.03  E-value=44  Score=22.76  Aligned_cols=22  Identities=14%  Similarity=0.332  Sum_probs=18.7

Q ss_pred             cCCHHHHHHHHHHcCccEEEec
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .=+++|-++||+.+|+++....
T Consensus       146 ~~~k~eI~~~~~~~~l~~~~~~  167 (185)
T cd01992         146 GITRAEIEAYLRENGLPWWEDP  167 (185)
T ss_pred             CCCHHHHHHHHHHcCCCeEECC
Confidence            4489999999999999987643


No 114
>PF13669 Glyoxalase_4:  Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily; PDB: 3RMU_B 3ISQ_A 1JC5_D 1JC4_D 3HDP_A 2QH0_A 3GM5_A 3OA4_A 3CT8_A.
Probab=33.95  E-value=36  Score=21.34  Aligned_cols=32  Identities=19%  Similarity=0.399  Sum_probs=26.8

Q ss_pred             CCCCCceeeecCCHHHHHHHHHHcCccEEEec
Q psy627           32 GDPLSNLALNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        32 ~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +.-+..|.+.-++.|+|++.++.+|+...-..
T Consensus        66 ~~gi~Hia~~v~D~d~~~~~l~~~G~~~~~~~   97 (109)
T PF13669_consen   66 GGGIHHIAFEVDDLDAAIARLEAQGFRVLDEG   97 (109)
T ss_dssp             SSEEEEEEEEESHHHHHHHHHHHTTECEEECE
T ss_pred             CCCEEEEEEEeCCHHHHHHHHHHCCCEEcccC
Confidence            44466788999999999999999999987544


No 115
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain. Bsu1 encodes a nuclear serine-threonine protein phosphatase found in plants and protozoans.  Bsu1 has a C-terminal phosphatase domain and an N-terminal Kelch-repeat domain.  Bsu1 is preferentially expressed in elongating plant cells. It modulates the phosphorylation state of Bes1, a transcriptional regulator phosphorylated by the glycogen synthase kinase Bin2, as part of a steroid hormone signal transduction pathway.  The PPP (phosphoprotein phosphatase) family, to which Bsu1 belongs, is one of two known protein phosphatase families specific for serine and threonine.  The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all eukaryotes, and in most
Probab=33.85  E-value=84  Score=24.39  Aligned_cols=23  Identities=4%  Similarity=0.172  Sum_probs=19.0

Q ss_pred             cCCHHHHHHHHHHcCccEEEecc
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      +=..+++-+||+++|+.+.|..-
T Consensus       239 ~fg~~~~~~Fl~~n~l~~iiRgH  261 (311)
T cd07419         239 KFGPDRVHRFLEENDLQMIIRAH  261 (311)
T ss_pred             eECHHHHHHHHHHCCCeEEEEec
Confidence            34678889999999999998653


No 116
>PF12123 Amidase02_C:  N-acetylmuramoyl-l-alanine amidase;  InterPro: IPR021976  This domain is found in bacteria and viruses. This domain is about 50 amino acids in length. This domain is classified with the enzyme classification code 3.5.1.28 from EC. This domain is the C-terminal of the enzyme which hydrolyses the link between N-acetylmuramoyl residues and L-amino acid residues in certain cell-wall glycopeptides. ; PDB: 2L48_B.
Probab=33.73  E-value=56  Score=19.02  Aligned_cols=18  Identities=17%  Similarity=0.466  Sum_probs=13.7

Q ss_pred             CHHHHHHHHHHcCccEEE
Q psy627           44 SKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V   61 (89)
                      .++.+-+|-.++||-|+|
T Consensus        28 ~L~k~~~wld~rgWwYe~   45 (45)
T PF12123_consen   28 ELDKFTAWLDERGWWYEV   45 (45)
T ss_dssp             HHHHHHHHHHHTT--EEE
T ss_pred             HHHHHHHHHHhcCcEEeC
Confidence            467888999999999987


No 117
>cd07249 MMCE Methylmalonyl-CoA epimerase (MMCE). MMCE, also called methylmalonyl-CoA racemase (EC 5.1.99.1) interconverts (2R)-methylmalonyl-CoA and (2S)-methylmalonyl-CoA. MMCE has been found in bacteria, archaea, and in animals. In eukaryotes, MMCE is an essential enzyme in a pathway that converts propionyl-CoA to succinyl-CoA, and is important in the breakdown of odd-chain length fatty acids, branched-chain amino acids, and other metabolites. In bacteria, MMCE participates in the reverse pathway for propionate fermentation, glyoxylate regeneration, and the biosynthesis of polyketide antibiotics. MMCE is closely related to glyoxalase I and type I extradiol dioxygenases.
Probab=33.57  E-value=66  Score=19.62  Aligned_cols=24  Identities=13%  Similarity=0.317  Sum_probs=21.3

Q ss_pred             CceeeecCCHHHHHHHHHHcCccE
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y   59 (89)
                      ..+.+..++.+++++.+.+.|+.+
T Consensus        74 ~h~~f~v~d~~~~~~~l~~~G~~~   97 (128)
T cd07249          74 HHIAFEVDDIDAALARLKAQGVRL   97 (128)
T ss_pred             EEEEEEeCCHHHHHHHHHHCCCee
Confidence            447888999999999999999975


No 118
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain. The only examples in which the wobble position of a tRNA must discriminate between G and A of mRNA are AUA (Ile) vs. AUG (Met) and UGA (stop) vs. UGG (Trp). In all bacteria, the wobble position of the tRNA(Ile) recognizing AUA is lysidine, a lysine derivative of cytidine. This family describes a protein domain found, apparently, in all bacteria in a single copy. Eukaryotic sequences appear to be organellar. The domain archictecture of this protein family is variable; some, including characterized proteins of E. coli and B. subtilis known to be tRNA(Ile)-lysidine synthetase, include a conserved 50-residue domain that many other members lack. This protein belongs to the ATP-binding PP-loop family ( pfam01171). It appears in the literature and protein databases as TilS, YacA, and putative cell cycle protein MesJ (a misnomer).
Probab=33.56  E-value=48  Score=22.81  Aligned_cols=20  Identities=20%  Similarity=0.296  Sum_probs=17.4

Q ss_pred             HHHHHHHHHHcCccEEEecc
Q psy627           45 KEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .+.|.++|+..|+++.+..-
T Consensus        47 ~~~~~~~~~~~gi~~~~~~~   66 (189)
T TIGR02432        47 AEFVQQFCKKLNIPLEIKKV   66 (189)
T ss_pred             HHHHHHHHHHcCCCEEEEEe
Confidence            68899999999999988763


No 119
>PF01329 Pterin_4a:  Pterin 4 alpha carbinolamine dehydratase;  InterPro: IPR001533 DCoH is the dimerisation cofactor of hepatocyte nuclear factor 1 (HNF-1) that functions as both a transcriptional coactivator and a pterin dehydratase []. X-ray crystallographic studies have shown that the ligand binds at four sites per tetrameric enzyme, with little apparent conformational change in the protein.; GO: 0008124 4-alpha-hydroxytetrahydrobiopterin dehydratase activity, 0006729 tetrahydrobiopterin biosynthetic process; PDB: 2V6T_B 2V6U_A 2V6S_B 2EBB_A 1USM_A 1F93_B 1DCP_C 1DCH_E 3HXA_E 1DCO_C ....
Probab=33.54  E-value=38  Score=21.78  Aligned_cols=32  Identities=19%  Similarity=0.442  Sum_probs=22.5

Q ss_pred             CCCCCCCCCCCCCCceeeecCCHHHHHHHHHH
Q psy627           23 NPLMGWCSTGDPLSNLALNFSSKEDAIQYCQK   54 (89)
Q Consensus        23 dPLMGWtss~D~~~qv~l~F~s~e~Aiayae~   54 (89)
                      ..|-||.-.++..-.-...|++-..|++|..+
T Consensus        15 ~~l~~W~~~~~~~l~r~f~f~~f~~a~~f~~~   46 (95)
T PF01329_consen   15 AELPGWKLDGGGRLERTFKFKDFAEAVEFVNR   46 (95)
T ss_dssp             HTSTTSEEETSSEEEEEEE-SSHHHHHHHHHH
T ss_pred             hcCcCCEECCCCcEEEEEEeCCHHHHHHHHHH
Confidence            36789998873222347899999999998754


No 120
>TIGR03072 release_prfH putative peptide chain release factor H. Members of this protein family are bacterial proteins homologous to peptide chain release factors 1 (RF-1, product of the prfA gene), and 2 (RF-2, product of the prfB gene). The member from Escherichia coli K-12, designated prfH, appears to be a pseudogene. This class I release factor is always found as the downstream gene of a two-gene operon.
Probab=33.25  E-value=34  Score=25.51  Aligned_cols=17  Identities=18%  Similarity=0.130  Sum_probs=14.6

Q ss_pred             HHHHHHcCccEEEeccC
Q psy627           49 IQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        49 iayae~~G~~Y~V~~p~   65 (89)
                      +.||+++||.++|.+-.
T Consensus        26 ~~~a~~~g~~~eii~~~   42 (200)
T TIGR03072        26 TREAAARGVRVEVLEQE   42 (200)
T ss_pred             HHHHHHcCCeEEEEeCC
Confidence            57999999999998743


No 121
>PF04895 DUF651:  Archaeal protein of unknown function (DUF651);  InterPro: IPR006979 This conserved region is found in the C-terminal region of a number of conserved archaeal proteins of unknown function.
Probab=33.19  E-value=30  Score=23.63  Aligned_cols=22  Identities=18%  Similarity=0.425  Sum_probs=17.5

Q ss_pred             CCCceeeecCCHHHHHHHHHHc
Q psy627           34 PLSNLALNFSSKEDAIQYCQKN   55 (89)
Q Consensus        34 ~~~qv~l~F~s~e~Aiayae~~   55 (89)
                      .+.+--..|+|.++|+.|+...
T Consensus        62 A~~~~p~~f~~l~eAl~~~~~~   83 (110)
T PF04895_consen   62 AMKGKPEKFETLEEALEYVSSR   83 (110)
T ss_pred             HHhCCCcccCCHHHHHHHHHHH
Confidence            3455568999999999998764


No 122
>KOG0369|consensus
Probab=32.85  E-value=40  Score=30.65  Aligned_cols=23  Identities=13%  Similarity=0.478  Sum_probs=19.8

Q ss_pred             cCCHHHHHHHHHHcCccEEEecc
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ..|.|+|++||+++|++..+...
T Consensus       170 itt~~EA~eF~k~yG~PvI~KAA  192 (1176)
T KOG0369|consen  170 ITTVEEALEFVKEYGLPVIIKAA  192 (1176)
T ss_pred             cccHHHHHHHHHhcCCcEEEeec
Confidence            36899999999999999888653


No 123
>PF05159 Capsule_synth:  Capsule polysaccharide biosynthesis protein;  InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT. Capsule polysaccharide modification protein lipB/A is involved in the phospholipid modification of the capsular polysaccharide and is a strong requirement for its translocation to the cell surface. The capsule of Neisseria meningitidis serogroup B and of other meningococcal serogroups and other Gram-negative bacterial pathogens, are anchored in the outer membrane through a 1,2-diacylglycerol moiety. The lipA and lipB genes are located on the 3' end of the ctr operon. lipA and lipB do not encode proteins responsible for diacylglycerophosphatidic acid substitution of the meningococcal capsule polymer, but they are required for proper translocation and surface expression of the lipidated polymer []. KpsS is an unusual sulphate-modified form of the capsular polysaccharide in Rhizobium loti (Mesorhizobium loti). Many plants, including R. loti, enter into symbiotic relationships with bacteria that allow survival in nutrient-limiting environments. KpsS functions as a fucosyl sulphotransferase in vitro. The kpsS gene product shares no significant amino acid similarity with previously identified sulphotransferases []. Sulphated cell surface polysaccharides are required for optimum nodule formation but limit growth rate and nodule colonisation in M. loti [].; GO: 0000271 polysaccharide biosynthetic process, 0015774 polysaccharide transport
Probab=32.72  E-value=45  Score=24.50  Aligned_cols=23  Identities=17%  Similarity=0.143  Sum_probs=18.8

Q ss_pred             CCHHHHHHHHHHcCccEEEeccC
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      .....|++.|+++|+++.+.|.-
T Consensus        11 ~~~~~~~~~a~~~~i~~~~~E~G   33 (269)
T PF05159_consen   11 PYHRAAIEVAKELGIPVIFFEDG   33 (269)
T ss_pred             cHHHHHHHHHHHhCCCEEEEecC
Confidence            34567889999999999998853


No 124
>TIGR00655 PurU formyltetrahydrofolate deformylase. This model describes formyltetrahydrofolate deformylases. The enzyme is a homohexamer. Sequences from a related enzyme formyl tetrahydrofolate-specific enzyme, phosphoribosylglycinamide formyltransferase, serve as an outgroup for phylogenetic analysis. Putative members of this family, scoring below the trusted cutoff, include a sequence from Rhodobacter capsulatus that lacks an otherwise conserved C-terminal region.
Probab=32.57  E-value=54  Score=25.28  Aligned_cols=29  Identities=24%  Similarity=0.312  Sum_probs=25.2

Q ss_pred             CceeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ..|.+-+.++.+|-++|+++||+|.+...
T Consensus       112 ~~i~~visn~~~~~~~A~~~gIp~~~~~~  140 (280)
T TIGR00655       112 AEIALVISNHEDLRSLVERFGIPFHYIPA  140 (280)
T ss_pred             cEEEEEEEcChhHHHHHHHhCCCEEEcCC
Confidence            56788889999999999999999988654


No 125
>COG3584 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.42  E-value=25  Score=24.18  Aligned_cols=29  Identities=28%  Similarity=0.400  Sum_probs=21.0

Q ss_pred             CCCCCCCCCC-----CceeeecCCHHHHHHHHHH
Q psy627           26 MGWCSTGDPL-----SNLALNFSSKEDAIQYCQK   54 (89)
Q Consensus        26 MGWtss~D~~-----~qv~l~F~s~e~Aiayae~   54 (89)
                      -||-=..||-     .++-|.|+|.+||++|-.+
T Consensus        70 YG~ava~DTGgaIkGNkIDl~~~s~~da~~wG~k  103 (109)
T COG3584          70 YGVAVAEDTGGAIKGNKIDLYMPSERDAINWGRK  103 (109)
T ss_pred             ccEEEEeecCCcccCcEEEEEcCcHHHHHhhCce
Confidence            4555556764     4578999999999977443


No 126
>cd01205 WASP WASP-type EVH1 domain. WASP-type EVH1 domain.  Wiskott-Aldrich syndrome (WAS) is an X-linked recessive disease, characterized by eczema, immunodeficiency, and thrombocytopenia. The majority of patients with WAS, or a milder version of the disorder,  X-linked thrombocytopenia (XLT), have point mutations in the EVH1 domain of WASP (Wiskott-Aldrich syndrome protein).  WASP  is an actin regulatory protein consisting of an N-terminal EVH1 domain, a basic region, a GTP binding domain, a proline rich region and a WH2 acidic region.  Yeast members lack the GTP binding domain. WASP binds a 25 residue proline rich motif from the WASP Interacting Protein (WIP) via its N-terminal EVH1 domain.
Probab=32.41  E-value=48  Score=22.41  Aligned_cols=19  Identities=26%  Similarity=0.550  Sum_probs=17.0

Q ss_pred             CceeeecCCHHHHHHHHHH
Q psy627           36 SNLALNFSSKEDAIQYCQK   54 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~   54 (89)
                      -++.|.|.+.+||-.|-++
T Consensus        82 c~~GL~Fade~EA~~F~k~  100 (105)
T cd01205          82 CVVGLNFADETEAAEFRKK  100 (105)
T ss_pred             cEEEEEECCHHHHHHHHHH
Confidence            5789999999999999776


No 127
>PF10686 DUF2493:  Protein of unknown function (DUF2493);  InterPro: IPR019627 This entry is represented by Mycobacteriophage D29, Gp61. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.  Members of this family are mainly Proteobacteria. The function is not known. 
Probab=32.35  E-value=53  Score=20.34  Aligned_cols=19  Identities=11%  Similarity=0.104  Sum_probs=15.9

Q ss_pred             HHHHHHHHcCccEEEeccC
Q psy627           47 DAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        47 ~Aiayae~~G~~Y~V~~p~   65 (89)
                      -|..+|+++|++.++..|.
T Consensus        48 iA~~wA~~~gv~~~~~~ad   66 (71)
T PF10686_consen   48 IAARWARERGVPVIRFPAD   66 (71)
T ss_pred             HHHHHHHHCCCeeEEeCcC
Confidence            4778999999999887665


No 128
>PF05389 MecA:  Negative regulator of genetic competence (MecA);  InterPro: IPR008681 Competence is the ability of a cell to take up exogenous DNA from its environment, resulting in transformation. It is widespread among bacteria and is probably an important mechanism for the horizontal transfer of genes. Cells that take up DNA inevitably acquire the nucleotides the DNA consists of, and, because nucleotides are needed for DNA and RNA synthesis and are expensive to synthesise, these may make a significant contribution to the cell's energy budget []. The lateral gene transfer caused by competence also contributes to the genetic diversity that makes evolution possible.  DNA usually becomes available by the death and lysis of other cells. Competent bacteria use components of extracellular filaments called type 4 pili to create pores in their membranes and pull DNA through the pores into the cytoplasm. This process, including the development of competence and the expression of the uptake machinery, is regulated in response to cell-cell signalling and/or nutritional conditions []. This family contains several bacterial MecA proteins. In complex media competence development is poor, and there is little or no expression of late competence genes. Overexpression of MecA inhibits comG transcription [, , ]. MecA enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. Acts negatively in the development of competence by binding ComK and recruiting it to the ClpCP protease. When overexpressed, inhibits sporulation. Also involved in Spx degradation by ClpC. ; PDB: 3JTP_C 2Y1R_O 3PXI_c 3PXG_b 3JTO_D 3JTN_A.
Probab=32.22  E-value=31  Score=25.18  Aligned_cols=21  Identities=24%  Similarity=0.265  Sum_probs=18.4

Q ss_pred             ceeeecCCHHHHHHHHHHcCc
Q psy627           37 NLALNFSSKEDAIQYCQKNGW   57 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G~   57 (89)
                      .+.+.|++.|++|++|+...-
T Consensus       131 ~~v~~F~dfedvI~la~~l~~  151 (220)
T PF05389_consen  131 TRVFEFDDFEDVIQLAKRLQD  151 (220)
T ss_dssp             EEEEEESSHHHHHHHHCHCCH
T ss_pred             EEEEEcCCHHHHHHHHhhccc
Confidence            467999999999999998754


No 129
>COG0216 PrfA Protein chain release factor A [Translation, ribosomal structure and biogenesis]
Probab=32.14  E-value=38  Score=27.75  Aligned_cols=19  Identities=21%  Similarity=0.484  Sum_probs=15.9

Q ss_pred             HHHHHHcCccEEEeccCCC
Q psy627           49 IQYCQKNGWKFFVEEPKWK   67 (89)
Q Consensus        49 iayae~~G~~Y~V~~p~~~   67 (89)
                      ..||+.+||.++|....+.
T Consensus       139 ~rYAe~kgWk~ei~s~se~  157 (363)
T COG0216         139 SRYAESKGWKVEILSASES  157 (363)
T ss_pred             HHHHHhCCCEEEEeecCcc
Confidence            3899999999999886543


No 130
>COG5079 SAC3 Nuclear protein export factor [Intracellular trafficking and secretion / Cell division and chromosome partitioning]
Probab=32.01  E-value=27  Score=30.39  Aligned_cols=25  Identities=24%  Similarity=0.618  Sum_probs=22.1

Q ss_pred             eeecCCHHHHHHHHHHcCccEEEec
Q psy627           39 ALNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .|.|+++++++.||+-+|++..+..
T Consensus       356 il~f~~~~e~~efckyy~lei~~ed  380 (646)
T COG5079         356 ILDFEEKGEGEEFCKYYGLEIRIED  380 (646)
T ss_pred             hccccccchhHHHhhhcceeeeccc
Confidence            5889999999999999999986554


No 131
>cd08344 MhqB_like_N N-terminal domain of MhqB, a type I extradiol dioxygenase, and similar proteins. This subfamily contains the N-terminal, non-catalytic, domain of Burkholderia sp. NF100 MhqB and similar proteins. MhqB is a type I extradiol dioxygenase involved in the catabolism of methylhydroquinone, an intermediate in the degradation of fenitrothion. The purified enzyme has shown extradiol ring cleavage activity toward 3-methylcatechol. Fe2+ was suggested as a cofactor, the same as most other enzymes in the family. Burkholderia sp. NF100 MhqB is encoded on the plasmid pNF1. The type I family of extradiol dioxygenases contains two structurally homologous barrel-shaped domains at the N- and C-terminal. The active-site metal is located in the C-terminal barrel and plays an essential role in the catalytic mechanism.
Probab=31.97  E-value=77  Score=19.51  Aligned_cols=28  Identities=11%  Similarity=0.100  Sum_probs=20.9

Q ss_pred             CCCCceeeec--CCHHHHHHHHHHcCccEE
Q psy627           33 DPLSNLALNF--SSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        33 D~~~qv~l~F--~s~e~Aiayae~~G~~Y~   60 (89)
                      +.+..+.+.|  ++.+++++.++++|+++.
T Consensus        54 ~~~~~~~~~~~~~d~~~~~~~l~~~Gi~~~   83 (112)
T cd08344          54 KRLAYLSFGIFEDDFAAFARHLEAAGVALA   83 (112)
T ss_pred             CceeeEEEEeEhhhHHHHHHHHHHcCCcee
Confidence            3344455555  789999999999999954


No 132
>cd00858 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain. GlyRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=31.89  E-value=60  Score=21.20  Aligned_cols=23  Identities=17%  Similarity=0.003  Sum_probs=19.3

Q ss_pred             eecCCHHHHHHHHHHcCccEEEec
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +. .+....+.+|++.|++|.|.-
T Consensus        62 ~~-~sl~kqlk~A~k~g~~~~iii   84 (121)
T cd00858          62 DS-GSIGRRYARQDEIGTPFCVTV   84 (121)
T ss_pred             CC-CCHHHHHHHhHhcCCCEEEEE
Confidence            45 788999999999999988765


No 133
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=31.77  E-value=59  Score=29.23  Aligned_cols=28  Identities=18%  Similarity=0.400  Sum_probs=24.0

Q ss_pred             CceeeecCCHHHH----HHHHHHcCccEEEec
Q psy627           36 SNLALNFSSKEDA----IQYCQKNGWKFFVEE   63 (89)
Q Consensus        36 ~qv~l~F~s~e~A----iayae~~G~~Y~V~~   63 (89)
                      ..|.|.|+|.|+|    .+||.+.|....|..
T Consensus        74 P~vGMeF~S~eeA~~FYn~YA~~~GFsVRi~~  105 (846)
T PLN03097         74 PLSGMEFESHGEAYSFYQEYARSMGFNTAIQN  105 (846)
T ss_pred             CcCCCeECCHHHHHHHHHHHHhhcCceEEeec
Confidence            4688999999999    578999999987754


No 134
>cd08349 BLMA_like Bleomycin binding protein (BLMA) and similar proteins; BLMA confers bleomycin (Bm) resistance by directly binding to Bm. BLMA also called Bleomycin resistance protein, confers Bm resistance by directly binding to Bm. Bm is a glycopeptide antibiotic produced naturally by actinomycetes. It is a potent anti-cancer drug, which acts as a strong DNA-cutting agent, thereby causing cell death. BLMA is produced by actinomycetes to protect themselves against their own lethal compound. BLMA has two identically-folded subdomains, with the same alpha/beta fold; these two halves have no sequence similarity. BLMAs are dimers and each dimer binds to two Bm molecules at the Bm-binding pockets formed at the dimer interface; two Bm molecules are bound per dimer. BLMA belongs to a conserved domain superfamily that is found in a variety of structurally related metalloproteins, including the bleomycin resistance protein, glyoxalase I, and type I ring-cleaving dioxygenases. As for the large
Probab=31.67  E-value=1e+02  Score=18.33  Aligned_cols=29  Identities=10%  Similarity=0.195  Sum_probs=22.9

Q ss_pred             ceeeecCCHHHHHHHHHHcCccEEEeccC
Q psy627           37 NLALNFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      .+.+.-++.+++.+.++++|+.+.+..+.
T Consensus        61 ~~~~~~~~~~~~~~~l~~~G~~~~~~~~~   89 (112)
T cd08349          61 SVYIEVEDVDALYAELKAKGADLIVYPPE   89 (112)
T ss_pred             EEEEEeCCHHHHHHHHHHcCCcceecCcc
Confidence            46677788999999999999986444443


No 135
>cd06575 PASTA_Pbp2x-like_2 PASTA domain of PBP2x-like proteins, second repeat. Penicillin-binding proteins (PBPs) are the major targets for beta-lactam antibiotics, like penicillins and cephalosporins. Beta-lactam antibiotics specifically inhibit transpeptidase activity by acylating the active site serine. PBPs catalyze key steps in the synthesis of the peptidoglycan, such as the interconnecting of glycan chains (polymers of N-glucosamine and N-acetylmuramic acid residues) and the cross-linking (transpeptidation) of short stem peptides, which are attached to glycan chains. Peptidoglycan is essential in cell division and protects bacteria from osmotic shock and lysis. PBP2x is one of the two monofunctional high molecular mass PBPs in Streptococcus pneumoniae and has been seen as the primary PBP target in beta-lactam-resistant strains. The PASTA domain is found at the C-termini of several PBPs and bacterial serine/threonine kinases. The name PASTA is derived from PBP and Serine/Threonine
Probab=31.64  E-value=75  Score=16.66  Aligned_cols=21  Identities=29%  Similarity=0.230  Sum_probs=17.9

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .+.++|.+..++.|+.+.+..
T Consensus         8 ~~~~~a~~~l~~~g~~~~~~~   28 (54)
T cd06575           8 WSKRDALKLLELLGLKVKFSG   28 (54)
T ss_pred             CCHHHHHHHHHHCCCeEEEee
Confidence            578999999999999987654


No 136
>KOG1769|consensus
Probab=31.47  E-value=26  Score=23.74  Aligned_cols=13  Identities=23%  Similarity=0.657  Sum_probs=10.8

Q ss_pred             HHHHHHcCccEEE
Q psy627           49 IQYCQKNGWKFFV   61 (89)
Q Consensus        49 iayae~~G~~Y~V   61 (89)
                      -+||+++|+++.-
T Consensus        48 ~aYc~r~Gl~~~s   60 (99)
T KOG1769|consen   48 KAYCERQGLSMNS   60 (99)
T ss_pred             HHHHHHcCCccce
Confidence            4899999998743


No 137
>PRK10291 glyoxalase I; Provisional
Probab=31.40  E-value=68  Score=20.32  Aligned_cols=27  Identities=19%  Similarity=0.266  Sum_probs=23.0

Q ss_pred             CCceeeecCCHHHHHHHHHHcCccEEE
Q psy627           35 LSNLALNFSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        35 ~~qv~l~F~s~e~Aiayae~~G~~Y~V   61 (89)
                      ...+.+..++.+++++.++.+|+.+..
T Consensus        66 ~~hlaf~V~d~~~~~~~l~~~G~~~~~   92 (129)
T PRK10291         66 YGHIALSVDNAAEACEKIRQNGGNVTR   92 (129)
T ss_pred             eeEEEEEeCCHHHHHHHHHHcCCcccc
Confidence            456888889999999999999998653


No 138
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily. Involved in the biogenesis of c-type cytochromes as well as in disulfide bond formation in some periplasmic proteins.
Probab=31.22  E-value=43  Score=23.08  Aligned_cols=47  Identities=13%  Similarity=0.239  Sum_probs=27.3

Q ss_pred             eeec-CCHHHHHHHHHHcCccEE-E-eccCCC---CCCcccccccCCcCCCcc
Q psy627           39 ALNF-SSKEDAIQYCQKNGWKFF-V-EEPKWK---TPKVKSYAFNFSWNKRTR   85 (89)
Q Consensus        39 ~l~F-~s~e~Aiayae~~G~~Y~-V-~~p~~~---~~~~ksYadNF~~~r~~~   85 (89)
                      .+.. ++.+++.+|++++|++|. | .++...   .....+.-.+|-.++..+
T Consensus        97 ~V~~~~~~~~~~~~~~~~~~~f~~v~~D~~~~~~~~~~v~~~P~~~~id~~G~  149 (173)
T TIGR00385        97 GVDYKDQSQNALKFLKELGNPYQAILIDPNGKLGLDLGVYGAPETFLVDGNGV  149 (173)
T ss_pred             EEECCCChHHHHHHHHHcCCCCceEEECCCCchHHhcCCeeCCeEEEEcCCce
Confidence            4445 356778999999999986 3 234322   122233334566655444


No 139
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=31.06  E-value=47  Score=21.68  Aligned_cols=24  Identities=21%  Similarity=0.444  Sum_probs=20.4

Q ss_pred             eecCCHHHHHHHHHHcCccEEEec
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      |.|-+.++-+.||..+|++|.-.+
T Consensus         7 L~~v~E~ei~~ya~~~~lp~~~~~   30 (104)
T TIGR00269         7 LRYIPEKEVVLYAFLNELKVHLDE   30 (104)
T ss_pred             cccCCHHHHHHHHHHcCCCcCCCC
Confidence            677888999999999999987444


No 140
>COG4862 MecA Negative regulator of genetic competence, sporulation and motility [Posttranslational modification, protein turnover, chaperones / Signal transduction mechanisms / Cell motility and secretion]
Probab=31.03  E-value=42  Score=25.78  Aligned_cols=22  Identities=23%  Similarity=0.351  Sum_probs=19.0

Q ss_pred             ceeeecCCHHHHHHHHHHcCcc
Q psy627           37 NLALNFSSKEDAIQYCQKNGWK   58 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G~~   58 (89)
                      .+.|.|.+.|++|++|+...+.
T Consensus       131 ~~il~F~d~eDvI~lsk~~~~~  152 (224)
T COG4862         131 YYILRFADFEDVISLSKNLKFE  152 (224)
T ss_pred             EEEEEeccHHHHHhHhhhcccc
Confidence            4789999999999999986654


No 141
>cd00914 PCD_DCoH_subfamily_b PCD_DCoH: The bifunctional protein pterin-4alpha-carbinolamine dehydratase (PCD), also known as DCoH  (dimerization cofactor of hepatocyte nuclear factor-1), is both a transcription activator and a metabolic enzyme.  DCoH stimulates gene expression by associating with specific DNA binding proteins such as HNF-1alpha (hepatocyte nuclear factor-1) and Xenopus enhancer of rudimentary homologue (XERH).  DCoH also catalyzes the dehydration of 4alpha- hydroxy- tetrahydrobiopterin (4alpha-OH-BH4) to quinoiddihydrobiopterin, a percursor of the phenylalanine hydroxylase cofactor BH4 (tetrahydrobiopterin). The DCoH homodimer has a saddle-shaped structure similar to that of TBP (TATA binding protein). Two DCoH proteins have been identifed in humans: DCoH1 and DCoH2. Mutations in human DCoH1 cause hyperphenylalaninemia. Loss of enzymic activity of DCoH in humans is associated with the depigmentation disorder vitiligo. DCoH1 has been reported to be overexpessed in colon
Probab=30.99  E-value=60  Score=20.02  Aligned_cols=29  Identities=14%  Similarity=0.343  Sum_probs=21.5

Q ss_pred             CCCCCCCCC-CceeeecCCHHHHHHHHHHc
Q psy627           27 GWCSTGDPL-SNLALNFSSKEDAIQYCQKN   55 (89)
Q Consensus        27 GWtss~D~~-~qv~l~F~s~e~Aiayae~~   55 (89)
                      ||.-..++. -.-+..|++-.+|++|+.+-
T Consensus         1 gW~~~~~~~~l~r~f~f~~f~~a~~f~~~v   30 (76)
T cd00914           1 GWTLVDGRDAIHKSFKFKDFNEAFGFMTRV   30 (76)
T ss_pred             CCeEeCCCCeEEEEEEeCCHHHHHHHHHHH
Confidence            677766654 23468899999999997663


No 142
>PF00462 Glutaredoxin:  Glutaredoxin;  InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors. Oxidized glutathione is regenerated by glutathione reductase. Together these components compose the glutathione system [].  Glutaredoxin functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. Like thioredoxin, which functions in a similar way, glutaredoxin possesses an active centre disulphide bond []. It exists in either a reduced or an oxidized form where the two cysteine residues are linked in an intramolecular disulphide bond. Glutaredoxin has been sequenced in a variety of species. On the basis of extensive sequence similarity, it has been proposed [] that Vaccinia virus protein O2L is most probably a glutaredoxin. Finally, it must be noted that Bacteriophage T4 thioredoxin seems also to be evolutionary related. In position 5 of the pattern T4 thioredoxin has Val instead of Pro.  This entry represents Glutaredoxin.; GO: 0009055 electron carrier activity, 0015035 protein disulfide oxidoreductase activity, 0045454 cell redox homeostasis; PDB: 1QFN_A 1GRX_A 1EGO_A 1EGR_A 3RHC_A 3RHB_A 3IPZ_A 1NHO_A 3GX8_A 3D5J_A ....
Probab=30.98  E-value=63  Score=18.12  Aligned_cols=19  Identities=11%  Similarity=0.207  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHcCccEEEec
Q psy627           45 KEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~   63 (89)
                      -..|.++-+++|++|++..
T Consensus        12 C~~~~~~L~~~~i~y~~~d   30 (60)
T PF00462_consen   12 CKKAKEFLDEKGIPYEEVD   30 (60)
T ss_dssp             HHHHHHHHHHTTBEEEEEE
T ss_pred             HHHHHHHHHHcCCeeeEcc
Confidence            4678999999999999876


No 143
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7. This model represents one of several families of known and probable glutathione peroxidases. This family is restricted to animals and designated GPX7.
Probab=30.92  E-value=39  Score=22.64  Aligned_cols=21  Identities=14%  Similarity=0.271  Sum_probs=18.1

Q ss_pred             CCHHHHHHHHHH-cCccEEEec
Q psy627           43 SSKEDAIQYCQK-NGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~-~G~~Y~V~~   63 (89)
                      ++.|++.+|+++ +|++|.|..
T Consensus        72 d~~~~~~~f~~~~~~~~fp~~~   93 (153)
T TIGR02540        72 DSSKEIESFARRNYGVTFPMFS   93 (153)
T ss_pred             CCHHHHHHHHHHhcCCCCCccc
Confidence            778999999986 899998854


No 144
>PF00588 SpoU_methylase:  SpoU rRNA Methylase family;  InterPro: IPR001537 The spoU gene of Escherichia coli codes for a protein that shows strong similarities to previously characterised 2'-O-methyltransferases [, ]. The Pet56 protein of Saccharomyces cerevisiae has been shown to be required for ribose methylation at a universally conserved nucleotide in the peptidyl transferase centre of the mitochondrial large ribosomal RNA (21S rRNA). Cells reduced in this activity were deficient in formation of functional large subunits of the mitochondrial ribosome. The Pet56 protein catalyzes the site-specific formation of 2'-O-methylguanosine on in vitro transcripts of both mitochondrial 21S rRNA and E. coli 23S rRNA providing evidence for an essential modified nucleotide in rRNA [].; GO: 0003723 RNA binding, 0008173 RNA methyltransferase activity, 0006396 RNA processing; PDB: 3N4J_A 3N4K_A 1IPA_A 3ONP_A 3NK6_A 3NK7_A 3IC6_A 1GZ0_D 1MXI_A 1J85_A ....
Probab=30.71  E-value=1.1e+02  Score=20.15  Aligned_cols=25  Identities=20%  Similarity=0.428  Sum_probs=20.8

Q ss_pred             eecCCHHHHHHHHHHcCccEEEecc
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ..+++.+++++.++..|+.....++
T Consensus        59 ~~~~~~~~~l~~~~~~g~~i~~~~~   83 (142)
T PF00588_consen   59 RRVDDLEEALKDLKENGYTIVATSP   83 (142)
T ss_dssp             EEESSHHHHHHHHHHTTEEEEEEST
T ss_pred             eeeehhhhhcccccccccccceeee
Confidence            6789999999999999877655555


No 145
>PRK03353 ribB 3,4-dihydroxy-2-butanone 4-phosphate synthase; Provisional
Probab=30.53  E-value=48  Score=24.85  Aligned_cols=18  Identities=6%  Similarity=0.329  Sum_probs=16.0

Q ss_pred             CCHHHHHHHHHHcCccEE
Q psy627           43 SSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~   60 (89)
                      ...+++++||++||+...
T Consensus       183 ~~~~~~~~fA~~~~l~~v  200 (217)
T PRK03353        183 ARAPECIAFAKQHNMPVL  200 (217)
T ss_pred             ccHHHHHHHHHHcCCcEE
Confidence            468999999999999983


No 146
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only]
Probab=30.47  E-value=43  Score=27.66  Aligned_cols=20  Identities=25%  Similarity=0.572  Sum_probs=18.2

Q ss_pred             HHHHHHHHcCccEEEeccCC
Q psy627           47 DAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        47 ~Aiayae~~G~~Y~V~~p~~   66 (89)
                      +||+||.++|+...|-+|-.
T Consensus       187 ~~l~~A~~~~~gI~IMeP~~  206 (391)
T COG1453         187 EGLKYAASKGLGIFIMEPLD  206 (391)
T ss_pred             HHHHHHHhCCCcEEEEeeCC
Confidence            68999999999999999854


No 147
>PF08057 Ery_res_leader2:  Erythromycin resistance leader peptide;  InterPro: IPR012559 This family consists of erythromycin resistance gene leader peptides. These leader peptides are involved in the transcriptional attenuation control of the synthesis of the macrolide-lincosamide -streptogramin B resistance protein. It acts as a transcriptional attenuator, in contrast to other inducible erm genes. The mRNA leader sequence can fold in either of two mutually exclusive conformations, one of which is postulated to form in the absence of induction, and to contain two rho factor-independent terminators [].; GO: 0046677 response to antibiotic
Probab=30.43  E-value=23  Score=15.95  Aligned_cols=10  Identities=20%  Similarity=0.468  Sum_probs=7.6

Q ss_pred             CceeeecCCH
Q psy627           36 SNLALNFSSK   45 (89)
Q Consensus        36 ~qv~l~F~s~   45 (89)
                      ..++|+|+++
T Consensus         3 hsmrlrfptl   12 (14)
T PF08057_consen    3 HSMRLRFPTL   12 (14)
T ss_pred             cceeeecccc
Confidence            3578999885


No 148
>cd03421 SirA_like_N SirA_like_N, a protein of unknown function with an N-terminal SirA-like domain.  The SirA, YedF, YeeD protein family is present in bacteria as well as archaea. SirA  (also known as UvrY,  and YhhP) belongs to a family of a two-component response regulators that controls secondary metabolism and virulence. The other member of this two-component system is a sensor kinase called BarA which phosphorylates SirA.  A variety of microorganisms have similar proteins, all of which contain a common CPxP sequence motif in the N-terminal region. YhhP is suggested to be important for normal cell division and growth in rich nutrient medium.  Moreover, despite a low primary sequence similarity,  the YccP structure closely resembles the non-homologous C-terminal RNA-binding domain of E. coli translation initiation factor IF3. The signature CPxP motif serves to stabilize the N-terminal helix as part of the N-capping box and might be important in mRNA-binding.
Probab=30.40  E-value=58  Score=19.08  Aligned_cols=20  Identities=30%  Similarity=0.596  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHcCccEEEecc
Q psy627           45 KEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .++-.+||+++|..+.+.+.
T Consensus        38 ~~~i~~~~~~~G~~~~~~~~   57 (67)
T cd03421          38 KENVSRFAESRGYEVSVEEK   57 (67)
T ss_pred             HHHHHHHHHHcCCEEEEEec
Confidence            46788999999999977653


No 149
>PF09840 DUF2067:  Uncharacterized protein conserved in archaea (DUF2067);  InterPro: IPR019202  This family of archaeal proteins, have no known function. 
Probab=30.40  E-value=47  Score=24.44  Aligned_cols=17  Identities=12%  Similarity=0.555  Sum_probs=15.1

Q ss_pred             eeeecCCHHHHHHHHHH
Q psy627           38 LALNFSSKEDAIQYCQK   54 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~   54 (89)
                      +.++|++.++++.||++
T Consensus         1 i~~~~~~~~E~~~fle~   17 (190)
T PF09840_consen    1 ISFKFRDDEECEEFLER   17 (190)
T ss_pred             CeEEcCChHHHHHHHHH
Confidence            46899999999999986


No 150
>cd07233 Glyoxalase_I Glyoxalase I catalyzes the isomerization of the hemithioacetal, formed by a 2-oxoaldehyde and glutathione, to S-D-lactoylglutathione. Glyoxalase I (also known as lactoylglutathione lyase; EC 4.4.1.5) is part of the glyoxalase system, a two-step system for detoxifying methylglyoxal, a side product of glycolysis. This system is responsible for the conversion of reactive, acyclic alpha-oxoaldehydes into the corresponding alpha-hydroxyacids and involves 2 enzymes, glyoxalase I and II. Glyoxalase I catalyses an intramolecular redox reaction of the hemithioacetal (formed from methylglyoxal and glutathione) to form the thioester, S-D-lactoylglutathione. This reaction involves the transfer of two hydrogen atoms from C1 to C2 of the methylglyoxal, and proceeds via an ene-diol intermediate. Glyoxalase I has a requirement for bound metal ions for catalysis. Eukaryotic glyoxalase I prefers the divalent cation zinc as cofactor, whereas Escherichia coil and other prokaryotic gly
Probab=30.39  E-value=92  Score=18.87  Aligned_cols=28  Identities=14%  Similarity=0.101  Sum_probs=23.3

Q ss_pred             CCCceeeecCCHHHHHHHHHHcCccEEE
Q psy627           34 PLSNLALNFSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        34 ~~~qv~l~F~s~e~Aiayae~~G~~Y~V   61 (89)
                      ....+.+.-++.+++++.++++|+...-
T Consensus        70 ~~~~i~~~v~did~~~~~l~~~G~~~~~   97 (121)
T cd07233          70 GFGHLAFAVDDVYAACERLEEMGVEVTK   97 (121)
T ss_pred             CeEEEEEEeCCHHHHHHHHHHCCCEEee
Confidence            3446778889999999999999999764


No 151
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes. It inhibits transcription by binding to the C-terminal domain of the alpha subunit of RNAP, disrupting complex formation between RNAP and certain transcriptional activator proteins like ResD and ComA. In response to oxidative stress, Spx can also activate transcription, making it a general regulator that exerts both positive and negative control over transcription initiation. Spx has been shown to exert redox-sensitive transcriptional control over genes like trxA (TRX) and trxB (TRX reductase), genes that function in thiol homeostasis. This redox-sensitive activity is dependent on the presence of a CXXC motif, present in some members of the Spx subfamily, that acts as a thiol/disulfide switch. Spx has also been shown to repress genes in a sulfate-dependent manner independent of the presence of the CXXC motif.
Probab=30.34  E-value=51  Score=21.49  Aligned_cols=22  Identities=23%  Similarity=0.138  Sum_probs=18.5

Q ss_pred             CCHHHHHHHHHHcCccEEEecc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ++...|+++.+.+|++|++..-
T Consensus        11 ~~c~ka~~~L~~~gi~~~~idi   32 (115)
T cd03032          11 SSCRKAKQWLEEHQIPFEERNL   32 (115)
T ss_pred             HHHHHHHHHHHHCCCceEEEec
Confidence            4567899999999999998763


No 152
>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only]
Probab=30.16  E-value=59  Score=25.40  Aligned_cols=31  Identities=19%  Similarity=0.354  Sum_probs=24.1

Q ss_pred             Cce--eeecCCHHHHHHHHHHcCccEEEeccCCC
Q psy627           36 SNL--ALNFSSKEDAIQYCQKNGWKFFVEEPKWK   67 (89)
Q Consensus        36 ~qv--~l~F~s~e~Aiayae~~G~~Y~V~~p~~~   67 (89)
                      .||  +..+.-.| -++||++|||..+.-.|-.+
T Consensus       162 NQIe~hp~~~q~e-l~~~~~~~gI~v~AysPL~~  194 (280)
T COG0656         162 NQIEYHPYLRQPE-LLPFCQRHGIAVEAYSPLAK  194 (280)
T ss_pred             EEEEeccCCCcHH-HHHHHHHcCCEEEEECCccc
Confidence            455  45555555 99999999999999888764


No 153
>KOG4213|consensus
Probab=30.12  E-value=34  Score=25.89  Aligned_cols=24  Identities=21%  Similarity=0.174  Sum_probs=21.8

Q ss_pred             ceeeecCCHHHHHHHHHHcCccEE
Q psy627           37 NLALNFSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G~~Y~   60 (89)
                      .|.+.|.+++.|-+|++.++..|-
T Consensus       152 svkv~f~tk~qa~a~~~~~e~~~~  175 (205)
T KOG4213|consen  152 SVKVTFQTKEQAFANDDTHEEKGA  175 (205)
T ss_pred             ceEEEeecHHHHHhhhhhhhhhcc
Confidence            589999999999999999988874


No 154
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional
Probab=30.10  E-value=1.2e+02  Score=23.49  Aligned_cols=41  Identities=12%  Similarity=0.292  Sum_probs=28.7

Q ss_pred             CccCCC---CCCCCCCCCCCceeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           20 RWENPL---MGWCSTGDPLSNLALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        20 ~~~dPL---MGWtss~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      -|-||.   -||..|   .......| ..++..+||++||+.+.|..-
T Consensus       200 lWsDP~~~~~~~~~~---~Rg~g~~f-g~~~~~~Fl~~n~l~~iiR~H  243 (294)
T PTZ00244        200 LWADPEDEVRGFLES---DRGVSYLF-GEDIVNDFLDMVDMDLIVRAH  243 (294)
T ss_pred             eecCcccccCCCCcC---CCCCcccc-CHHHHHHHHHHcCCcEEEEcC
Confidence            577774   355432   13455666 677899999999999999653


No 155
>PF11387 DUF2795:  Protein of unknown function (DUF2795);  InterPro: IPR021527  This family of proteins has no known function. 
Probab=30.00  E-value=58  Score=18.40  Aligned_cols=21  Identities=19%  Similarity=0.265  Sum_probs=17.6

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .|+++=|++|+++|.+=.|.+
T Consensus         8 a~k~~Lv~~A~~~gA~~~vl~   28 (44)
T PF11387_consen    8 ADKDELVRHARRNGAPDDVLD   28 (44)
T ss_pred             CCHHHHHHHHHHcCCCHHHHH
Confidence            479999999999998876654


No 156
>PHA02087 hypothetical protein
Probab=29.95  E-value=52  Score=21.35  Aligned_cols=21  Identities=14%  Similarity=0.306  Sum_probs=17.6

Q ss_pred             ceeeecCCHHHHHHHHHHcCc
Q psy627           37 NLALNFSSKEDAIQYCQKNGW   57 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G~   57 (89)
                      -+|++|.|.|---+||+-.-+
T Consensus         3 i~rvkfks~ehrk~fa~s~~y   23 (83)
T PHA02087          3 IVRVKFKSPEHRKAFAESEWY   23 (83)
T ss_pred             eEEEEcCCHHHHHHHHhhhHH
Confidence            479999999999999986543


No 157
>PRK11478 putative lyase; Provisional
Probab=29.86  E-value=76  Score=19.69  Aligned_cols=25  Identities=16%  Similarity=0.170  Sum_probs=21.9

Q ss_pred             CceeeecCCHHHHHHHHHHcCccEE
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y~   60 (89)
                      ..+.+..++.+++++.++++|+++.
T Consensus        77 ~hi~f~v~d~~~~~~~l~~~G~~~~  101 (129)
T PRK11478         77 RHLAFSVDDIDAAVAHLESHNVKCE  101 (129)
T ss_pred             eEEEEEeCCHHHHHHHHHHcCCeee
Confidence            4677888999999999999999864


No 158
>TIGR00552 nadE NAD+ synthetase. NAD+ synthetase is a nearly ubiquitous enzyme for the final step in the biosynthesis of the essensial cofactor NAD. The member of this family from Bacillus subtilis is a strictly NH(3)-dependent NAD(+) synthetase of 272 amino acids. Proteins consisting only of the domain modeled here may be named as NH3-dependent NAD+ synthetase. Amidotransferase activity may reside in a separate protein, or not be present. Some other members of the family, such as from Mycobacterium tuberculosis, are considerably longer, contain an apparent amidotransferase domain, and show glutamine-dependent as well as NH(3)-dependent activity.
Probab=29.42  E-value=44  Score=24.71  Aligned_cols=21  Identities=14%  Similarity=0.227  Sum_probs=18.4

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .+.++|.++|++.|+++.+..
T Consensus        64 ~e~~~a~~~a~~lgi~~~~i~   84 (250)
T TIGR00552        64 QDVQDALALAEPLGINYKNID   84 (250)
T ss_pred             HHHHHHHHHHHHhCCeEEEEc
Confidence            357899999999999999875


No 159
>smart00034 CLECT C-type lectin (CTL) or carbohydrate-recognition domain (CRD). Many of these domains function as calcium-dependent carbohydrate binding modules.
Probab=29.40  E-value=44  Score=20.25  Aligned_cols=19  Identities=26%  Similarity=0.384  Sum_probs=14.9

Q ss_pred             CCHHHHHHHHHHcCccEEE
Q psy627           43 SSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V   61 (89)
                      .+-++|.++|+.+|=....
T Consensus        20 ~~~~~A~~~C~~~~~~La~   38 (126)
T smart00034       20 KTWADAQAFCQSLGAHLAS   38 (126)
T ss_pred             cCHHHHHHHHHhcCCEEcc
Confidence            6789999999999854433


No 160
>TIGR03748 conj_PilL conjugative transfer region protein, TIGR03748 family. This model describes the conserved N-terminal region of a variable length protein family associated with laterally transfered regions flanked by markers of conjugative plasmid integration and/or transposition. Most members of the family have the lipoprotein signal peptide motif. A member of the family from a pathogenicity island in Salmonella enterica serovar Dublin strain was designated PilL for nomenclature consistency with a neighboring gene for the pilin structural protein PilS. However, the species distribution of this protein family tracks much better with markers of conjugal transfer than with markers of PilS-like pilin structure.
Probab=29.32  E-value=40  Score=22.97  Aligned_cols=23  Identities=22%  Similarity=0.465  Sum_probs=18.6

Q ss_pred             CCCCCc-eeeecC-----CHHHHHHHHHH
Q psy627           32 GDPLSN-LALNFS-----SKEDAIQYCQK   54 (89)
Q Consensus        32 ~D~~~q-v~l~F~-----s~e~Aiayae~   54 (89)
                      -||+.| +.+.|+     |-.||+.|.-+
T Consensus        18 ~dpL~qvv~v~~P~~~~~TVGdAl~~~L~   46 (105)
T TIGR03748        18 RDLLNQVIDITIPPSLVATVGDALRYLLR   46 (105)
T ss_pred             hChHhheeEEECCccccCCHHHHHHHHHH
Confidence            466777 589999     99999999854


No 161
>cd03593 CLECT_NK_receptors_like C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs). CLECT_NK_receptors_like: C-type lectin-like domain (CTLD) of the type found in natural killer cell receptors (NKRs), including proteins similar to oxidized low density lipoprotein (OxLDL) receptor (LOX-1), CD94, CD69, NKG2-A and -D, osteoclast inhibitory lectin (OCIL), dendritic cell-associated C-type lectin-1 (dectin-1),  human myeloid inhibitory C-type lectin-like receptor (MICL), mast cell-associated functional antigen (MAFA), killer cell lectin-like receptors: subfamily F, member 1 (KLRF1) and subfamily B, member 1 (KLRB1), and lys49 receptors.  CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins.  NKRs are variously associated with activation or inhibition of natural killer (NK) cells. Activating NKRs stimulate cytolysis by NK cells of virally infected or transformed cells; inhibitory NKRs block cytolysis up
Probab=29.15  E-value=41  Score=20.86  Aligned_cols=21  Identities=5%  Similarity=0.197  Sum_probs=16.3

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .|=++|..+|+.+|=...++.
T Consensus        20 ~~w~~A~~~C~~~g~~La~i~   40 (116)
T cd03593          20 KTWNESKEACSSKNSSLLKID   40 (116)
T ss_pred             CCHHHHHHHHHhCCCcEEEEC
Confidence            567899999999997765544


No 162
>cd03414 CbiX_SirB_C Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), C-terminal domain. SirB catalyzes the ferro-chelation of sirohydrochlorin to siroheme, the prosthetic group of sulfite and nitrite reductases. CbiX is a cobaltochelatase, responsible for the chelation of Co2+ into sirohydrochlorin, an important step in the vitamin B12 biosynthetic pathway. CbiX often contains a C-terminal histidine-rich region that may be important for metal delivery and/or storage, and may also contain an iron-sulfur center. Both CbiX and SirB are found in a wide range of bacteria.
Probab=29.00  E-value=77  Score=20.22  Aligned_cols=26  Identities=19%  Similarity=0.096  Sum_probs=21.5

Q ss_pred             eecCCHHHHHHHHHHcCccEEEeccC
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      +..++.++||+-|.++|..-.|..|-
T Consensus        42 ~~~P~~~~~l~~l~~~g~~~i~vvP~   67 (117)
T cd03414          42 ATRPSLPEALERLRALGARRVVVLPY   67 (117)
T ss_pred             CCCCCHHHHHHHHHHcCCCEEEEEec
Confidence            33578899999999999998877773


No 163
>COG1979 Uncharacterized oxidoreductases, Fe-dependent alcohol dehydrogenase family [Energy production and conversion]
Probab=28.97  E-value=34  Score=28.13  Aligned_cols=22  Identities=14%  Similarity=0.484  Sum_probs=19.3

Q ss_pred             ecCCHHHHHHHHHHcCccEEEe
Q psy627           41 NFSSKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y~V~   62 (89)
                      ++.|...||..|+++||+|.+-
T Consensus        70 ~~~Tv~kaV~i~kee~idflLA   91 (384)
T COG1979          70 RLETLMKAVEICKEENIDFLLA   91 (384)
T ss_pred             hHHHHHHHHHHHHHcCceEEEE
Confidence            4678999999999999999764


No 164
>cd00861 ProRS_anticodon_short ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria. ProRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only.
Probab=28.91  E-value=48  Score=19.97  Aligned_cols=22  Identities=5%  Similarity=-0.117  Sum_probs=16.3

Q ss_pred             cCCHHHHHHHHHHcCccEEEec
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      -.+...-+++|++.|++|.|.-
T Consensus        40 ~~~l~k~i~~a~~~g~~~~iii   61 (94)
T cd00861          40 NERPGVKFADADLIGIPYRIVV   61 (94)
T ss_pred             CCCcccchhHHHhcCCCEEEEE
Confidence            3566777888888888887755


No 165
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional
Probab=28.78  E-value=59  Score=22.39  Aligned_cols=27  Identities=11%  Similarity=0.245  Sum_probs=21.8

Q ss_pred             eeeecCCHHHHHHHHHHcCcc-EEEecc
Q psy627           38 LALNFSSKEDAIQYCQKNGWK-FFVEEP   64 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~-Y~V~~p   64 (89)
                      +.++-++.+++-+|++++|+. +.+...
T Consensus        80 v~vs~D~~~~~~~f~~~~~~~~~~~lsD  107 (167)
T PRK00522         80 LCISADLPFAQKRFCGAEGLENVITLSD  107 (167)
T ss_pred             EEEeCCCHHHHHHHHHhCCCCCceEeec
Confidence            568889999999999999998 555543


No 166
>cd00738 HGTP_anticodon HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS). In aaRSs, the anticodon binding domain is responsible for specificity in tRNA-binding, so that the activated amino acid is transferred to a ribose 3' OH group of the appropriate tRNA only. This domain is also found in the accessory subunit of mitochondrial polymerase gamma (Pol gamma b).
Probab=28.46  E-value=81  Score=18.71  Aligned_cols=22  Identities=14%  Similarity=0.042  Sum_probs=18.5

Q ss_pred             CCHHHHHHHHHHcCccEEEecc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .+....+++|++.|++|.|.-.
T Consensus        41 ~~~~k~~~~a~~~g~~~~iiig   62 (94)
T cd00738          41 RKIGKKFREADLRGVPFAVVVG   62 (94)
T ss_pred             cCHhHHHHHHHhCCCCEEEEEC
Confidence            4688899999999999977653


No 167
>KOG0638|consensus
Probab=28.33  E-value=44  Score=27.43  Aligned_cols=38  Identities=24%  Similarity=0.349  Sum_probs=31.9

Q ss_pred             CCCCC--CCCCCCCCCceeeecCCHHHHHHHHHHcCccEE
Q psy627           23 NPLMG--WCSTGDPLSNLALNFSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        23 dPLMG--Wtss~D~~~qv~l~F~s~e~Aiayae~~G~~Y~   60 (89)
                      ||++|  =..-+|+...|....++.++|+.-+..+|....
T Consensus        78 ~~~~G~~l~~HgdgvkdvafeVeD~da~~~~~va~Ga~v~  117 (381)
T KOG0638|consen   78 NSEYGDHLVKHGDGVKDVAFEVEDADAIFQEAVANGAKVV  117 (381)
T ss_pred             chhhhhhhhhcccchhceEEEecchHHHHHHHHHcCCccc
Confidence            66777  334588888999999999999999999999853


No 168
>cd00488 PCD_DCoH PCD_DCoH: The bifunctional protein pterin-4alpha-carbinolamine dehydratase (PCD), also known as DCoH  (dimerization cofactor of hepatocyte nuclear factor-1), is both a transcription activator and a metabolic enzyme.  DCoH stimulates gene expression by associating with specific DNA binding proteins such as HNF-1alpha (hepatocyte nuclear factor-1) and Xenopus enhancer of rudimentary homologue (XERH).  DCoH also catalyzes the dehydration of 4alpha- hydroxy- tetrahydrobiopterin (4alpha-OH-BH4) to quinoiddihydrobiopterin, a percursor of the phenylalanine hydroxylase cofactor BH4 (tetrahydrobiopterin). The DCoH homodimer has a saddle-shaped structure similar to that of TBP (TATA binding protein). Two DCoH proteins have been identifed in humans: DCoH1 and DCoH2. Mutations in human DCoH1 cause hyperphenylalaninemia. Loss of enzymic activity of DCoH in humans is associated with the depigmentation disorder vitiligo. DCoH1 has been reported to be overexpessed in colon cancer carc
Probab=28.19  E-value=94  Score=18.93  Aligned_cols=29  Identities=17%  Similarity=0.407  Sum_probs=19.9

Q ss_pred             CCCCCCCCCCceeeecCCHHHHHHHHHHc
Q psy627           27 GWCSTGDPLSNLALNFSSKEDAIQYCQKN   55 (89)
Q Consensus        27 GWtss~D~~~qv~l~F~s~e~Aiayae~~   55 (89)
                      ||.=..+..-.-+..|++-.+|++|+.+-
T Consensus         1 gW~~~~~~~l~r~f~f~~f~~a~~f~~~v   29 (75)
T cd00488           1 GWELADGDALERTFKFKDFKEAIAFVNRV   29 (75)
T ss_pred             CCcCCCCCcEEEEEEcCCHHHHHHHHHHH
Confidence            56554412234578899999999997763


No 169
>PF13263 PHP_C:  PHP-associated; PDB: 2Z4G_B 2YXO_B 2YZ5_A 3DCP_B.
Probab=28.08  E-value=64  Score=18.66  Aligned_cols=18  Identities=22%  Similarity=0.254  Sum_probs=12.5

Q ss_pred             HHHHHHHHHcCccEEEec
Q psy627           46 EDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        46 e~Aiayae~~G~~Y~V~~   63 (89)
                      +.|..||+++|++...-.
T Consensus         5 ~~A~~~A~~~~lp~~~gS   22 (56)
T PF13263_consen    5 RRAAELAEKYGLPFTGGS   22 (56)
T ss_dssp             -HHHHHHHHTT--EEEE-
T ss_pred             HHHHHHHHHcCCCeEeEE
Confidence            579999999999988755


No 170
>COG4668 MtlA Mannitol/fructose-specific phosphotransferase system, IIA domain [Carbohydrate transport and metabolism]
Probab=28.07  E-value=37  Score=24.35  Aligned_cols=17  Identities=29%  Similarity=0.511  Sum_probs=14.3

Q ss_pred             eeeecCCHHHHHHHHHH
Q psy627           38 LALNFSSKEDAIQYCQK   54 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~   54 (89)
                      +..++.+||+||.+|=+
T Consensus        10 l~~~~~nK~eAi~~~g~   26 (142)
T COG4668          10 LNQKAANKEEAIEFAGE   26 (142)
T ss_pred             hhhcccCHHHHHHHHHH
Confidence            46789999999999854


No 171
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains. Included in this CD is the C-terminal ACT domain of a novel protein composed of just two ACT domains, as seen in the yet uncharacterized structure (pdb 2F06) of the Bt0572 protein from Bacteroides thetaiotaomicron and related proteins. Members of this CD belong to the superfamily of ACT regulatory domains.
Probab=28.06  E-value=97  Score=17.09  Aligned_cols=24  Identities=25%  Similarity=0.293  Sum_probs=20.3

Q ss_pred             CceeeecCCHHHHHHHHHHcCccE
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y   59 (89)
                      ..+.+..++.+++.+-.+++||.+
T Consensus        41 ~~v~~~ve~~~~~~~~L~~~G~~v   64 (65)
T cd04882          41 ALLIFRTEDIEKAIEVLQERGVEL   64 (65)
T ss_pred             EEEEEEeCCHHHHHHHHHHCCceE
Confidence            457788889999999999999853


No 172
>TIGR01465 cobM_cbiF precorrin-4 C11-methyltransferase. This model represents precorrin-4 C11-methyltransferase, one of two methyltransferases commonly referred to as precorrin-3 methylase (the other is precorrin-3B C17-methyltransferase, EC 2.1.1.131). This enzyme participates in the pathway toward the biosynthesis of cobalamin and related products.
Probab=28.06  E-value=89  Score=22.25  Aligned_cols=30  Identities=23%  Similarity=0.336  Sum_probs=22.2

Q ss_pred             CCCCCCCceeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           30 STGDPLSNLALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        30 ss~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .+|||.     -|.+--.-+..++++|++++|..-
T Consensus        78 ~~GDP~-----~~~~~~~l~~~~~~~g~~veviPG  107 (229)
T TIGR01465        78 HTGDPS-----IYGAIAEQMQLLEALGIPYEVVPG  107 (229)
T ss_pred             eCcCcc-----ccccHHHHHHHHHHCCCCEEEECC
Confidence            457773     467777777888889999988753


No 173
>PTZ00480 serine/threonine-protein phosphatase; Provisional
Probab=28.03  E-value=1.2e+02  Score=24.07  Aligned_cols=40  Identities=20%  Similarity=0.488  Sum_probs=27.1

Q ss_pred             CccCCC---CCCCCCCCCCCceeeecCCHHHHHHHHHHcCccEEEec
Q psy627           20 RWENPL---MGWCSTGDPLSNLALNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        20 ~~~dPL---MGWtss~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      -|-||.   .||.-|.   ..+...| ..++..+||+++|+++.|..
T Consensus       207 lWSDP~~~~~~~~~s~---RG~g~~F-G~~~~~~Fl~~n~l~~IiR~  249 (320)
T PTZ00480        207 LWSDPDKDVQGWADNE---RGVSYVF-SQEIVQVFLKKHELDLICRA  249 (320)
T ss_pred             eecCcccccCCCccCC---CCCcccc-CHHHHHHHHHhCCCcEEEEc
Confidence            466774   3554331   2234444 57889999999999998865


No 174
>cd04448 DEP_PIKfyve DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in fungal RhoGEF (GDP/GTP exchange factor) PIKfyve-like proteins. PIKfyve contains N-terminal Fyve finger and DEP domains, a central chaperonin-like domain and a C-terminal PIPK (phosphatidylinositol phosphate kinase) domain. PIKfyve-like proteins are important phosphatidylinositol (3)-monophosphate (PtdIns(3)P)-5-kinases, producing PtdIns(3,5)P2, which plays a major role in multivesicular body (MVB) sorting and control of retrograde traffic from the vacuole back to the endosome and/or Golgi. PIKfyve itself has been shown to be play a role in regulating early-endosome-to-trans-Golgi network (TGN) retrograde trafficking.
Probab=28.02  E-value=51  Score=20.86  Aligned_cols=24  Identities=25%  Similarity=0.397  Sum_probs=18.5

Q ss_pred             cCCHHHHHHHHH---HcCccEEEeccC
Q psy627           42 FSSKEDAIQYCQ---KNGWKFFVEEPK   65 (89)
Q Consensus        42 F~s~e~Aiayae---~~G~~Y~V~~p~   65 (89)
                      ..|+++||++|.   .+|+=..|...+
T Consensus        44 ~~~R~eAv~~gq~Ll~~g~i~hV~~~~   70 (81)
T cd04448          44 AATRVQAIAIGQALLDAGWIECVSDDD   70 (81)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEecCCCC
Confidence            599999999998   567776665543


No 175
>PF11216 DUF3012:  Protein of unknown function (DUF3012);  InterPro: IPR021379  This family of proteins with unknown function is restricted to Gammaproteobacteria. 
Probab=27.86  E-value=44  Score=18.34  Aligned_cols=10  Identities=10%  Similarity=0.478  Sum_probs=8.1

Q ss_pred             CHHHHHHHHH
Q psy627           44 SKEDAIQYCQ   53 (89)
Q Consensus        44 s~e~Aiayae   53 (89)
                      |.++|.+||+
T Consensus        19 tanea~~fAK   28 (32)
T PF11216_consen   19 TANEAADFAK   28 (32)
T ss_pred             cHhHHHHHHH
Confidence            5678999987


No 176
>PF00059 Lectin_C:  Lectin C-type domain;  InterPro: IPR001304 Lectins occur in plants, animals, bacteria and viruses. Initially described for their carbohydrate-binding activity [], they are now recognised as a more diverse group of proteins, some of which are involved in protein-protein, protein-lipid or protein-nucleic acid interactions []. There are at least twelve structural families of lectins:   C-type lectins, which are Ca+-dependent.  S-type (galectins), a widespread family of glycan-binding proteins []. I-type, which have an immunoglobulin-like fold and can recognise sialic acids, other sugars and glycosaminoglycans []. P-type, which bind phosphomannosyl receptors []. Pentraxins []. (Trout) egg lectins. Calreticulin and calnexin, which act as molecular chaperones of the endoplasmic reticulum []. ERGIC-53 and VIP-36 []. Discoidins []. Eel aggutinins (fucolectins) []. Annexin lectins []. Fibrinogen-type lectins, which includes ficolins, tachylectins 5A and 5B, and Limax flavus (Spotted garden slug) agglutinin (these proteins have clear distinctions from one another, but they share a homologous fibrinogen-like domain used for carbohydrate binding). Also unclassified orphan lectins, including amphoterin, Cel-II, complement factor H, thrombospondin, sailic acid-binding lectins, adherence lectin, and cytokins (such as tumour necrosis factor and several interleukins).   C-type lectins can be further divided into seven subgroups based on additional non-lectin domains and gene structure: (I) hyalectans, (II) asialoglycoprotein receptors, (III) collectins, (IV) selectins, (V) NK group transmembrane receptors, (VI) macrophage mannose receptors, and (VII) simple (single domain) lectins []. Therefore, lectins are a diverse group of proteins, both in terms of structure and activity. Carbohydrate binding ability may have evolved independently and sporadically in numerous unrelated families, where each evolved a structure that was conserved to fulfil some other activity and function. In general, animal lectins act as recognition molecules within the immune system, their functions involving defence against pathogens, cell trafficking, immune regulation and the prevention of autoimmunity [].; GO: 0005488 binding; PDB: 1T8D_A 2H2T_B 1T8C_A 2H2R_A 1TN3_A 1RJH_A 1HTN_A 3G8K_B 2E3X_B 1UMR_D ....
Probab=27.83  E-value=43  Score=19.71  Aligned_cols=20  Identities=35%  Similarity=0.466  Sum_probs=13.8

Q ss_pred             CHHHHHHHHHHcCccEEEec
Q psy627           44 SKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~   63 (89)
                      |-++|..+|+++|=...+..
T Consensus         4 ~~~~A~~~C~~~~~~L~~i~   23 (105)
T PF00059_consen    4 TWEEAQQYCQSMGAHLASIN   23 (105)
T ss_dssp             EHHHHHHHHHHTTSEEB-GS
T ss_pred             CHHHHHHHHhcCCCEEeEeC
Confidence            35789999999876654433


No 177
>cd04442 DEP_1_DEP6 DEP (Dishevelled, Egl-10, and Pleckstrin) domain 1 found in DEP6-like proteins. DEP6 proteins contain two DEP and a PDZ domain. Their function is unknown.
Probab=27.77  E-value=51  Score=21.15  Aligned_cols=21  Identities=29%  Similarity=0.305  Sum_probs=16.1

Q ss_pred             CCHHHHHHHHH---HcCccEEEec
Q psy627           43 SSKEDAIQYCQ---KNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae---~~G~~Y~V~~   63 (89)
                      .|+++||.+|.   .+|+=-.|..
T Consensus        45 ~sR~eAv~lgq~Ll~~gvi~HV~~   68 (82)
T cd04442          45 SDRETAIKIMQKLLDHSIIHHVCD   68 (82)
T ss_pred             CCHHHHHHHHHHHHHCCCEEeccC
Confidence            79999999998   4676655543


No 178
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional
Probab=27.56  E-value=66  Score=23.87  Aligned_cols=21  Identities=19%  Similarity=0.328  Sum_probs=17.0

Q ss_pred             CHHHHHHHHHHcCccEEEecc
Q psy627           44 SKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      +.+.+.++|++.||++.|...
T Consensus        75 ~~~~~~~~~~~lgI~~~v~~~   95 (258)
T PRK10696         75 PEHVLPEYLESLGVPYHIEEQ   95 (258)
T ss_pred             CHHHHHHHHHHhCCCEEEEEe
Confidence            345678999999999998763


No 179
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism]
Probab=27.49  E-value=72  Score=26.67  Aligned_cols=34  Identities=15%  Similarity=0.329  Sum_probs=28.4

Q ss_pred             CCCCCceeeecCCHHHHHHHHHHcCccEEEeccCC
Q psy627           32 GDPLSNLALNFSSKEDAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        32 ~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p~~   66 (89)
                      .+.+.++.+. .+.|+-++||++++++..|.-|..
T Consensus        40 ~~~~~~~~~~-~~~~~lv~fA~~~~idl~vVGPE~   73 (428)
T COG0151          40 EAYLVNIEID-TDHEALVAFAKEKNVDLVVVGPEA   73 (428)
T ss_pred             hhhhccCccc-cCHHHHHHHHHHcCCCEEEECCcH
Confidence            4556666666 789999999999999999998865


No 180
>COG5171 YRB1 Ran GTPase-activating protein (Ran-binding protein) [Intracellular trafficking and secretion]
Probab=27.49  E-value=43  Score=25.31  Aligned_cols=27  Identities=33%  Similarity=0.688  Sum_probs=21.4

Q ss_pred             CCCCCCCC-----Cc-eeeecCCHHHHHHHHHH
Q psy627           28 WCSTGDPL-----SN-LALNFSSKEDAIQYCQK   54 (89)
Q Consensus        28 Wtss~D~~-----~q-v~l~F~s~e~Aiayae~   54 (89)
                      |++++|+.     .| ..++|.|.|.|-.|-|.
T Consensus       164 w~~taD~~Egea~a~tFairF~s~Ena~~FkEe  196 (211)
T COG5171         164 WMSTADTVEGEAKAQTFAIRFYSEENAKRFKEE  196 (211)
T ss_pred             EEeecccccCcceeeEEEEeeccHHHHHHHHHH
Confidence            78887764     34 48999999999998765


No 181
>cd07416 MPP_PP2B PP2B, metallophosphatase domain. PP2B (calcineurin) is a unique serine/threonine protein phosphatase in its regulation by a second messenger (calcium and calmodulin).  PP2B is involved in many biological processes including immune responses, the second messenger cAMP pathway, sodium/potassium ion transport in the nephron, cell cycle progression in lower eukaryotes, cardiac hypertrophy, and memory formation.  PP2B is highly conserved from yeast to humans, but is absent from plants.  PP2B is a heterodimer consisting of a catalytic subunit (CnA) and a regulatory subunit (CnB); CnB  contains four Ca2+ binding motifs referred to as EF hands.  The PPP (phosphoprotein phosphatase) family, to which PP2B belongs, is one of two known protein phosphatase families specific for serine and threonine.  The PPP family also includes: PP1, PP2A, PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -G
Probab=27.45  E-value=1.1e+02  Score=23.82  Aligned_cols=26  Identities=15%  Similarity=0.181  Sum_probs=20.3

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      +...|. .+++.+||++||+.+.|..-
T Consensus       216 ~g~~fG-~~~~~~Fl~~n~l~~iiR~H  241 (305)
T cd07416         216 CSYFYS-YRAVCEFLQKNNLLSIIRAH  241 (305)
T ss_pred             CceecC-HHHHHHHHHHcCCeEEEEec
Confidence            455665 47888999999999998653


No 182
>PRK12465 xylose isomerase; Provisional
Probab=27.43  E-value=74  Score=26.78  Aligned_cols=30  Identities=30%  Similarity=0.255  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHcCccEEE-eccCCCCCCcccc
Q psy627           45 KEDAIQYCQKNGWKFFV-EEPKWKTPKVKSY   74 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V-~~p~~~~~~~ksY   74 (89)
                      .+-|++|+.+.|++..+ +||++.-++.-+|
T Consensus       221 l~ma~dY~~~iGf~g~f~IEPKP~EPr~hqy  251 (445)
T PRK12465        221 LTLARDYGRSIGFKGNFLIEPKPMEPMKHQY  251 (445)
T ss_pred             HHHHHHHhHhcCCCceEEeccCCCCCCcccc
Confidence            45677899999996654 5777766666665


No 183
>PRK11235 bifunctional antitoxin/transcriptional repressor RelB; Provisional
Probab=27.32  E-value=37  Score=21.89  Aligned_cols=22  Identities=23%  Similarity=0.160  Sum_probs=17.4

Q ss_pred             ceeeecCCHHHHHHHHHHcCcc
Q psy627           37 NLALNFSSKEDAIQYCQKNGWK   58 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~~G~~   58 (89)
                      ++++.=+.|++|.+-|++.|+.
T Consensus         5 ~vRiD~~lK~~A~~vl~~lGls   26 (80)
T PRK11235          5 NVRVDDELKARAYAVLEKLGVT   26 (80)
T ss_pred             EEEeCHHHHHHHHHHHHHhCCC
Confidence            5667777788999988888875


No 184
>PRK11370 YciI-like protein; Reviewed
Probab=27.16  E-value=66  Score=20.57  Aligned_cols=18  Identities=22%  Similarity=0.320  Sum_probs=15.1

Q ss_pred             ceeeecCCHHHHHHHHHH
Q psy627           37 NLALNFSSKEDAIQYCQK   54 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~   54 (89)
                      =+-+.|+|.|+|.++.+.
T Consensus        60 ~ii~ea~s~~~a~~~~~~   77 (99)
T PRK11370         60 TVIAEFESLEAAQAWADA   77 (99)
T ss_pred             EEEEEECCHHHHHHHHHC
Confidence            456799999999999764


No 185
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC. Proteins containing a redox active CXXC motif like TRX and glutaredoxin (GRX) function as protein disulfide oxidoreductases, altering the redox state of target proteins via the reversible oxidation of the active site dithiol. ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via GRX, through a single catalytic cysteine.
Probab=27.02  E-value=57  Score=21.23  Aligned_cols=21  Identities=14%  Similarity=0.271  Sum_probs=17.8

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      ++...|.++-+.+|++|++..
T Consensus        10 ~~c~ka~~~L~~~~i~~~~id   30 (111)
T cd03036          10 STCRKAKKWLDEHGVDYTAID   30 (111)
T ss_pred             HHHHHHHHHHHHcCCceEEec
Confidence            345689999999999999876


No 186
>COG2154 Pterin-4a-carbinolamine dehydratase [Coenzyme metabolism]
Probab=26.92  E-value=80  Score=21.32  Aligned_cols=34  Identities=21%  Similarity=0.370  Sum_probs=26.7

Q ss_pred             cCCCCCCCCCCC-CCCceeeecCCHHHHHHHHHHc
Q psy627           22 ENPLMGWCSTGD-PLSNLALNFSSKEDAIQYCQKN   55 (89)
Q Consensus        22 ~dPLMGWtss~D-~~~qv~l~F~s~e~Aiayae~~   55 (89)
                      ...|-||.-..| ..-.-..+|.+-.+||+|.-+-
T Consensus        15 l~~l~gW~l~~~~~~l~r~f~FknF~~a~~F~~~v   49 (101)
T COG2154          15 LRALPGWELADDGAKLTRTFKFKNFKQAIAFVNRV   49 (101)
T ss_pred             hcCCCCCEEecCcceEEEEEEcCCHHHHHHHHHHH
Confidence            368999999988 3334479999999999997653


No 187
>PF10827 DUF2552:  Protein of unknown function (DUF2552) ;  InterPro: IPR020157 This entry contains proteins with no known function.
Probab=26.92  E-value=52  Score=21.40  Aligned_cols=16  Identities=19%  Similarity=0.322  Sum_probs=12.6

Q ss_pred             eecCCHHHHHHHHHHc
Q psy627           40 LNFSSKEDAIQYCQKN   55 (89)
Q Consensus        40 l~F~s~e~Aiayae~~   55 (89)
                      -.|++.|+||+.-..|
T Consensus        56 ~eF~tld~Ai~Wi~e~   71 (79)
T PF10827_consen   56 QEFPTLDLAIAWIGEH   71 (79)
T ss_pred             cccccHHHHHHHHHhc
Confidence            3578899999987655


No 188
>cd04449 DEP_DEPDC5-like DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in DEPDC5-like proteins. DEPDC5, in human also known as KIAA0645, is a DEP domain containing protein of unknown function.
Probab=26.74  E-value=55  Score=20.58  Aligned_cols=22  Identities=23%  Similarity=0.354  Sum_probs=16.9

Q ss_pred             cCCHHHHHHHHH---HcCccEEEec
Q psy627           42 FSSKEDAIQYCQ---KNGWKFFVEE   63 (89)
Q Consensus        42 F~s~e~Aiayae---~~G~~Y~V~~   63 (89)
                      ..|+++||++|+   .+|+=..|..
T Consensus        46 ~~~r~eAv~lgq~Ll~~g~I~hv~~   70 (83)
T cd04449          46 VDTREEAVELGQELMNEGLIEHVSG   70 (83)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEecCC
Confidence            579999999998   4677666543


No 189
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones]
Probab=26.67  E-value=71  Score=21.07  Aligned_cols=21  Identities=14%  Similarity=0.208  Sum_probs=18.2

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +....|++|-++.+++|+-++
T Consensus        13 pdca~a~eyl~rl~v~yd~Ve   33 (85)
T COG4545          13 PDCAPAVEYLERLNVDYDFVE   33 (85)
T ss_pred             cchHHHHHHHHHcCCCceeee
Confidence            556889999999999998766


No 190
>cd03409 Chelatase_Class_II Class II Chelatase: a family of ATP-independent monomeric or homodimeric enzymes that catalyze the insertion of metal into protoporphyrin rings. This family includes protoporphyrin IX ferrochelatase (HemH), sirohydrochlorin ferrochelatase (SirB) and the cobaltochelatases, CbiK and CbiX. HemH and SirB are involved in heme and siroheme biosynthesis, respectively, while the cobaltochelatases are associated with cobalamin biosynthesis. Excluded from this family are the ATP-dependent heterotrimeric chelatases (class I) and the multifunctional homodimeric enzymes with dehydrogenase and chelatase activities (class III).
Probab=26.44  E-value=95  Score=18.95  Aligned_cols=24  Identities=25%  Similarity=0.295  Sum_probs=21.3

Q ss_pred             cCCHHHHHHHHHHcCccEEEeccC
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      .++.++|++-+.+.|++-.|.-|-
T Consensus        44 ~P~i~~~l~~l~~~g~~~vvvvPl   67 (101)
T cd03409          44 GPDTEEAIRELAEEGYQRVVIVPL   67 (101)
T ss_pred             CCCHHHHHHHHHHcCCCeEEEEeC
Confidence            589999999999999998888774


No 191
>KOG1380|consensus
Probab=26.44  E-value=27  Score=28.85  Aligned_cols=12  Identities=42%  Similarity=0.994  Sum_probs=9.2

Q ss_pred             cCCCCCCCCCCC
Q psy627           22 ENPLMGWCSTGD   33 (89)
Q Consensus        22 ~dPLMGWtss~D   33 (89)
                      +-|||||...+-
T Consensus       234 IPPLMGwAAasg  245 (409)
T KOG1380|consen  234 IPPLMGWAAASG  245 (409)
T ss_pred             CCccchhhhhcc
Confidence            579999987643


No 192
>smart00633 Glyco_10 Glycosyl hydrolase family 10.
Probab=26.40  E-value=43  Score=24.70  Aligned_cols=21  Identities=29%  Similarity=0.642  Sum_probs=18.8

Q ss_pred             eeecCCHHHHHHHHHHcCccE
Q psy627           39 ALNFSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y   59 (89)
                      +..|...+.+|++|+++|+..
T Consensus        12 ~~n~~~~D~~~~~a~~~gi~v   32 (254)
T smart00633       12 QFNFSGADAIVNFAKENGIKV   32 (254)
T ss_pred             ccChHHHHHHHHHHHHCCCEE
Confidence            467899999999999999995


No 193
>PLN03181 glycosyltransferase; Provisional
Probab=26.33  E-value=48  Score=27.89  Aligned_cols=20  Identities=20%  Similarity=0.730  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHcCccEEEecc
Q psy627           45 KEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .+-=++||++||+++.+...
T Consensus       154 ikNR~dYArrHGY~lf~~~a  173 (453)
T PLN03181        154 FKNKVDYCRIHGYDIFYNNA  173 (453)
T ss_pred             HHHHHHHHHHhCCcEEEecc
Confidence            34457899999999987554


No 194
>PRK09732 hypothetical protein; Provisional
Probab=26.20  E-value=67  Score=22.34  Aligned_cols=18  Identities=22%  Similarity=0.381  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHcCccEEEe
Q psy627           45 KEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~   62 (89)
                      .++|++.|+++|++..|-
T Consensus        16 ~~aA~~~A~~~g~~v~ia   33 (134)
T PRK09732         16 IAAGQEEAQKNNWSVSIA   33 (134)
T ss_pred             HHHHHHHHHHhCCCEEEE
Confidence            367899999999987653


No 195
>KOG3048|consensus
Probab=26.20  E-value=46  Score=24.22  Aligned_cols=13  Identities=31%  Similarity=0.557  Sum_probs=11.5

Q ss_pred             CCHHHHHHHHHHc
Q psy627           43 SSKEDAIQYCQKN   55 (89)
Q Consensus        43 ~s~e~Aiayae~~   55 (89)
                      .|.|+|.+||+|.
T Consensus        97 K~~e~akdyfkRK  109 (153)
T KOG3048|consen   97 KDAEDAKDYFKRK  109 (153)
T ss_pred             echHHHHHHHHHH
Confidence            6899999999984


No 196
>PF09691 PulS_OutS:  Bacterial chaperone lipoprotein (PulS_OutS);  InterPro: IPR019114  This family comprises lipoproteins from gamma proteobacterial species: pullulanase secretion protein PulS protein of Klebsiella pneumoniae (P20440 from SWISSPROT), the lipoprotein OutS protein of Erwinia chrysanthemi (Q01567 from SWISSPROT) and the functionally uncharacterised type II secretion protein EtpO (Q7BSV3 from SWISSPROT) from Escherichia coli O157:H7. PulS and OutS have been shown to interact with and facilitate insertion of secretins into the outer membrane, suggesting a chaperone-like, or piloting function for members of this family.  In addition to the PulS/OutS proteins this entry also includes other functionally uncharacterised proteins, such as YacC from Escherischia coli (P0AA95 from SWISSPROT).; PDB: 3SOL_A 3UYM_A 3UTK_A 4A56_A.
Probab=26.14  E-value=46  Score=22.68  Aligned_cols=13  Identities=31%  Similarity=0.833  Sum_probs=9.9

Q ss_pred             HHHHHHHHcCccE
Q psy627           47 DAIQYCQKNGWKF   59 (89)
Q Consensus        47 ~Aiayae~~G~~Y   59 (89)
                      .||.+|+++||+.
T Consensus        54 ~a~~~A~~~gWd~   66 (109)
T PF09691_consen   54 AAVIFAQQRGWDT   66 (109)
T ss_dssp             HHHHHHHHTT--C
T ss_pred             HHHHHHHHcCCCc
Confidence            6999999999984


No 197
>COG0269 SgbH 3-hexulose-6-phosphate synthase and related proteins [Carbohydrate transport and metabolism]
Probab=26.02  E-value=73  Score=24.27  Aligned_cols=31  Identities=26%  Similarity=0.268  Sum_probs=25.6

Q ss_pred             CCCceeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           34 PLSNLALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        34 ~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      |+-||-|-..|+|+||..+++-+=..+|.|-
T Consensus         4 p~LQvALD~~~l~~Ai~~a~~v~~~~diiEv   34 (217)
T COG0269           4 PLLQVALDLLDLEEAIEIAEEVADYVDIIEV   34 (217)
T ss_pred             cceEeeecccCHHHHHHHHHHhhhcceEEEe
Confidence            6789999999999999999987655556553


No 198
>cd04440 DEP_2_P-Rex DEP (Dishevelled, Egl-10, and Pleckstrin) domain 2 found in P-Rex-like proteins. The P-Rex family is the guanine-nucleotide exchange factor (GEF) for the small GTPase Rac that contains an N-terminal RhoGEF domain, two DEP and PDZ domains. Rac-GEF activity is stimulated by phosphatidylinositol (3,4,5)-trisphosphate (PtdIns(3,4,5)P3), a lipid second messenger, and the G beta-gamma subunits of heterotrimeric G proteins. The DEP domains are not involved in mediating these stimuli, but may be of importance for basal and stimulated levels Rac-GEF activity.
Probab=25.98  E-value=56  Score=21.62  Aligned_cols=23  Identities=26%  Similarity=0.384  Sum_probs=18.2

Q ss_pred             cCCHHHHHHHHH---HcCccEEEecc
Q psy627           42 FSSKEDAIQYCQ---KNGWKFFVEEP   64 (89)
Q Consensus        42 F~s~e~Aiayae---~~G~~Y~V~~p   64 (89)
                      -.|+|+||.|++   .+||=-.|...
T Consensus        53 ~~tR~eAv~~gq~Ll~~gii~HV~~~   78 (93)
T cd04440          53 CRTREEAVILGVGLCNNGFMHHVLEK   78 (93)
T ss_pred             CCCHHHHHHHHHHHHhCCCEEecCCC
Confidence            469999999998   57887777643


No 199
>PF05172 Nup35_RRM:  Nup53/35/40-type RNA recognition motif;  InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT []. This family also includes Q05166 from SWISSPROT a suppressor of thermosensitive mutations in the DNA polymerase delta gene, Pol III []. The conserved central region appears to be distantly related to the RNA-binding region RNP-1 (RNA recognition motif, IPR000504 from INTERPRO), suggesting an RNA binding function for this protein.; PDB: 1WWH_C 3P3D_A.
Probab=25.87  E-value=56  Score=21.67  Aligned_cols=22  Identities=27%  Similarity=0.379  Sum_probs=19.7

Q ss_pred             eeeecCCHHHHHHHHHHcCccE
Q psy627           38 LALNFSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y   59 (89)
                      |+|+|+++.+|..--.+||--+
T Consensus        57 i~I~Y~~~~~A~rAL~~NG~i~   78 (100)
T PF05172_consen   57 IHITYDNPLSAQRALQKNGTIF   78 (100)
T ss_dssp             EEEEESSHHHHHHHHTTTTEEE
T ss_pred             EEEECCCHHHHHHHHHhCCeEE
Confidence            8999999999999999998643


No 200
>KOG2564|consensus
Probab=25.84  E-value=41  Score=27.31  Aligned_cols=22  Identities=32%  Similarity=0.365  Sum_probs=18.2

Q ss_pred             eeeecCCHHHHHHHHHHcCccE
Q psy627           38 LALNFSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y   59 (89)
                      ---.|.|.|+||..|-+.|.-=
T Consensus       199 rP~~F~Si~~Ai~W~v~sg~~R  220 (343)
T KOG2564|consen  199 RPKSFKSIEDAIEWHVRSGQLR  220 (343)
T ss_pred             CCccccchhhHHHHHhcccccc
Confidence            3457999999999999998643


No 201
>KOG0092|consensus
Probab=25.82  E-value=56  Score=24.69  Aligned_cols=52  Identities=21%  Similarity=0.423  Sum_probs=33.8

Q ss_pred             CceEEEecCCCCccCCCCCCCCC-CCCCCceeeecCCHHHHHHHHHHcCccEEEecc
Q psy627            9 NNWFIQFDTRERWENPLMGWCST-GDPLSNLALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus         9 ~~W~lefe~~~~~~dPLMGWtss-~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      +.|+.|...... .|-+|-=.|+ .|-.+...+   ..+||.+||+.+|+.|.-...
T Consensus        97 K~WvkeL~~~~~-~~~vialvGNK~DL~~~R~V---~~~ea~~yAe~~gll~~ETSA  149 (200)
T KOG0092|consen   97 KNWVKELQRQAS-PNIVIALVGNKADLLERREV---EFEEAQAYAESQGLLFFETSA  149 (200)
T ss_pred             HHHHHHHHhhCC-CCeEEEEecchhhhhhcccc---cHHHHHHHHHhcCCEEEEEec
Confidence            556666665544 5555555555 455443333   468999999999999965543


No 202
>cd04441 DEP_2_DEP6 DEP (Dishevelled, Egl-10, and Pleckstrin) domain 2 found in DEP6-like proteins. DEP6 proteins contain two DEP and a PDZ domain. Their function is unknown.
Probab=25.82  E-value=58  Score=21.10  Aligned_cols=22  Identities=27%  Similarity=0.516  Sum_probs=17.1

Q ss_pred             cCCHHHHHHHHH---HcCccEEEec
Q psy627           42 FSSKEDAIQYCQ---KNGWKFFVEE   63 (89)
Q Consensus        42 F~s~e~Aiayae---~~G~~Y~V~~   63 (89)
                      ..|+++||.+|+   .+|+=-.|..
T Consensus        48 ~~sR~eAv~lgq~Ll~~gii~HV~~   72 (85)
T cd04441          48 AESRREAVQLCRRLLEHGIIQHVSN   72 (85)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEecCC
Confidence            589999999998   4677666653


No 203
>PRK10638 glutaredoxin 3; Provisional
Probab=25.71  E-value=67  Score=19.36  Aligned_cols=22  Identities=14%  Similarity=-0.058  Sum_probs=18.2

Q ss_pred             CHHHHHHHHHHcCccEEEeccC
Q psy627           44 SKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      -...|..+.+++|++|++.+-.
T Consensus        14 ~C~~a~~~L~~~gi~y~~~dv~   35 (83)
T PRK10638         14 FCHRAKALLNSKGVSFQEIPID   35 (83)
T ss_pred             hHHHHHHHHHHcCCCcEEEECC
Confidence            4578999999999999987643


No 204
>cd03416 CbiX_SirB_N Sirohydrochlorin cobalt chelatase (CbiX) and sirohydrochlorin iron chelatase (SirB), N-terminal domain. SirB catalyzes the ferro-chelation of sirohydrochlorin to siroheme, the prosthetic group of sulfite and nitrite reductases. CbiX is a cobaltochelatase, responsible for the chelation of Co2+ into sirohydrochlorin, an important step in the vitamin B12 biosynthetic pathway. CbiX often contains a C-terminal histidine-rich region that may be important for metal delivery and/or storage, and may also contain an iron-sulfur center. Both are found in a wide range of bacteria. This subgroup also contains single domain proteins from archaea and bacteria which may represent the ancestral form of class II chelatases before domain duplication occurred.
Probab=25.55  E-value=1.1e+02  Score=18.98  Aligned_cols=26  Identities=23%  Similarity=0.170  Sum_probs=21.9

Q ss_pred             eeecCCHHHHHHHHHHcCccEEEecc
Q psy627           39 ALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ....++.++|++-+.+.|.+-.+..|
T Consensus        40 e~~~p~~~~~l~~l~~~g~~~v~vvP   65 (101)
T cd03416          40 ELAEPSLAEALDELAAQGATRIVVVP   65 (101)
T ss_pred             EcCCCCHHHHHHHHHHcCCCEEEEEe
Confidence            34568999999999999999877776


No 205
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism]
Probab=25.49  E-value=60  Score=21.91  Aligned_cols=21  Identities=14%  Similarity=0.358  Sum_probs=17.5

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .|...|.++-+.||++|++..
T Consensus        12 ~t~rka~~~L~~~gi~~~~~~   32 (117)
T COG1393          12 STCRKALAWLEEHGIEYTFID   32 (117)
T ss_pred             hHHHHHHHHHHHcCCCcEEEE
Confidence            466789999999999997653


No 206
>PF07476 MAAL_C:  Methylaspartate ammonia-lyase C-terminus;  InterPro: IPR022662  Methylaspartate ammonia-lyase 4.3.1.2 from EC catalyses the second step of fermentation of glutamate. It is a homodimer. This domain represents the C-terminal region of methylaspartate ammonia-lyase and contains a TIM barrel fold similar to the PF01188 from PFAM. This domain represents the catalytic domain and contains a metal binding site []. ; PDB: 1KKO_B 1KKR_A 3ZVI_A 1KD0_B 1KCZ_B 3ZVH_A.
Probab=25.42  E-value=60  Score=25.31  Aligned_cols=17  Identities=24%  Similarity=0.681  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHcCccEEE
Q psy627           45 KEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V   61 (89)
                      --+||-||+++|+.-.+
T Consensus       178 tieAvlyCk~~gvgaY~  194 (248)
T PF07476_consen  178 TIEAVLYCKEHGVGAYL  194 (248)
T ss_dssp             HHHHHHHHHHTT-EEEE
T ss_pred             HHHHHHHHHhcCCceee
Confidence            35899999999998665


No 207
>PRK09314 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional
Probab=25.32  E-value=65  Score=25.95  Aligned_cols=18  Identities=17%  Similarity=0.464  Sum_probs=15.8

Q ss_pred             CCHHHHHHHHHHcCccEE
Q psy627           43 SSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~   60 (89)
                      ..++++++||++||++..
T Consensus       172 a~~~~l~~fA~~h~l~~i  189 (339)
T PRK09314        172 ARRDDLEDFAKKHNLKMI  189 (339)
T ss_pred             ccHHHHHHHHHHcCCcEE
Confidence            468999999999999983


No 208
>PF01171 ATP_bind_3:  PP-loop family;  InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,]. The PP-loop motif appears to be a modified version of the P-loop of nucleotide binding domain that is involved in phosphate binding []. Named PP-motif, since it appears to be a part of a previously uncharacterised ATP pyrophophatase domain. ATP sulfurylases, Escherichia coli NtrL, and Bacillus subtilis OutB consist of this domain alone. In other proteins, the pyrophosphatase domain is associated with amidotransferase domains (type I or type II), a putative citrulline-aspartate ligase domain or a nitrilase/amidase domain.; PDB: 3A2K_A 2E89_B 2E21_D 1WY5_B 1NI5_A.
Probab=25.28  E-value=46  Score=23.09  Aligned_cols=24  Identities=25%  Similarity=0.515  Sum_probs=18.4

Q ss_pred             eecCCHHHHHHHHHHcCccEEEec
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      |-.-++++-++||+.+||+|....
T Consensus       144 Ll~~~k~ei~~~~~~~~i~~~~D~  167 (182)
T PF01171_consen  144 LLYVSKDEIRAYAKENGIPYVEDP  167 (182)
T ss_dssp             GGCS-HHHHHHHHHHTT-SSBS-C
T ss_pred             chhCCHHHHHHHHHHCCCcEEECc
Confidence            667899999999999999987643


No 209
>cd03592 CLECT_selectins_like C-type lectin-like domain (CTLD) of the type found in the type 1 transmembrane proteins:  P(platlet)-, E(endothelial)-, and L(leukocyte)- selectins (sels). CLECT_selectins_like: C-type lectin-like domain (CTLD) of the type found in the type 1 transmembrane proteins:  P(platlet)-, E(endothelial)-, and L(leukocyte)- selectins (sels).  CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins.  P- E- and L-sels are cell adhesion receptors that mediate the initial attachment, tethering, and rolling of lymphocytes on inflamed vascular walls enabling subsequent lymphocyte adhesion and transmigration.  L- sel is expressed constitutively on most leukocytes.  P-sel is stored in the Weibel-Palade bodies of endothelial cells and in the alpha granules of platlets.  E- sels are present on endothelial cells.  Following platelet and/or endothelial cell activation P- sel is rapidly translocated to the cell surface and E-sel exp
Probab=25.28  E-value=59  Score=20.40  Aligned_cols=19  Identities=21%  Similarity=0.604  Sum_probs=14.5

Q ss_pred             CCHHHHHHHHHHcCccEEE
Q psy627           43 SSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V   61 (89)
                      .|=++|.+||+++|-....
T Consensus        10 ~~w~~A~~~C~~~g~~La~   28 (115)
T cd03592          10 MTFNEAVKYCKSRGTDLVA   28 (115)
T ss_pred             cCHHHHHHHHHHcCCeEee
Confidence            3558999999999965444


No 210
>PF15649 Tox-REase-7:  Restriction endonuclease fold toxin 7
Probab=25.27  E-value=94  Score=20.28  Aligned_cols=22  Identities=23%  Similarity=0.510  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHcCccEEEeccCC
Q psy627           45 KEDAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p~~   66 (89)
                      .-+-++||+.+|.+|.+.-.+.
T Consensus        59 lr~~~~~A~~~G~~~~Lvv~~~   80 (87)
T PF15649_consen   59 LRDYVKYAKENGYRFNLVVNHR   80 (87)
T ss_pred             HHHHHHHHHHcCCcEEEEEcCC
Confidence            3578999999999998876543


No 211
>PF14555 UBA_4:  UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A.
Probab=25.23  E-value=73  Score=17.46  Aligned_cols=16  Identities=38%  Similarity=0.814  Sum_probs=13.5

Q ss_pred             CHHHHHHHHHHcCccE
Q psy627           44 SKEDAIQYCQKNGWKF   59 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y   59 (89)
                      +.+.|+.|-++++|+.
T Consensus        14 ~~~~A~~~L~~~~wdl   29 (43)
T PF14555_consen   14 DEDVAIQYLEANNWDL   29 (43)
T ss_dssp             SHHHHHHHHHHTTT-H
T ss_pred             CHHHHHHHHHHcCCCH
Confidence            6799999999999975


No 212
>PLN02923 xylose isomerase
Probab=25.19  E-value=75  Score=26.96  Aligned_cols=30  Identities=33%  Similarity=0.462  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHcCccEEE-eccCCCCCCcccc
Q psy627           45 KEDAIQYCQKNGWKFFV-EEPKWKTPKVKSY   74 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V-~~p~~~~~~~ksY   74 (89)
                      ..-|++|+++.|.+..+ +||++.-+++-.|
T Consensus       255 l~ma~dY~~~iGf~g~flIEPKP~EPtkHqY  285 (478)
T PLN02923        255 LEAAVAYKKKIGFNGTLLIEPKPQEPTKHQY  285 (478)
T ss_pred             HHHHHHHHHhcCCCceEEecCCCCCCCCCcc
Confidence            35689999999999865 6788766665555


No 213
>PF02177 APP_N:  Amyloid A4 N-terminal heparin-binding;  InterPro: IPR015849 Amyloid-beta precursor protein (APP, or A4) is associated with Alzheimer's disease (AD), because one of its breakdown products, amyloid-beta (A-beta), aggregates to form amyloid or senile plaques [, ]. Mutations in APP or in proteins that process APP have been linked with early-onset, familial AD. Individuals with Down's syndrome carry an extra copy of chromosome 21, which contains the APP gene, and almost invariably develop amyloid plaques and Alzheimer's symptoms.  APP is important for the neurogenesis and neuronal regeneration, either through the intact protein, or through its many breakdown products []. APP consists of a large N-terminal extracellular region containing heparin-binding and copper-binding sites, a short hydrophobic transmembrane domain, and a short C-terminal intracellular domain. The N-terminal region is similar in structure to cysteine-rich growth factors and appears to function as a cell surface receptor, contributing to neurite growth, neuronal adhesion, axonogenesis and cell mobility []. APP acts as a kinesin I membrane receptor to mediate the axonal transport of beta-secretase and presenilin 1. The N-terminal domain can regulate neurite outgrowth through its binding to heparin and collagen I and IV, which are components of the extracellular matrix. APP is also coupled to apoptosis-inducing pathways, and is involved in copper homeostasis/oxidative stress through copper ion reduction, where copper-metallated APP induces neuronal death []. The C-terminal intracellular domain appears to be involved in transcription regulation through protein-protein interactions. APP can promote transcription activation through binding to APBB1/Tip60, and may bind to the adaptor protein FE65 to transactivate a wide variety of different promoters. APP can be processed by different sets of enzymes:    In the non-amyloidogenic (non-plaque-forming) pathway, APP is cleaved by alpha-secretase to yield a soluble N-terminal sAPP-alpha (neuroprotective) and a membrane-bound CTF-alpha. CTF-alpha is broken-down by presenilin-containing gamma-secretase to yield soluble p3 and membrane-bound AICD (nuclear signalling).  In the amyloidogenic pathway (plaque-forming), APP is broken down by beta-secretase to yield soluble sAPP-beta and membrane-bound CTF-beta. CTF-beta is broken down by gamma-secretase to yield soluble amyloid-beta and membrane-bound AICD. Amyloid-beta is required for neuronal function, but can aggregate to form amyloid plaques that seem to disrupt brain cells by clogging points of cell-cell contact.   This entry represents a heparin-binding domain found at the N-terminal of the extracellular domain, which is itself found at the N-terminal of amyloidogenic glycoproteins such as amyloid-beta precursor protein (APP, or A4). The core of the heparin-binding domain has an unusual disulphide-rich fold, consisting of a beta-x-alpha-beta-loop-beta topology [].  More information about these protein can be found at Protein of the Month: Amyloid-beta Precursor Protein [].; GO: 0005488 binding, 0016021 integral to membrane; PDB: 3KTM_E 1MWP_A 2FKL_A 1OWT_A.
Probab=25.13  E-value=61  Score=22.00  Aligned_cols=25  Identities=24%  Similarity=0.380  Sum_probs=16.1

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEe
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~   62 (89)
                      ..-.|.++++.++||++.--+..|.
T Consensus        30 ~~~C~~~k~eIL~YCrkvYP~l~It   54 (102)
T PF02177_consen   30 SASCLKDKEEILKYCRKVYPELQIT   54 (102)
T ss_dssp             --B---SHHHHHHHHHHHSTTS-EE
T ss_pred             CccccCChHHHHHHHHHhCCCCcee
Confidence            3667899999999999987766553


No 214
>KOG2944|consensus
Probab=25.10  E-value=1.9e+02  Score=21.44  Aligned_cols=42  Identities=14%  Similarity=0.242  Sum_probs=32.6

Q ss_pred             CCCCC--CCceeeecCCHHHHHHHHHHcCccEEEeccCCCCCCcc
Q psy627           30 STGDP--LSNLALNFSSKEDAIQYCQKNGWKFFVEEPKWKTPKVK   72 (89)
Q Consensus        30 ss~D~--~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p~~~~~~~k   72 (89)
                      ++.||  ...+.+..++-++|+..-|..|+. .+..|..-++++.
T Consensus       109 gN~~prGfgHIci~V~di~sac~~lkekGV~-f~Kk~~dGk~K~i  152 (170)
T KOG2944|consen  109 GNKEPRGFGHICIEVDDINSACERLKEKGVR-FKKKLKDGKMKPI  152 (170)
T ss_pred             CCCCCCccceEEEEeCCHHHHHHHHHHhCce-eeecCCCccccce
Confidence            45666  467899999999999999999999 5666666555443


No 215
>PF03754 DUF313:  Domain of unknown function (DUF313) ;  InterPro: IPR005508 This is a family of proteins from Arabidopsis thaliana (Mouse-ear cress) with uncharacterised function.
Probab=25.09  E-value=43  Score=22.88  Aligned_cols=34  Identities=18%  Similarity=0.416  Sum_probs=28.3

Q ss_pred             CCCce-eeecCCHHHHHHH-------HHHcCccEEEeccCCC
Q psy627           34 PLSNL-ALNFSSKEDAIQY-------CQKNGWKFFVEEPKWK   67 (89)
Q Consensus        34 ~~~qv-~l~F~s~e~Aiay-------ae~~G~~Y~V~~p~~~   67 (89)
                      |.+|| ...|-|.||--+.       .+..|++..|..|...
T Consensus        43 P~~qi~~~dFLt~eE~~~i~~~~~~~~~~~Gv~V~lvdp~~~   84 (114)
T PF03754_consen   43 PFNQIIDNDFLTEEEKRIIKEEKKNNDKKKGVEVILVDPSLR   84 (114)
T ss_pred             cHHHhcccccCCHHHHHHHHHhhccCcccCCceEEEECCcCc
Confidence            45566 7889999999888       6788999999998764


No 216
>TIGR00168 infC translation initiation factor IF-3. render its expression particularly sensitive to excess of its gene product IF-3 thereby regulating its own expression
Probab=24.95  E-value=1e+02  Score=22.11  Aligned_cols=33  Identities=24%  Similarity=0.465  Sum_probs=24.2

Q ss_pred             CCHHHHHHHHHHcCccEEEeccCCC--CCCccccc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPKWK--TPKVKSYA   75 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~~~--~~~~ksYa   75 (89)
                      =+..+|++.|++.|++-....|...  .-+.-.|+
T Consensus        23 ~~~~eAl~~A~~~~lDLVev~~~a~PPVckImdy~   57 (165)
T TIGR00168        23 VSREEALEIAEEAGLDLVLISPNAKPPVCKIMDYG   57 (165)
T ss_pred             ccHHHHHHHHHHcCCcEEEECCCCCCCEEEEeeHH
Confidence            3688999999999999877776532  22444555


No 217
>TIGR00746 arcC carbamate kinase. The seed alignment for this model includes experimentally confirmed examples from a set of phylogenetically distinct species. In a neighbor-joining tree constructed from an alignment of candidate carbamate kinases and several acetylglutamate kinases, the latter group forms a clear outgroup which roots the tree of carbamate kinase-like proteins. This analysis suggests that in E. coli, the ArcC paralog YqeA may be a second isozyme, while the paralog YahI branches as an outlier and is less likely to be an authentic carbamate kinase. The homolog from Mycoplasma pneumoniae likewise branches outside the set containing known carbamate kinases and also scores below the trusted cutoff.
Probab=24.88  E-value=81  Score=24.79  Aligned_cols=21  Identities=24%  Similarity=0.491  Sum_probs=17.9

Q ss_pred             ecCCHHHHHHHHHHcCccEEE
Q psy627           41 NFSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y~V   61 (89)
                      .|-|+|+|.+.+++.||.|.-
T Consensus       131 ~~y~~~~a~~~~~~~~~~~~~  151 (310)
T TIGR00746       131 PFYTEEEAKRLAAEKGWIVKE  151 (310)
T ss_pred             CCcCHHHHHHHHHHcCCeEee
Confidence            478999999999999996544


No 218
>PRK02315 adaptor protein; Provisional
Probab=24.87  E-value=80  Score=23.62  Aligned_cols=23  Identities=22%  Similarity=0.210  Sum_probs=19.5

Q ss_pred             CCceeeecCCHHHHHHHHHHcCc
Q psy627           35 LSNLALNFSSKEDAIQYCQKNGW   57 (89)
Q Consensus        35 ~~qv~l~F~s~e~Aiayae~~G~   57 (89)
                      ..++.+.|++.|+.|++|+...+
T Consensus       138 ~~~~i~~F~d~EdvI~la~~l~~  160 (233)
T PRK02315        138 QLTYVLKFDDFEDVISLAKTLKV  160 (233)
T ss_pred             ceEEEEEcCCHHHHHHHHHhcCc
Confidence            35678999999999999998843


No 219
>PRK06746 peptide chain release factor 2; Provisional
Probab=24.72  E-value=57  Score=26.16  Aligned_cols=16  Identities=19%  Similarity=0.376  Sum_probs=13.8

Q ss_pred             HHHHHHcCccEEEecc
Q psy627           49 IQYCQKNGWKFFVEEP   64 (89)
Q Consensus        49 iayae~~G~~Y~V~~p   64 (89)
                      ..||+++||.++|.+-
T Consensus       113 ~r~a~~~g~~~evi~~  128 (326)
T PRK06746        113 TRWAEKRGFKVETVDY  128 (326)
T ss_pred             HHHHHHcCCEEEEEec
Confidence            4699999999999863


No 220
>COG0007 CysG Uroporphyrinogen-III methylase [Coenzyme metabolism]
Probab=24.53  E-value=99  Score=23.83  Aligned_cols=25  Identities=20%  Similarity=0.193  Sum_probs=20.1

Q ss_pred             ecCCHHHHHHHHHHcCccEEEeccC
Q psy627           41 NFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      -|.=--+=++++.++||+|+|..-.
T Consensus        94 iFGRggEE~~~l~~~gI~~eVVPGi  118 (244)
T COG0007          94 IFGRGGEEIEALAEAGIEFEVVPGI  118 (244)
T ss_pred             eecCcHHHHHHHHHcCCceEEeCcc
Confidence            4666667788999999999998744


No 221
>PF14370 Topo_C_assoc:  C-terminal topoisomerase domain; PDB: 1TL8_A 1K4T_A 1A36_A 1RR8_C 1T8I_A 1SC7_A 1EJ9_A 1LPQ_A 1RRJ_A 1A31_A ....
Probab=24.43  E-value=50  Score=21.12  Aligned_cols=18  Identities=6%  Similarity=0.224  Sum_probs=11.2

Q ss_pred             CCHHHHHHHHHHcCccEE
Q psy627           43 SSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~   60 (89)
                      -.+-=.||+|++++++.+
T Consensus        31 lDPRItvAWck~~~VPie   48 (71)
T PF14370_consen   31 LDPRITVAWCKRHEVPIE   48 (71)
T ss_dssp             S-HHHHHHHHHHTT--GG
T ss_pred             cCcHHHHHHHHHhCCcHH
Confidence            344457999999998743


No 222
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional
Probab=24.43  E-value=88  Score=23.10  Aligned_cols=23  Identities=4%  Similarity=0.095  Sum_probs=19.4

Q ss_pred             CHHHHHHHHHHcCccEEEeccCC
Q psy627           44 SKEDAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~p~~   66 (89)
                      ..++.+.+|+++|+.+..-.|-.
T Consensus       160 ~~~~ll~~~~~~gi~v~a~spl~  182 (267)
T PRK11172        160 QNRKVVAFAKEHGIHVTSYMTLA  182 (267)
T ss_pred             CcHHHHHHHHHCCCEEEEECCCC
Confidence            34689999999999999888764


No 223
>KOG0091|consensus
Probab=24.35  E-value=70  Score=24.21  Aligned_cols=19  Identities=21%  Similarity=0.361  Sum_probs=16.7

Q ss_pred             CHHHHHHHHHHcCccEEEe
Q psy627           44 SKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~   62 (89)
                      |.|+|..||+-+|..|.=.
T Consensus       135 t~EEaEklAa~hgM~FVET  153 (213)
T KOG0091|consen  135 TAEEAEKLAASHGMAFVET  153 (213)
T ss_pred             cHHHHHHHHHhcCceEEEe
Confidence            6899999999999998643


No 224
>cd03413 CbiK_C Anaerobic cobalamin biosynthetic cobalt chelatase (CbiK), C-terminal domain. CbiK is part of the cobalt-early path for cobalamin biosynthesis. It catalyzes the insertion of cobalt into the oxidized form of precorrin-2, factor II (sirohydrochlorin), the second step of the anaerobic branch of vitamin B12 biosynthesis. CbiK belongs to the class II family of chelatases, and is a homomeric enzyme that does not require ATP for its enzymatic activity.
Probab=24.26  E-value=1.1e+02  Score=20.01  Aligned_cols=25  Identities=20%  Similarity=0.276  Sum_probs=21.7

Q ss_pred             ecCCHHHHHHHHHHcCccEEEeccC
Q psy627           41 NFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      .+++.+++|+-+.+.|..-.+.-|-
T Consensus        40 ~~P~i~~~l~~l~~~G~~~i~lvPl   64 (103)
T cd03413          40 GYPGLDDVLAKLKKAGIKKVTLMPL   64 (103)
T ss_pred             CCCCHHHHHHHHHHcCCCEEEEEeh
Confidence            5689999999999999998777773


No 225
>PF04221 RelB:  RelB antitoxin;  InterPro: IPR007337  Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. Several toxin/antitoxin pairs may occur in a single species. RelE and RelB form a toxin-antitoxin system; RelE represses translation, probably through binding ribosomes [, ]. RelB stably binds RelE, presumably deactivating it.; PDB: 2KC8_B 2K29_A.
Probab=24.22  E-value=41  Score=21.08  Aligned_cols=20  Identities=20%  Similarity=0.218  Sum_probs=10.3

Q ss_pred             eeeecCCHHHHHHHHHHcCc
Q psy627           38 LALNFSSKEDAIQYCQKNGW   57 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~   57 (89)
                      +|+-=+.+++|.+.|+++|+
T Consensus         6 ~Rid~~lK~~a~~il~~~Gl   25 (83)
T PF04221_consen    6 VRIDEELKEEAEAILEELGL   25 (83)
T ss_dssp             EEE-HHHHHHHHHHHHHTT-
T ss_pred             EEcCHHHHHHHHHHHHHcCC
Confidence            44444556666666665543


No 226
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed
Probab=24.21  E-value=73  Score=25.29  Aligned_cols=20  Identities=25%  Similarity=0.559  Sum_probs=17.5

Q ss_pred             ecCCHHHHHHHHHHcCccEE
Q psy627           41 NFSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y~   60 (89)
                      .|-|+|+|.+.++++||.|.
T Consensus       134 ~~y~~~~a~~~~~~~g~~~~  153 (313)
T PRK12454        134 PFYDEEEAKKLAKEKGWIVK  153 (313)
T ss_pred             CCcCHHHHHHHHHHcCCEEE
Confidence            38899999999999999654


No 227
>cd00037 CLECT C-type lectin (CTL)/C-type lectin-like (CTLD) domain. CLECT: C-type lectin (CTL)/C-type lectin-like (CTLD) domain; protein domains homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins.  This group is chiefly comprised of eukaryotic CTLDs, but contains some, as yet functionally uncharacterized, bacterial CTLDs.  Many CTLDs are calcium-dependent carbohydrate binding modules; other CTLDs bind protein ligands, lipids, and inorganic surfaces, including CaCO3 and ice.  Animal C-type lectins are involved in such functions as extracellular matrix organization, endocytosis, complement activation, pathogen recognition, and cell-cell interactions. For example: mannose-binding lectin and lung surfactant proteins A and D bind carbohydrates on surfaces (e.g. pathogens, allergens, necrotic, and apoptotic cells) and mediate functions associated with killing and phagocytosis;  P (platlet)-, E (endothelial)-, and L (leukocyte)- selectins (sels) mediate the initia
Probab=24.15  E-value=68  Score=18.71  Aligned_cols=15  Identities=33%  Similarity=0.570  Sum_probs=13.3

Q ss_pred             cCCHHHHHHHHHHcC
Q psy627           42 FSSKEDAIQYCQKNG   56 (89)
Q Consensus        42 F~s~e~Aiayae~~G   56 (89)
                      ..+-++|.++|+.+|
T Consensus         9 ~~~~~~A~~~C~~~~   23 (116)
T cd00037           9 KLTWEEAQEYCRSLG   23 (116)
T ss_pred             ccCHHHHHHHHHHcC
Confidence            467899999999999


No 228
>PRK12865 YciI-like protein; Reviewed
Probab=24.14  E-value=79  Score=20.20  Aligned_cols=17  Identities=18%  Similarity=0.210  Sum_probs=14.5

Q ss_pred             eeeecCCHHHHHHHHHH
Q psy627           38 LALNFSSKEDAIQYCQK   54 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~   54 (89)
                      +-+.++|+|+|.++++.
T Consensus        55 ~i~~a~s~e~a~~~~~~   71 (97)
T PRK12865         55 VIVKAETKEAAKALADA   71 (97)
T ss_pred             EEEEcCCHHHHHHHHHc
Confidence            45799999999999874


No 229
>PF01922 SRP19:  SRP19 protein;  InterPro: IPR002778  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the SRP19 subunit. The SRP19 protein is unstructured but forms a compact core domain and two extended RNA-binding loops upon binding the signal recognition particle (SRP) RNA [].; GO: 0008312 7S RNA binding, 0006614 SRP-dependent cotranslational protein targeting to membrane, 0048500 signal recognition particle; PDB: 3DLU_A 3DLV_B 2J37_B 1MFQ_B 3KTV_D 1RY1_B 1JID_A 1KVV_A 1KVN_A 3KTW_B ....
Probab=24.14  E-value=1.7e+02  Score=19.08  Aligned_cols=25  Identities=28%  Similarity=0.395  Sum_probs=19.4

Q ss_pred             eeecCCHHHHHHHHHHcCccEEEec
Q psy627           39 ALNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .+.-++.+|=..-|++.|++++|+.
T Consensus        25 aV~~P~~~EI~~a~~~Lgl~~~~E~   49 (95)
T PF01922_consen   25 AVENPTLEEIADACKKLGLPCVVEP   49 (95)
T ss_dssp             SBSS--HHHHHHHHHHTTSEEEEET
T ss_pred             cCCCCCHHHHHHHHHHcCCCEEEcc
Confidence            3456899999999999999999763


No 230
>PF02407 Viral_Rep:  Putative viral replication protein;  InterPro: IPR003365 Proteins in this entry are essential for the replication of viral ssDNA. The closed circular ssDNA genome is first converted to a superhelical dsDNA. Rep and/or Rep' binds a specific hairpin at the genome origin of replication introducing an endonucleolytic nick within the conserved sequence 5'-AGTATTAC-3'. This initiates rolling circle replication (RCR). Following cleavage, the protein binds covalently to the 5'-phosphate of DNA as a tyrosyl ester. The cleavage gives rise to a free 3'-OH that serves as a primer for the cellular DNA polymerase. The polymerase synthesizes the (+) strand DNA by rolling circle mechanism. After one round of replication, a Rep-catalyzed nucleotidyl transfer reaction releases a circular single-stranded virus genome, thereby terminating the replication.; GO: 0016779 nucleotidyltransferase activity, 0016888 endodeoxyribonuclease activity, producing 5'-phosphomonoesters, 0042624 ATPase activity, uncoupled, 0006260 DNA replication, 0018142 protein-DNA covalent cross-linking; PDB: 2HW0_A 2HWT_A.
Probab=24.02  E-value=8.8  Score=24.85  Aligned_cols=12  Identities=50%  Similarity=0.888  Sum_probs=10.3

Q ss_pred             CCHHHHHHHHHH
Q psy627           43 SSKEDAIQYCQK   54 (89)
Q Consensus        43 ~s~e~Aiayae~   54 (89)
                      .|.++|++||.|
T Consensus        74 Gs~~qa~~YC~K   85 (86)
T PF02407_consen   74 GSDEQAREYCSK   85 (86)
T ss_dssp             TTCCHHHCCHCT
T ss_pred             CCHHHHHHHccC
Confidence            579999999976


No 231
>PF02244 Propep_M14:  Carboxypeptidase activation peptide;  InterPro: IPR003146 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The peptidases are synthesised as inactive molecules, zymogens, with propeptides that must be removed by proteolytic cleavage to activate the enzyme. Structural studies of carboxypeptidases A and B reveal the propeptide to exist as a globular domain, followed by an extended alpha-helix; this shields the catalytic site, without specifically binding to it, while the substrate-binding site is blocked by making specific contacts [, ]. Members of this propeptide family are found in the metallocarboxypeptidases: A1, A2 [], A3, A4, A5, A6, U, insect gut carboxypeptidase and B [], and and are associated with peptidases belonging to MEROPS peptidase family M14A.  Carboxypeptidases are found in abundance in pancreatic secretions. The pro-segment moiety (activation peptide) accounts for up to a quarter of the total length of the peptidase.; GO: 0004180 carboxypeptidase activity, 0006508 proteolysis; PDB: 3D68_C 3D67_B 3D66_A 1PBA_A 3GLJ_A 1NSA_A 1KWM_A 2BOA_B 1PYT_A 1JQG_A ....
Probab=24.01  E-value=1e+02  Score=18.15  Aligned_cols=29  Identities=10%  Similarity=0.090  Sum_probs=23.2

Q ss_pred             CceeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ..|.+.=...+....+.+++|+.|+|.-.
T Consensus        36 ~dv~V~p~~~~~f~~~L~~~~i~~~v~i~   64 (74)
T PF02244_consen   36 VDVMVPPEKLEEFEELLKEHGIEYEVLIE   64 (74)
T ss_dssp             EEEEEEGGGHHHHHHHHHHTT-EEEEEES
T ss_pred             EEEEECHHHHHHHHHHHHHCCCcEEEEeH
Confidence            45677777888999999999999999653


No 232
>PF14277 DUF4364:  Domain of unknown function (DUF4364)
Probab=23.89  E-value=76  Score=22.68  Aligned_cols=23  Identities=35%  Similarity=0.521  Sum_probs=19.0

Q ss_pred             CCCCCceeeecCCHHHHHHHHHH
Q psy627           32 GDPLSNLALNFSSKEDAIQYCQK   54 (89)
Q Consensus        32 ~D~~~qv~l~F~s~e~Aiayae~   54 (89)
                      +.++=.+.|.-||+|+|.+-|++
T Consensus       124 ~~~Li~l~l~vp~~~qA~~ic~n  146 (163)
T PF14277_consen  124 DSDLIDLKLNVPSEEQAEAICNN  146 (163)
T ss_pred             CceEEEEEEeCCCHHHHHHHHHH
Confidence            34455689999999999999985


No 233
>cd08914 START_STARD15-like Lipid-binding START domain of mammalian STARD15 and related proteins. This subgroup includes the steroidogenic acute regulatory protein (StAR)-related lipid transfer (START) domains of STARD15/ACOT12 (also known as cytoplasmic acetyl-CoA hydrolase/CACH, THEAL, and MGC105114) and related domains. It belongs to the START domain family, and in turn to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. STARD15/ACOT12 is a type II acetyl-CoA thioesterase; it catalyzes the hydrolysis of acyl-CoAs to free fatty acid and CoASH. Rat CACH hydrolyzes acetyl-CoA to acetate and CoA. In addition to having a START domain, most proteins in this subgroup have two tandem copies of the hotdog domain. Human STARD15/ACOT12 may have roles in cholesterol metabolism and in beta-oxidation.
Probab=23.88  E-value=78  Score=24.15  Aligned_cols=33  Identities=24%  Similarity=0.269  Sum_probs=29.9

Q ss_pred             CCCCceeeecCCHHHHHHHHHHcCccEEEeccC
Q psy627           33 DPLSNLALNFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        33 D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      ||-.|+-|+..+-++-...+..+||........
T Consensus        34 ~~~~~~~~~~~~~~~~~~~a~~~~W~l~~dkdg   66 (236)
T cd08914          34 DIGNQASLSDSNVEALKKLAAKSGWEVTSTVEK   66 (236)
T ss_pred             CCCceEEEeeCCHHHhhhhcccCCCEEEEccCC
Confidence            788899999999999999999999999887654


No 234
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family. This model represents a portion of the proteins within the larger set covered by Pfam model pfam03960. That larger family includes a glutaredoxin-dependent arsenate reductase (TIGR00014). Characterized members of this family include Spx and MgsR from Bacillus subtili. Spx is a global regulator for response to thiol-specific oxidative stress. It interacts with RNA polymerase. MgsR (modulator of the general stress response, also called YqgZ) provides a second level of regulation for more than a third of the proteins in the B. subtilis general stress regulon controlled by Sigma-B.
Probab=23.85  E-value=71  Score=20.82  Aligned_cols=22  Identities=14%  Similarity=0.261  Sum_probs=18.8

Q ss_pred             CCHHHHHHHHHHcCccEEEecc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ++...|+++.+++|++|++..-
T Consensus        10 ~~c~ka~~~L~~~~i~~~~idi   31 (117)
T TIGR01617        10 TTCKKARRWLEANGIEYQFIDI   31 (117)
T ss_pred             HHHHHHHHHHHHcCCceEEEec
Confidence            5667899999999999998764


No 235
>PRK13789 phosphoribosylamine--glycine ligase; Provisional
Probab=23.84  E-value=89  Score=25.16  Aligned_cols=25  Identities=8%  Similarity=0.251  Sum_probs=21.3

Q ss_pred             eecCCHHHHHHHHHHcCccEEEecc
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ..|.+.++|++|+++.|+++.|-..
T Consensus       127 ~~~~~~~ea~~~~~~~~~PvVVKp~  151 (426)
T PRK13789        127 KTFTEYSSSLSYLESEMLPIVIKAD  151 (426)
T ss_pred             EeeCCHHHHHHHHHhcCCCEEEEeC
Confidence            5788999999999999999887554


No 236
>COG0151 PurD Phosphoribosylamine-glycine ligase [Nucleotide transport and metabolism]
Probab=23.81  E-value=83  Score=26.32  Aligned_cols=24  Identities=25%  Similarity=0.383  Sum_probs=20.3

Q ss_pred             eecCCHHHHHHHHHHcCccEEEec
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      -.|.+.|+|.+|.++.|-++.|-.
T Consensus       122 ~~f~~~e~a~ayi~~~g~piVVKa  145 (428)
T COG0151         122 EVFTDPEEAKAYIDEKGAPIVVKA  145 (428)
T ss_pred             cccCCHHHHHHHHHHcCCCEEEec
Confidence            468899999999999999976644


No 237
>PRK09318 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional
Probab=23.79  E-value=71  Score=26.11  Aligned_cols=18  Identities=6%  Similarity=0.113  Sum_probs=15.7

Q ss_pred             CCHHHHHHHHHHcCccEE
Q psy627           43 SSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~   60 (89)
                      ..++++++||++||++..
T Consensus       159 ~~~~~~~~fA~~h~l~~i  176 (387)
T PRK09318        159 HDLDYVLKLAEKFSLPVL  176 (387)
T ss_pred             ccHHHHHHHHHHCCCcEE
Confidence            368999999999999984


No 238
>PRK00028 infC translation initiation factor IF-3; Reviewed
Probab=23.78  E-value=1.1e+02  Score=22.26  Aligned_cols=34  Identities=21%  Similarity=0.333  Sum_probs=25.4

Q ss_pred             CCHHHHHHHHHHcCccEEEeccCCC--CCCcccccc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPKWK--TPKVKSYAF   76 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~~~--~~~~ksYad   76 (89)
                      -+.++|++-|++.|++-....|...  .-+.-.|+.
T Consensus        35 ~~~~eAl~~A~~~~lDLV~v~~~~~PPVckI~dy~k   70 (177)
T PRK00028         35 VSTREALELAEEAGLDLVEISPNAKPPVCKIMDYGK   70 (177)
T ss_pred             eeHHHHHHHHHHcCCCEEEECCCCCCCEEEEEeHHH
Confidence            4688999999999999988877543  334556654


No 239
>PRK02628 nadE NAD synthetase; Reviewed
Probab=23.72  E-value=62  Score=27.79  Aligned_cols=20  Identities=15%  Similarity=0.119  Sum_probs=18.3

Q ss_pred             CHHHHHHHHHHcCccEEEec
Q psy627           44 SKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~   63 (89)
                      |.++|.++|+..|++|.+..
T Consensus       409 s~~~a~~la~~LGi~~~~i~  428 (679)
T PRK02628        409 TKNNAVALMKALGVTAREID  428 (679)
T ss_pred             HHHHHHHHHHHhCCeEEEEE
Confidence            67899999999999999875


No 240
>PF11247 DUF2675:  Protein of unknown function (DUF2675) ;  InterPro: IPR022611  Members in this family of proteins include Bacteriophage T7 gene 5.5; they have no known function. 
Probab=23.72  E-value=41  Score=22.75  Aligned_cols=21  Identities=24%  Similarity=0.403  Sum_probs=16.5

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .-.|.||+||-|+|+-=.|.+
T Consensus        56 ~G~egav~f~~k~g~R~~IKe   76 (98)
T PF11247_consen   56 HGPEGAVAFVVKQGIREAIKE   76 (98)
T ss_pred             cChHHHHHHHHHHHHHHHHHH
Confidence            347999999999998655544


No 241
>PF13539 Peptidase_M15_4:  D-alanyl-D-alanine carboxypeptidase
Probab=23.60  E-value=1e+02  Score=18.48  Aligned_cols=38  Identities=21%  Similarity=0.514  Sum_probs=24.8

Q ss_pred             EEecCCCCccCCCCCCCCCCCCCCceeeecCCHHHHHHHHHHcCcc
Q psy627           13 IQFDTRERWENPLMGWCSTGDPLSNLALNFSSKEDAIQYCQKNGWK   58 (89)
Q Consensus        13 lefe~~~~~~dPLMGWtss~D~~~qv~l~F~s~e~Aiayae~~G~~   58 (89)
                      |++.|.   .||+..|.+.-+.     -....-+..++.+++.||.
T Consensus        15 iDin~~---~np~~~~~~~~~~-----~~~~~~~~~~~~~~~~G~~   52 (67)
T PF13539_consen   15 IDINPD---ENPYIQWNGDVDG-----YKIADYKEVVAIFEKLGFR   52 (67)
T ss_pred             EEEccc---cCCeeeeCCccch-----hhhhhHHHHHHHHHhCCCE
Confidence            455433   6787777776542     2234556788999999984


No 242
>PRK06186 hypothetical protein; Validated
Probab=23.57  E-value=58  Score=24.70  Aligned_cols=18  Identities=28%  Similarity=0.573  Sum_probs=15.2

Q ss_pred             CCHHHHHHHHHHcCccEE
Q psy627           43 SSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~   60 (89)
                      +-+=.||.||..++++|-
T Consensus        69 ~Gki~ai~~Are~~iP~L   86 (229)
T PRK06186         69 DGALTAIRFARENGIPFL   86 (229)
T ss_pred             hHHHHHHHHHHHcCCCeE
Confidence            456789999999999983


No 243
>KOG0781|consensus
Probab=23.51  E-value=81  Score=27.34  Aligned_cols=23  Identities=17%  Similarity=0.354  Sum_probs=18.9

Q ss_pred             HHHHHHHHHcCccEEEeccCCCC
Q psy627           46 EDAIQYCQKNGWKFFVEEPKWKT   68 (89)
Q Consensus        46 e~Aiayae~~G~~Y~V~~p~~~~   68 (89)
                      -+||.||+++|.+..+..-..|.
T Consensus       456 k~AI~~a~~~gfDVvLiDTAGR~  478 (587)
T KOG0781|consen  456 KEAIQEARNQGFDVVLIDTAGRM  478 (587)
T ss_pred             HHHHHHHHhcCCCEEEEeccccc
Confidence            57999999999999888765543


No 244
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins such as ribonucleotide reductase. It contains a redox active CXXC motif in a TRX fold and uses a similar dithiol mechanism employed by TRXs for intramolecular disulfide bond reduction of protein substrates. Unlike TRX, GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. The flow of reducing equivalents in the GRX system goes from NADPH - GSH reductase - GSH - GRX - protein substrates. By altering the redox state of target proteins, GRX is involved in many cellular functions including DNA synthesis, signal transduction and the defense against oxidative stress. Different classes are known i
Probab=23.41  E-value=94  Score=17.80  Aligned_cols=22  Identities=14%  Similarity=-0.013  Sum_probs=18.0

Q ss_pred             CCHHHHHHHHHHcCccEEEecc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      +....|.++.+++|++|+...-
T Consensus        11 p~C~~ak~~L~~~~i~~~~i~i   32 (75)
T cd03418          11 PYCVRAKALLDKKGVDYEEIDV   32 (75)
T ss_pred             hHHHHHHHHHHHCCCcEEEEEC
Confidence            4567899999999999988653


No 245
>PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional
Probab=23.27  E-value=38  Score=27.91  Aligned_cols=40  Identities=15%  Similarity=0.302  Sum_probs=23.1

Q ss_pred             CCCCCCCCCCCCCceeeecCC---------HHHHHHHHHHcCccEEEec
Q psy627           24 PLMGWCSTGDPLSNLALNFSS---------KEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        24 PLMGWtss~D~~~qv~l~F~s---------~e~Aiayae~~G~~Y~V~~   63 (89)
                      +++.|-+.+=-+|=..--||+         ..--.++|+++|++|....
T Consensus       407 ~~~~wf~GGLN~QIEHHLFP~mp~~~y~~i~piVk~~C~k~glpY~~~~  455 (485)
T PLN03199        407 AFVDWFCGGLQYQVDHHLFPMLPRHNIAKCHALVESFCKEWGVKYHEAD  455 (485)
T ss_pred             hHHHHHhccchhhhhhhcCCCCchhhHHhhhHHHHHHHHHhCCCccccC
Confidence            466665544222222344555         2233589999999998643


No 246
>PRK13307 bifunctional formaldehyde-activating enzyme/3-hexulose-6-phosphate synthase; Provisional
Probab=23.27  E-value=77  Score=25.84  Aligned_cols=37  Identities=24%  Similarity=0.358  Sum_probs=30.2

Q ss_pred             CccCCCCCCCCC---CCCCCceeeecCCHHHHHHHHHHcC
Q psy627           20 RWENPLMGWCST---GDPLSNLALNFSSKEDAIQYCQKNG   56 (89)
Q Consensus        20 ~~~dPLMGWtss---~D~~~qv~l~F~s~e~Aiayae~~G   56 (89)
                      +-.+|+||---.   .=|+-||-|-+.|.|+|++.+++-+
T Consensus       156 ~~~h~~~~~~~~~~~~~p~L~vALD~~~~~~A~~i~~~l~  195 (391)
T PRK13307        156 RALHPIMGFKVTRLWDPPYLQVALDLPDLEEVERVLSQLP  195 (391)
T ss_pred             cccCCccccchhhhcccceEEEecCCCCHHHHHHHHHhcc
Confidence            445899997655   2257899999999999999999875


No 247
>PRK14019 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein; Provisional
Probab=23.15  E-value=67  Score=25.94  Aligned_cols=17  Identities=18%  Similarity=0.401  Sum_probs=15.4

Q ss_pred             CCHHHHHHHHHHcCccE
Q psy627           43 SSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y   59 (89)
                      .+.++|++||++||+++
T Consensus       173 ~~~~~~~~fA~~h~L~~  189 (367)
T PRK14019        173 ARLPDLEEFAKEHGLKI  189 (367)
T ss_pred             cchHHHHHHHHHcCCcE
Confidence            46899999999999998


No 248
>KOG2486|consensus
Probab=23.11  E-value=68  Score=25.89  Aligned_cols=23  Identities=13%  Similarity=0.091  Sum_probs=19.0

Q ss_pred             CCHHHHHHHHHHcCccEEEeccC
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      ++--.+|+||.+++.+|+++--+
T Consensus       235 ~~D~~~i~~~ge~~VP~t~vfTK  257 (320)
T KOG2486|consen  235 PTDNPEIAWLGENNVPMTSVFTK  257 (320)
T ss_pred             CCChHHHHHHhhcCCCeEEeeeh
Confidence            34557999999999999998754


No 249
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC. It is encoded by an ORF present in a gene cluster associated with nitrogen fixation that also encodes dinitrogenase reductase ADP-ribosyltransferase (DRAT) and dinitrogenase reductase activating glycohydrolase (DRAG). ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], using reducing equivalents derived from glutathione via glutaredoxin, through a single catalytic cysteine.
Probab=22.97  E-value=76  Score=21.07  Aligned_cols=20  Identities=10%  Similarity=0.137  Sum_probs=17.4

Q ss_pred             CHHHHHHHHHHcCccEEEec
Q psy627           44 SKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +.-.|.++-+.+|++|++..
T Consensus        12 ~crkA~~~L~~~gi~~~~~d   31 (113)
T cd03033          12 NNARQKALLEAAGHEVEVRD   31 (113)
T ss_pred             HHHHHHHHHHHcCCCcEEee
Confidence            45689999999999999876


No 250
>cd05565 PTS_IIB_lactose PTS_IIB_lactose: subunit IIB of enzyme II (EII) of the lactose-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS) found in Firmicutes as well as Actinobacteria. In this system, EII is a lactose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. The IIC and IIB domains are expressed as a single protein from the lac operon. The IIB domain fold includes a central four-stranded parallel open twisted beta-sheet flanked by alpha-helices on both sides. The seven major PTS systems with this IIB fold include lactose, chitobiose/lichenan, ascorbate, galactitol, mannitol, fructose, and a sensory system with similarity to the bacterial bgl system.
Probab=22.90  E-value=72  Score=21.02  Aligned_cols=17  Identities=6%  Similarity=-0.031  Sum_probs=14.0

Q ss_pred             HHHHHHHHcCccEEEec
Q psy627           47 DAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        47 ~Aiayae~~G~~Y~V~~   63 (89)
                      .--++|+++|++++|..
T Consensus        19 km~~~a~~~gi~~~i~a   35 (99)
T cd05565          19 ALNKGAKERGVPLEAAA   35 (99)
T ss_pred             HHHHHHHHCCCcEEEEE
Confidence            34579999999999875


No 251
>PF09633 DUF2023:  Protein of unknown function (DUF2023);  InterPro: IPR018594  This protein of approx.120 residues consists of three beta strands and five alpha helices, thought to fold into a homo-dimer. ; PDB: 2GUK_B.
Probab=22.80  E-value=99  Score=21.03  Aligned_cols=22  Identities=23%  Similarity=0.383  Sum_probs=15.5

Q ss_pred             CHHHHHHHHHHcCccEEEeccC
Q psy627           44 SKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      ..+.|++=-+++||+|.|++-.
T Consensus        26 ~~~~~~~rL~~~~I~y~iq~v~   47 (101)
T PF09633_consen   26 YEEFAIARLERQGIDYFIQPVG   47 (101)
T ss_dssp             GHHHHHHHHHHTT--EEEEE-T
T ss_pred             hHHHHHHHHHHCCCCEEEEEcC
Confidence            4567888889999999998753


No 252
>PRK00578 prfB peptide chain release factor 2; Validated
Probab=22.80  E-value=65  Score=26.14  Aligned_cols=16  Identities=19%  Similarity=0.507  Sum_probs=13.9

Q ss_pred             HHHHHHcCccEEEecc
Q psy627           49 IQYCQKNGWKFFVEEP   64 (89)
Q Consensus        49 iayae~~G~~Y~V~~p   64 (89)
                      ..||+++||.++|.+-
T Consensus       151 ~~~a~~~g~~~evi~~  166 (367)
T PRK00578        151 LRWAERHGFKVEVLDY  166 (367)
T ss_pred             HHHHHHcCCEEEEEec
Confidence            4699999999999874


No 253
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=22.76  E-value=95  Score=20.01  Aligned_cols=20  Identities=25%  Similarity=0.438  Sum_probs=15.6

Q ss_pred             CHHHHHHHHHHcCccEEEec
Q psy627           44 SKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +.++|.++|++++..|.-..
T Consensus       123 ~~~~~~~~~~~~~~~~~e~S  142 (162)
T PF00071_consen  123 SVEEAQEFAKELGVPYFEVS  142 (162)
T ss_dssp             CHHHHHHHHHHTTSEEEEEB
T ss_pred             hhhHHHHHHHHhCCEEEEEE
Confidence            46799999999998774433


No 254
>PF06356 DUF1064:  Protein of unknown function (DUF1064);  InterPro: IPR009414 This entry is represented by Bacteriophage 92, Orf34. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several phage and bacterial proteins whose functions have not been experimentally determined. Computational analysis involving sequence, predicted strucutre and genomic context suggests that these proteins may be endonucleases which function in phage genome segregation, or the repair of double-stranded breaks introduced during either this process or DNA replication [].
Probab=22.73  E-value=72  Score=21.89  Aligned_cols=43  Identities=21%  Similarity=0.339  Sum_probs=26.4

Q ss_pred             eeecCCHHHHHHHHH-----HcC--ccEEEeccC---------CCCCCcccccccCCcC
Q psy627           39 ALNFSSKEDAIQYCQ-----KNG--WKFFVEEPK---------WKTPKVKSYAFNFSWN   81 (89)
Q Consensus        39 ~l~F~s~e~Aiayae-----~~G--~~Y~V~~p~---------~~~~~~ksYadNF~~~   81 (89)
                      .+.|+|+-||-.|++     +.|  ..++++.+=         ....++..|-.-|.+.
T Consensus        13 Gi~FDSk~Ea~~Y~~Lk~~~~~g~I~~l~lQ~~f~L~~~~~~~Gk~~r~i~Y~aDF~~~   71 (118)
T PF06356_consen   13 GIKFDSKKEAEYYQELKLLERAGEISDLELQPRFELQPKFKKNGKKIRAITYIADFVYY   71 (118)
T ss_pred             CeEEccHHHHHHHHHHHHhHhcCceEEEEEeCCEEEecccccCCcEecceEEeccEEEE
Confidence            478999999998874     334  244444321         1233566787777663


No 255
>cd08578 GDPD_NUC-2_fungi Putative glycerophosphodiester phosphodiesterase domain of ankyrin repeat protein NUC-2 and similar proteins. This subfamily corresponds to a putative glycerophosphodiester phosphodiesterase domain (GDPD) present in Neurospora crassa ankyrin repeat protein NUC-2 and its Saccharomyces cerevisiae counterpart, Phosphate system positive regulatory protein PHO81. Some uncharecaterized NUC-2 sequence homologs are also included in this family. NUC-2 plays an important role in the phosphate-regulated signal transduction pathway in Neurospora crassa. It shows high similarity to a cyclin-dependent kinase inhibitory protein PHO81, which is part of the phosphate regulatory cascade in S. cerevisiae. Both NUC-2 and PHO81 have multi-domain architecture, including an SPX N-terminal domain following by several ankyrin repeats and a putative C-terminal GDPD domain with unknown function. Although the putative GDPD domain displays sequence homology to that of bacterial glycerophos
Probab=22.73  E-value=61  Score=25.30  Aligned_cols=24  Identities=13%  Similarity=0.167  Sum_probs=19.0

Q ss_pred             eecCCHHHHHHHHHHcCccEEEec
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .+=.|.++||.||..+|+-=.|..
T Consensus       226 ~r~~Si~~Av~fA~~~nL~Giv~~  249 (300)
T cd08578         226 PRSRSIKEAVRFAKNNNLLGLILP  249 (300)
T ss_pred             chhhhHHHHHHHHHHcCCcEEEec
Confidence            444689999999999998766654


No 256
>TIGR02630 xylose_isom_A xylose isomerase. Members of this family are the enzyme xylose isomerase (5.3.1.5), which interconverts D-xylose and D-xylulose.
Probab=22.70  E-value=1e+02  Score=25.87  Aligned_cols=30  Identities=37%  Similarity=0.468  Sum_probs=22.0

Q ss_pred             HHHHHHHHHHcCccEEE-eccCCCCCCcccc
Q psy627           45 KEDAIQYCQKNGWKFFV-EEPKWKTPKVKSY   74 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V-~~p~~~~~~~ksY   74 (89)
                      ...|++|+.+.|++..| +||++.-++..+|
T Consensus       210 l~~~~dYa~~iGf~~~f~IEPKP~EPr~hqy  240 (434)
T TIGR02630       210 LHMAVDYAKKIGFKGQFLIEPKPKEPTKHQY  240 (434)
T ss_pred             HHHHHHHhhhcCCCceEEeccCCCCcccccc
Confidence            45689999999996654 5777766666655


No 257
>PTZ00175 diphthine synthase; Provisional
Probab=22.70  E-value=1.4e+02  Score=22.92  Aligned_cols=29  Identities=24%  Similarity=0.323  Sum_probs=23.3

Q ss_pred             CCCCCCCceeeecCCHHHHHHHHHHcCccEEEec
Q psy627           30 STGDPLSNLALNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        30 ss~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .+|||.     -|.+--+=+..|+++|++++|..
T Consensus        83 ~~GDP~-----i~~t~~~l~~~~~~~gi~vevIP  111 (270)
T PTZ00175         83 VVGDPF-----CATTHTDLYLRAKKKGIEVEVIH  111 (270)
T ss_pred             ECCCCC-----ccCCHHHHHHHHHHCCCcEEEEC
Confidence            357774     67777777889999999999986


No 258
>PTZ00323 NAD+ synthase; Provisional
Probab=22.51  E-value=74  Score=24.82  Aligned_cols=21  Identities=10%  Similarity=-0.040  Sum_probs=18.2

Q ss_pred             CHHHHHHHHHHcCccEEEecc
Q psy627           44 SKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      +.++|..+|+..|+++.+..-
T Consensus        93 ~~~~A~~la~~lGi~~~~idi  113 (294)
T PTZ00323         93 ALNRGRENIQACGATEVTVDQ  113 (294)
T ss_pred             HHHHHHHHHHHhCCcEEEEEC
Confidence            469999999999999988763


No 259
>PF12671 Amidase_6:  Putative amidase domain
Probab=22.48  E-value=62  Score=22.38  Aligned_cols=16  Identities=19%  Similarity=0.283  Sum_probs=13.4

Q ss_pred             CHHHHHHHHHHcCccE
Q psy627           44 SKEDAIQYCQKNGWKF   59 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y   59 (89)
                      +++.||+||++.-..+
T Consensus         3 nr~~Av~YA~k~~~~~   18 (157)
T PF12671_consen    3 NRSAAVAYANKYANNP   18 (157)
T ss_pred             CHHHHHHHHHHHhcCC
Confidence            5789999999987765


No 260
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional
Probab=22.39  E-value=98  Score=21.61  Aligned_cols=49  Identities=12%  Similarity=0.156  Sum_probs=30.5

Q ss_pred             eeeec-CCHHHHHHHHHHcCccEEE-e-ccCCC---CCCcccccccCCcCCCcce
Q psy627           38 LALNF-SSKEDAIQYCQKNGWKFFV-E-EPKWK---TPKVKSYAFNFSWNKRTRT   86 (89)
Q Consensus        38 v~l~F-~s~e~Aiayae~~G~~Y~V-~-~p~~~---~~~~ksYadNF~~~r~~~~   86 (89)
                      +.+.+ ++.+++.+|.+++|++|.+ . .+...   ......+-..|..++..++
T Consensus       101 i~v~~~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~~~~gv~~~P~t~vid~~G~i  155 (185)
T PRK15412        101 VGMNYKDDRQKAISWLKELGNPYALSLFDGDGMLGLDLGVYGAPETFLIDGNGII  155 (185)
T ss_pred             EEEECCCCHHHHHHHHHHcCCCCceEEEcCCccHHHhcCCCcCCeEEEECCCceE
Confidence            35555 5678899999999999974 2 23221   2234445566777665544


No 261
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=22.38  E-value=90  Score=17.39  Aligned_cols=23  Identities=17%  Similarity=0.261  Sum_probs=18.0

Q ss_pred             CCHHHHHHHHHHcCccEEEeccC
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      +|.|+|++|-+..-|+=-+.=|+
T Consensus         1 p~e~~c~~~l~~~RW~~g~~CP~   23 (46)
T PF12760_consen    1 PDEEACREYLEEIRWPDGFVCPH   23 (46)
T ss_pred             CCHHHHHHHHHHhcCCCCCCCCC
Confidence            57899999999999986554454


No 262
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional
Probab=22.37  E-value=70  Score=21.18  Aligned_cols=20  Identities=25%  Similarity=0.260  Sum_probs=16.9

Q ss_pred             eeecCCHHHHHHHHHHcCcc
Q psy627           39 ALNFSSKEDAIQYCQKNGWK   58 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~   58 (89)
                      +|...++.+++.+|.+.|+.
T Consensus       185 Kl~~~~~~~l~~~~~~~~~~  204 (204)
T PRK09958        185 KLECKSLMDLYTFAQRNKIG  204 (204)
T ss_pred             HcCCCCHHHHHHHHHHhCCC
Confidence            57789999999999998863


No 263
>PF04343 DUF488:  Protein of unknown function, DUF488;  InterPro: IPR007438 This family includes several proteins of uncharacterised function.
Probab=22.29  E-value=1.1e+02  Score=20.06  Aligned_cols=23  Identities=17%  Similarity=0.193  Sum_probs=18.9

Q ss_pred             ecCCHHHHHHHHHHcCccEEEec
Q psy627           41 NFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        41 ~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .+-++++.-.+++.+||.|.=..
T Consensus        29 ~~~~k~~l~~~l~~~gi~Y~~~~   51 (122)
T PF04343_consen   29 PGFNKEDLASFLEEAGIEYVWLP   51 (122)
T ss_pred             CCCCHHHHHHHHHHCCceEeech
Confidence            35689999999999999996544


No 264
>PF02540 NAD_synthase:  NAD synthase;  InterPro: IPR022310 NAD+ synthase (6.3.5.1 from EC) catalyzes the last step in the biosynthesis of nicotinamide adenine dinucleotide and is induced by stress factors such as heat shock and glucose limitation. The three-dimensional structure of NH3-dependent NAD+ synthetase from Bacillus subtilis, in its free form and in complex with ATP shows that the enzyme consists of a tight homodimer with alpha/beta subunit topology []. Catalyzes the synthesis of GMP from XMP. The protein is a homodimer, but in the archaea it is a heterodimer composed of a glutamine amidotransferase subunit (A) and a GMP-binding subunit (B). This entry contains the GMP-binding subunit (B). ; PDB: 2VXO_A 3UOW_B 3N05_A 2DPL_B 3A4I_A 3SEQ_D 3SZG_A 3SYT_A 3SDB_A 3SEZ_C ....
Probab=22.29  E-value=67  Score=24.01  Aligned_cols=20  Identities=30%  Similarity=0.444  Sum_probs=17.6

Q ss_pred             CHHHHHHHHHHcCccEEEec
Q psy627           44 SKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +.++|...|++-|++|.+..
T Consensus        61 ~~~~A~~la~~lgi~~~~i~   80 (242)
T PF02540_consen   61 DIEDAKELAEKLGIEYIVID   80 (242)
T ss_dssp             HHHHHHHHHHHHTSEEEEEE
T ss_pred             HHHHHHHHHHHhCCCeeccc
Confidence            46799999999999998875


No 265
>PRK12420 histidyl-tRNA synthetase; Provisional
Probab=22.29  E-value=99  Score=24.60  Aligned_cols=22  Identities=14%  Similarity=0.252  Sum_probs=18.6

Q ss_pred             CCHHHHHHHHHHcCccEEEecc
Q psy627           43 SSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .+.+.+++||.+.|++|.|.--
T Consensus       374 ~~l~~~i~~A~~~g~~~iviig  395 (423)
T PRK12420        374 RKLKKALNYANKENIPYVLIIG  395 (423)
T ss_pred             cCHHHHHHHHHHcCCCEEEEEC
Confidence            3678999999999999988653


No 266
>PRK12677 xylose isomerase; Provisional
Probab=22.28  E-value=1.2e+02  Score=24.22  Aligned_cols=32  Identities=19%  Similarity=0.245  Sum_probs=19.7

Q ss_pred             CCCCCCCCCCceeeecCCHHHHHHHHHHcCccE
Q psy627           27 GWCSTGDPLSNLALNFSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        27 GWtss~D~~~qv~l~F~s~e~Aiayae~~G~~Y   59 (89)
                      ||.+. ||+..-...=-+.+++|+.+.+.|+..
T Consensus        16 ~~~~~-~~~g~~~~~~~~~~E~v~~~a~~Gf~g   47 (384)
T PRK12677         16 GWQGR-DPFGDATRPPLDPVEAVHKLAELGAYG   47 (384)
T ss_pred             cCCCC-CCCCCCCCCCCCHHHHHHHHHHhCCCE
Confidence            55555 776554333346777777777777553


No 267
>PRK00754 signal recognition particle protein Srp19; Provisional
Probab=22.17  E-value=1.3e+02  Score=19.82  Aligned_cols=25  Identities=28%  Similarity=0.217  Sum_probs=21.7

Q ss_pred             eeecCCHHHHHHHHHHcCccEEEec
Q psy627           39 ALNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .+.-++.+|=.+-|++.|++++|+.
T Consensus        31 aV~~P~~~EI~~a~~~lgl~~~~e~   55 (95)
T PRK00754         31 AVKEPRLEEIIEAAEKLGLNPEVEP   55 (95)
T ss_pred             hccCCCHHHHHHHHHHcCCCeEEee
Confidence            4567899999999999999998864


No 268
>cd03588 CLECT_CSPGs C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins. CLECT_CSPGs: C-type lectin-like domain (CTLD) of the type found in chondroitin sulfate proteoglycan core proteins (CSPGs) in human and chicken aggrecan, frog brevican, and zebra fish dermacan.  CTLD refers to a domain homologous to the carbohydrate-recognition domains (CRDs) of the C-type lectins.  In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA).  These aggregates contribute to the tissue's load bearing properties.  Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues.  Xenopus brevican is expressed in the notochord and the brain during early embryogenesis.  Zebra fish dermacan is expressed in dermal bones and may play a role in dermal bone development.  CSPGs do contain LINK domain(s) which bind HA.  These LINK domains are considered by one classif
Probab=22.16  E-value=73  Score=20.44  Aligned_cols=36  Identities=17%  Similarity=0.139  Sum_probs=20.9

Q ss_pred             CCCCCCCCCCceeeecCCHHHHHHHHHHcCccEEEe
Q psy627           27 GWCSTGDPLSNLALNFSSKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        27 GWtss~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~   62 (89)
                      ||+.-.+--=++...-.|-.+|..+|+.+|-...++
T Consensus         4 gw~~~~~~Cy~~~~~~~sw~~A~~~C~~~gg~La~i   39 (124)
T cd03588           4 GWDKFQGHCYRHFPDRETWEDAERRCREQQGHLSSI   39 (124)
T ss_pred             cceecCCEEEEEECCccCHHHHHHHHHhcCCEEecc
Confidence            665544321112222356789999999999665443


No 269
>CHL00199 infC translation initiation factor 3; Provisional
Probab=22.15  E-value=1.2e+02  Score=22.37  Aligned_cols=38  Identities=18%  Similarity=0.330  Sum_probs=28.2

Q ss_pred             cCCHHHHHHHHHHcCccEEEeccCC--CCCCcccccccCCc
Q psy627           42 FSSKEDAIQYCQKNGWKFFVEEPKW--KTPKVKSYAFNFSW   80 (89)
Q Consensus        42 F~s~e~Aiayae~~G~~Y~V~~p~~--~~~~~ksYadNF~~   80 (89)
                      --+..+|++-|++.|++.....|..  +.-+.-.||. |.|
T Consensus        39 v~~~~eAl~~A~~~~lDLVeVs~~a~PPVCKImdygK-~ky   78 (182)
T CHL00199         39 IFTSEQAIQLAANQGLDLVLVSEKSDPPVCRIIDYGK-YKF   78 (182)
T ss_pred             ceeHHHHHHHHHHcCCCEEEECCCCCCCeEEEeehHH-HHH
Confidence            3478899999999999998888764  3335566765 443


No 270
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes,  and related proteins, metallophosphatase domain. PP1 (protein phosphatase type 1) is a serine/threonine phosphatase that regulates many cellular processes including: cell-cycle progression, protein synthesis, muscle contraction, carbohydrate metabolism, transcription and neuronal signaling, through its interaction with at least 180 known targeting proteins.  PP1 occurs in all tissues and regulates many pathways, ranging from cell-cycle progression to carbohydrate metabolism.  Also included here are the PPKL (PP1 and kelch-like) enzymes including the PPQ, PPZ1, and PPZ2 fungal phosphatases.  These PPKLs have a large N-terminal kelch repeat in addition to a C-terminal phosphoesterase domain.  The PPP (phosphoprotein phosphatase) family, to which PP1 belongs, is one of two known protein phosphatase families specific for serine and threonine.  The PPP family also includes: PP2A, PP2B (calcineurin), PP4, PP5, PP6,  PP7, Bsu1, Rdg
Probab=22.14  E-value=2.1e+02  Score=22.07  Aligned_cols=40  Identities=18%  Similarity=0.546  Sum_probs=27.0

Q ss_pred             CccCCC---CCCCCCCCCCCceeeecCCHHHHHHHHHHcCccEEEec
Q psy627           20 RWENPL---MGWCSTGDPLSNLALNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        20 ~~~dPL---MGWtss~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      -|-||.   -||..|.   ......| ..+++.+|++++|+.+.|..
T Consensus       198 lWsDP~~~~~~~~~~~---Rg~g~~f-g~~~~~~Fl~~n~l~~iiR~  240 (293)
T cd07414         198 LWSDPDKDVQGWGEND---RGVSFTF-GKDVVAKFLNKHDLDLICRA  240 (293)
T ss_pred             hccCcccccCCCccCC---CCcceec-CHHHHHHHHHHcCCeEEEEC
Confidence            466664   3444331   2334556 56899999999999998865


No 271
>cd05564 PTS_IIB_chitobiose_lichenan PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme II (EII) of the N,N-diacetylchitobiose-specific and lichenan-specific phosphoenolpyruvate:carbohydrate phosphotransferase system (PTS). In these systems, EII is either a lichenan- or an N,N-diacetylchitobiose-specific permease with two cytoplasmic domains (IIA and IIB) and a transmembrane channel IIC domain. In the chitobiose system, these subunits are expressed as separate proteins from chbA, chbB, and chbC of the chb operon (formerly the cel (cellulose) operon). In the lichenan system, these subunits are expressed from licA, licB, and licC of the lic operon. The lic operon of Bacillus subtilis is required for the transport and degradation of oligomeric beta-glucosides, which are produced by extracellular enzymes on substrates such as lichenan or barley glucan. The lic operon is transcribed from a gammaA-dependent promoter and is inducible by lichenan, lichenan hydrolysate, and cellobiose. The IIB d
Probab=22.14  E-value=1.1e+02  Score=19.60  Aligned_cols=20  Identities=15%  Similarity=0.106  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHcCccEEEecc
Q psy627           45 KEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .+...++|+++|++|+|..-
T Consensus        16 ~~ki~~~~~~~~~~~~v~~~   35 (96)
T cd05564          16 VKKMKKAAEKRGIDAEIEAV   35 (96)
T ss_pred             HHHHHHHHHHCCCceEEEEe
Confidence            34677899999999999763


No 272
>PRK03147 thiol-disulfide oxidoreductase; Provisional
Probab=21.99  E-value=1.1e+02  Score=20.23  Aligned_cols=48  Identities=19%  Similarity=0.211  Sum_probs=31.2

Q ss_pred             eeec-CCHHHHHHHHHHcCccEEEeccCC----CCCCcccccccCCcCCCcce
Q psy627           39 ALNF-SSKEDAIQYCQKNGWKFFVEEPKW----KTPKVKSYAFNFSWNKRTRT   86 (89)
Q Consensus        39 ~l~F-~s~e~Aiayae~~G~~Y~V~~p~~----~~~~~ksYadNF~~~r~~~~   86 (89)
                      .+.. ++.++...|+++++++|.|.....    +......+-.+|..++..++
T Consensus        99 ~i~~d~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~v~~~P~~~lid~~g~i  151 (173)
T PRK03147         99 AVNVDETELAVKNFVNRYGLTFPVAIDKGRQVIDAYGVGPLPTTFLIDKDGKV  151 (173)
T ss_pred             EEEcCCCHHHHHHHHHHhCCCceEEECCcchHHHHcCCCCcCeEEEECCCCcE
Confidence            4444 356788999999999998865432    23344555667777655443


No 273
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli. E. coli ArsC catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)], the first step in the detoxification of arsenic, using reducing equivalents derived from glutathione (GSH) via glutaredoxin (GRX). ArsC contains a single catalytic cysteine, within a thioredoxin fold, that forms a covalent thiolate-As(V) intermediate, which is reduced by GRX through a mixed GSH-arsenate intermediate. This family of predominantly bacterial enzymes is unrelated to two other families of arsenate reductases which show similarity to low-molecular-weight acid phosphatases and phosphotyrosyl phosphatases.
Probab=21.89  E-value=85  Score=20.47  Aligned_cols=21  Identities=19%  Similarity=0.227  Sum_probs=17.5

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +|.-.|+++.+.+|++|++..
T Consensus        10 ~t~rkA~~~L~~~~i~~~~~d   30 (112)
T cd03034          10 SKSRNALALLEEAGIEPEIVE   30 (112)
T ss_pred             HHHHHHHHHHHHCCCCeEEEe
Confidence            355679999999999998875


No 274
>PF09363 XFP_C:  XFP C-terminal domain;  InterPro: IPR018969  Phosphoketolases (PK) are key enzymes of the pentose phosphate pathway of heterofermentative and facultative homofermentative lactic acid bacteria and of the D-fructose 6-phosphate shunt of bifidobacteria. PK activity has been sporadically reported in other microorganisms including eukaryotic yeasts. Xylulose-5-phosphate/fructose-6-phosphate phosphoketolase is a thiamine diphosphate (ThdP)-dependent enzyme found in bacteria such as Bifidobacterium sp [, ]. This enzyme has dual-specificity with the following catalytic activities:    4.1.2.9 from EC: xylose 5-P + Pi = acetyl-P + glyeraldehyde-3-P  4.1.2.22 from EC: fructose-6-P + Pi = acetyl-P + erythrose-4-P   Phosphoketolases are distantly related to transketolases, e.g. IPR005475 from INTERPRO.; GO: 0016832 aldehyde-lyase activity, 0005975 carbohydrate metabolic process; PDB: 3AI7_B 3AHC_A 3AHJ_A 3AHG_A 3AHE_A 3AHI_A 3AHD_A 3AHF_A 3AHH_A.
Probab=21.85  E-value=93  Score=23.49  Aligned_cols=18  Identities=22%  Similarity=0.248  Sum_probs=13.9

Q ss_pred             ceeeecCCHHHHHHHHHH
Q psy627           37 NLALNFSSKEDAIQYCQK   54 (89)
Q Consensus        37 qv~l~F~s~e~Aiayae~   54 (89)
                      |-...|-|.|+|++.|++
T Consensus         2 qp~pqwls~eeA~~hc~~   19 (203)
T PF09363_consen    2 QPRPQWLSMEEARAHCAA   19 (203)
T ss_dssp             SEEEE-S-HHHHHHHHHH
T ss_pred             CCCCccCCHHHHHHHHHc
Confidence            457889999999999986


No 275
>TIGR03662 Chlor_Arch_YYY Chlor_Arch_YYY domain. Members of this highly hydrophobic probable integral membrane family belong to two classes. In one, a single copy of the region modeled by This model represents essentially the full length of a strongly hydrophobic protein of about 700 to 900 residues (variable because of long inserts in some). The domain architecture of the other class consists of an additional N-terminal region, two copies of the region represented by this model, and three to four repeats of TPR, or tetratricopeptide repeat. The unusual species range includes several Archaea, several Chloroflexi, and Clostridium phytofermentans. An unusual motif YYYxG is present, and we suggest the name Chlor_Arch_YYY protein. The function is unknown.
Probab=21.77  E-value=97  Score=27.33  Aligned_cols=33  Identities=9%  Similarity=0.172  Sum_probs=27.5

Q ss_pred             eeeecC--CHHHHHHHHHHcCccEEEeccCCCCCC
Q psy627           38 LALNFS--SKEDAIQYCQKNGWKFFVEEPKWKTPK   70 (89)
Q Consensus        38 v~l~F~--s~e~Aiayae~~G~~Y~V~~p~~~~~~   70 (89)
                      |+--+.  +.+++.+..+++|++|.+..|.+|.+-
T Consensus       661 V~~IY~s~d~~~~~~Ll~kY~V~YVyVG~~ER~~Y  695 (723)
T TIGR03662       661 VETIYTSGDPTEARELLERYGVDYVYVGPLERQRY  695 (723)
T ss_pred             HHHHHcCCCHHHHHHHHHHcCCeEEEECchhhhhc
Confidence            555555  899999999999999999999888543


No 276
>TIGR00032 argG argininosuccinate synthase. argG in bacteria, ARG1 in Saccharomyces cerevisiae. There is a very unusual clustering in the alignment, with a deep split between one cohort of E. coli, H. influenzae, and Streptomyces, and the other cohort of eukaryotes, archaea, and the rest of the eubacteria.
Probab=21.74  E-value=93  Score=25.28  Aligned_cols=20  Identities=20%  Similarity=0.514  Sum_probs=18.0

Q ss_pred             CHHHHHHHHHHcCccEEEec
Q psy627           44 SKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~V~~   63 (89)
                      ++++-++||+++|+++.+..
T Consensus       147 ~r~ei~~ya~~~Gip~~~~~  166 (394)
T TIGR00032       147 TREEEIEYAIQCGIPYPMSK  166 (394)
T ss_pred             CHHHHHHHHHHcCCCeeEec
Confidence            69999999999999998754


No 277
>TIGR00268 conserved hypothetical protein TIGR00268. The N-terminal region of the model shows similarity to Argininosuccinate synthase proteins using PSI-blast and using the recognize protein identification server.
Probab=21.68  E-value=1e+02  Score=22.86  Aligned_cols=20  Identities=25%  Similarity=0.135  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHcCccEEEecc
Q psy627           45 KEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p   64 (89)
                      .++|.++|++.|++++|..-
T Consensus        54 ~~~a~~~a~~lgi~~~ii~~   73 (252)
T TIGR00268        54 LEDAIIIAKEIGVNHEFVKI   73 (252)
T ss_pred             HHHHHHHHHHcCCCEEEEEc
Confidence            47789999999999998763


No 278
>smart00740 PASTA PASTA domain.
Probab=21.64  E-value=1.4e+02  Score=16.12  Aligned_cols=20  Identities=35%  Similarity=0.248  Sum_probs=17.2

Q ss_pred             CCHHHHHHHHHHcCccEEEe
Q psy627           43 SSKEDAIQYCQKNGWKFFVE   62 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~   62 (89)
                      .+.++|.+.++..|+...+.
T Consensus        13 ~~~~~a~~~l~~~g~~~~~~   32 (66)
T smart00740       13 LSKEEAKKLLKALGLKVEVV   32 (66)
T ss_pred             CCHHHHHHHHHHCCCEEEEE
Confidence            57889999999999988776


No 279
>TIGR03645 glyox_marine lactoylglutathione lyase family protein. Members of this protein family share homology with lactoylglutathione lyase (glyoxalase I) and are found mainly in marine members of the gammaproteobacteria, including CPS_0532 from Colwellia psychrerythraea 34H. This family excludes a well-separated, more narrowly distributed paralogous family, exemplified by CPS_3492 from C. psychrerythraea. The function is of this protein family is unknown.
Probab=21.61  E-value=1.2e+02  Score=20.51  Aligned_cols=24  Identities=13%  Similarity=-0.013  Sum_probs=19.0

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEE
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFV   61 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V   61 (89)
                      +.+.-++.|++++-++++|+...+
T Consensus        97 la~~v~dida~~~~l~~~G~~~~~  120 (162)
T TIGR03645        97 FCVQDPDVEGLAERIVAAGGKKRM  120 (162)
T ss_pred             EEEEcCCHHHHHHHHHHcCCcccC
Confidence            444448899999999999988544


No 280
>TIGR02190 GlrX-dom Glutaredoxin-family domain. This C-terminal domain with homology to glutaredoxin is fused to an N-terminal peroxiredoxin-like domain.
Probab=21.54  E-value=99  Score=18.52  Aligned_cols=21  Identities=14%  Similarity=0.077  Sum_probs=17.8

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +-...|.++.+++|++|++..
T Consensus        19 p~C~~ak~~L~~~gi~y~~id   39 (79)
T TIGR02190        19 PFCAKAKATLKEKGYDFEEIP   39 (79)
T ss_pred             HhHHHHHHHHHHcCCCcEEEE
Confidence            346789999999999999865


No 281
>PRK05474 xylose isomerase; Provisional
Probab=21.50  E-value=1.1e+02  Score=25.58  Aligned_cols=29  Identities=31%  Similarity=0.440  Sum_probs=22.2

Q ss_pred             HHHHHHHHHcCccEEE-eccCCCCCCcccc
Q psy627           46 EDAIQYCQKNGWKFFV-EEPKWKTPKVKSY   74 (89)
Q Consensus        46 e~Aiayae~~G~~Y~V-~~p~~~~~~~ksY   74 (89)
                      ..+++|+.+.|++..+ +||++.-++.-+|
T Consensus       212 ~~v~dYa~~iGf~~~f~IEPKP~EPr~hqy  241 (437)
T PRK05474        212 QMVVDYKHKIGFKGTFLIEPKPQEPTKHQY  241 (437)
T ss_pred             HHHHHHhhhcCCCceEEeccCCCCCCCccc
Confidence            4679999999996654 6788777777776


No 282
>TIGR01004 PulS_OutS lipoprotein, PulS/OutS family. This family comprises lipoproteins from four gamma proteobacterial species: PulS protein of Klebsiella pneumoniae, the OutS protein of Erwinia chrysanthemi and Pectobacterium chrysanthemi, and the functionally uncharacterized E. coli protein EtpO. PulS and OutS have been shown to interact with and facilitate insertion of secretins into the outer membrane, suggesting a chaperone-like, or piloting function for members of this family.
Probab=21.47  E-value=64  Score=22.76  Aligned_cols=13  Identities=23%  Similarity=0.412  Sum_probs=11.6

Q ss_pred             HHHHHHHHcCccE
Q psy627           47 DAIQYCQKNGWKF   59 (89)
Q Consensus        47 ~Aiayae~~G~~Y   59 (89)
                      .||.||+.+||+-
T Consensus        70 aai~~A~~~gWd~   82 (128)
T TIGR01004        70 TANNVAIGKGWDS   82 (128)
T ss_pred             HHHHHHHHcCCch
Confidence            7999999999964


No 283
>PRK13813 orotidine 5'-phosphate decarboxylase; Provisional
Probab=21.46  E-value=1.1e+02  Score=21.75  Aligned_cols=34  Identities=18%  Similarity=0.085  Sum_probs=25.3

Q ss_pred             CCCCCceeeecCCHHHHHHHHHHcCccEEEeccC
Q psy627           32 GDPLSNLALNFSSKEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        32 ~D~~~qv~l~F~s~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      .||.-||-|-+.|.++|++.+++-+=...+.++.
T Consensus         2 ~~~~l~~alD~~~~~~~~~~~~~~~~~~~~vk~g   35 (215)
T PRK13813          2 KDSRIILALDVTDRERALKIAEELDDYVDAIKVG   35 (215)
T ss_pred             CCCCEEEEeCCCCHHHHHHHHHhccccCCEEEEc
Confidence            4677789999999999999999875332344443


No 284
>TIGR00442 hisS histidyl-tRNA synthetase. This model finds a histidyl-tRNA synthetase in every completed genome. Apparent second copies from Bacillus subtilis, Synechocystis sp., and Aquifex aeolicus are slightly shorter, more closely related to each other than to other hisS proteins, and actually serve as regulatory subunits for an enzyme of histidine biosynthesis. They were excluded from the seed alignment and score much lower than do single copy histidyl-tRNA synthetases of other genomes not included in the seed alignment. These putative second copies of HisS score below the trusted cutoff. The regulatory protein kinase GCN2 of Saccharomyces cerevisiae (YDR283c), and related proteins from other species designated eIF-2 alpha kinase, have a domain closely related to histidyl-tRNA synthetase that may serve to detect and respond to uncharged tRNA(his), an indicator of amino acid starvation; these regulatory proteins are not orthologous and so score below the noise cutoff.
Probab=21.41  E-value=1.1e+02  Score=23.80  Aligned_cols=21  Identities=24%  Similarity=0.339  Sum_probs=18.3

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      .+.+++++||++.|++|.|.-
T Consensus       359 ~~l~k~~~~a~~~g~~~~i~i  379 (397)
T TIGR00442       359 RKLKKQLKYADKLGARFAVIL  379 (397)
T ss_pred             CCHHHHHHHHHHcCCCEEEEE
Confidence            357899999999999998865


No 285
>PRK13011 formyltetrahydrofolate deformylase; Reviewed
Probab=21.34  E-value=1.2e+02  Score=23.35  Aligned_cols=29  Identities=14%  Similarity=0.015  Sum_probs=24.2

Q ss_pred             CceeeecCCHHHHHHHHHHcCccEEEecc
Q psy627           36 SNLALNFSSKEDAIQYCQKNGWKFFVEEP   64 (89)
Q Consensus        36 ~qv~l~F~s~e~Aiayae~~G~~Y~V~~p   64 (89)
                      ..|.+-+.++.+|-+.|+++||++.+...
T Consensus       117 ~~i~~visn~~~~~~lA~~~gIp~~~~~~  145 (286)
T PRK13011        117 MDIVGVVSNHPDLEPLAAWHGIPFHHFPI  145 (286)
T ss_pred             cEEEEEEECCccHHHHHHHhCCCEEEeCC
Confidence            45777788888999999999999987643


No 286
>PRK05589 peptide chain release factor 2; Provisional
Probab=21.19  E-value=74  Score=25.47  Aligned_cols=16  Identities=19%  Similarity=0.461  Sum_probs=14.0

Q ss_pred             HHHHHHcCccEEEecc
Q psy627           49 IQYCQKNGWKFFVEEP   64 (89)
Q Consensus        49 iayae~~G~~Y~V~~p   64 (89)
                      ..||+++||.++|.+-
T Consensus       112 ~~~a~~~g~~~~vi~~  127 (325)
T PRK05589        112 TRWAEKKGYKVEIIDL  127 (325)
T ss_pred             HHHHHHcCCEEEEEec
Confidence            4699999999999874


No 287
>PRK04247 hypothetical protein; Provisional
Probab=21.19  E-value=1.1e+02  Score=23.58  Aligned_cols=22  Identities=27%  Similarity=0.382  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHcCccEEEeccCC
Q psy627           45 KEDAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p~~   66 (89)
                      .+.|..+|+..|++|...+|..
T Consensus       216 ~~~A~~ll~~~Gle~~~l~p~~  237 (238)
T PRK04247        216 TDRARRLLEKEGLEFVKLEPPK  237 (238)
T ss_pred             CHHHHHHHHHcCCeEEEecCCC
Confidence            5789999999999999988853


No 288
>COG0504 PyrG CTP synthase (UTP-ammonia lyase) [Nucleotide transport and metabolism]
Probab=21.00  E-value=65  Score=27.66  Aligned_cols=17  Identities=35%  Similarity=0.595  Sum_probs=14.6

Q ss_pred             CHHHHHHHHHHcCccEE
Q psy627           44 SKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~   60 (89)
                      -+=.||+||..|+++|-
T Consensus       360 GkI~Ai~yAREn~iP~l  376 (533)
T COG0504         360 GKIAAIRYARENNIPFL  376 (533)
T ss_pred             HHHHHHHHHHhcCCCEE
Confidence            35689999999999984


No 289
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified. PRXs are thiol-specific antioxidant (TSA) proteins also known as TRX peroxidases and alkyl hydroperoxide reductase C22 (AhpC) proteins. They confer a protective antioxidant role in cells through their peroxidase activity in which hydrogen peroxide, peroxynitrate, and organic hydroperoxides are reduced and detoxified using reducing equivalents derived from either TRX, glutathione, trypanothione and AhpF. They are distinct from other peroxidases in that they have no cofactors such as metals or prosthetic groups. The first step of catalysis, common to all PRXs, is the nucleophilic attack by the catalytic cysteine (also known as the peroxidatic cysteine) on the peroxide leading to cleavage of the oxygen-oxygen bond and the formation of a 
Probab=20.92  E-value=1.4e+02  Score=18.89  Aligned_cols=27  Identities=19%  Similarity=0.270  Sum_probs=23.2

Q ss_pred             eeeecCCHHHHHHHHHHc-CccEEEecc
Q psy627           38 LALNFSSKEDAIQYCQKN-GWKFFVEEP   64 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~-G~~Y~V~~p   64 (89)
                      +.+..++.+++-+|++++ +..|.+...
T Consensus        60 i~is~d~~~~~~~~~~~~~~~~~~~l~D   87 (140)
T cd02971          60 LGVSVDSPFSHKAWAEKEGGLNFPLLSD   87 (140)
T ss_pred             EEEeCCCHHHHHHHHhcccCCCceEEEC
Confidence            567788999999999999 999988764


No 290
>KOG1502|consensus
Probab=20.91  E-value=98  Score=24.83  Aligned_cols=21  Identities=19%  Similarity=0.472  Sum_probs=18.5

Q ss_pred             HHHHHHHHHHcCccEEEeccC
Q psy627           45 KEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      ..+|-+||+++|++..+.-|.
T Consensus       172 EkaAw~fa~e~~~~lv~inP~  192 (327)
T KOG1502|consen  172 EKAAWEFAKENGLDLVTINPG  192 (327)
T ss_pred             HHHHHHHHHhCCccEEEecCC
Confidence            478999999999999988874


No 291
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain. RdgC (retinal degeneration C) is a vertebrate serine-threonine protein phosphatase that is required to prevent light-induced retinal degeneration.  In addition to its catalytic domain, RdgC has two C-terminal EF hands.  Homologs of RdgC include the human phosphatases protein phosphatase with EF hands 1 and -2 (PPEF-1 and -2).  PPEF-1 transcripts are present at low levels in the retina, PPEF-2 transcripts and PPEF-2 protein are present at high levels in photoreceptors.  The PPP (phosphoprotein phosphatase) family, to which RdgC belongs, is one of two known protein phosphatase families specific for serine and threonine.  The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all
Probab=20.89  E-value=1.9e+02  Score=22.82  Aligned_cols=25  Identities=16%  Similarity=0.246  Sum_probs=20.0

Q ss_pred             eeeecCCHHHHHHHHHHcCccEEEec
Q psy627           38 LALNFSSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        38 v~l~F~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      ....|. .++..+||++||+.+.|..
T Consensus       247 ~g~~FG-~~~~~~Fl~~n~l~~IIR~  271 (321)
T cd07420         247 GGCYFG-PDVTSKVLQKHGLSLLIRS  271 (321)
T ss_pred             CccccC-HHHHHHHHHHCCCcEEEEc
Confidence            455565 7777799999999999865


No 292
>PRK11070 ssDNA exonuclease RecJ; Provisional
Probab=20.88  E-value=1e+02  Score=26.23  Aligned_cols=21  Identities=10%  Similarity=0.184  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHcCccEEEeccC
Q psy627           45 KEDAIQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        45 ~e~Aiayae~~G~~Y~V~~p~   65 (89)
                      --++|+||+.+|++..|..-|
T Consensus       140 ~~e~i~~a~~~gidvIVtDHH  160 (575)
T PRK11070        140 SHAGVAHAHALGIPVLVTDHH  160 (575)
T ss_pred             CHHHHHHHHHCCCCEEEECCC
Confidence            467999999999999997744


No 293
>PF13380 CoA_binding_2:  CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A.
Probab=20.78  E-value=90  Score=20.52  Aligned_cols=17  Identities=18%  Similarity=0.403  Sum_probs=11.9

Q ss_pred             CCHHHHHHHHHHcCccE
Q psy627           43 SSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y   59 (89)
                      ...++++++|+++|+.+
T Consensus        89 ~~~~~~~~~a~~~gi~v  105 (116)
T PF13380_consen   89 AESEELIEAAREAGIRV  105 (116)
T ss_dssp             S--HHHHHHHHHTT-EE
T ss_pred             hHHHHHHHHHHHcCCEE
Confidence            45688999999999874


No 294
>TIGR00068 glyox_I lactoylglutathione lyase. Glyoxylase I is a homodimer in many species. In some eukaryotes, including yeasts and plants, the orthologous protein carries a tandem duplication, is twice as long, and hits this model twice.
Probab=20.76  E-value=1.2e+02  Score=19.95  Aligned_cols=26  Identities=12%  Similarity=0.157  Sum_probs=21.9

Q ss_pred             CCceeeecCCHHHHHHHHHHcCccEE
Q psy627           35 LSNLALNFSSKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        35 ~~qv~l~F~s~e~Aiayae~~G~~Y~   60 (89)
                      ..++.+..++.+++++.++++|+...
T Consensus        87 ~~hi~f~v~dld~~~~~l~~~G~~~~  112 (150)
T TIGR00068        87 FGHIAIGVDDVYKACERVRALGGNVV  112 (150)
T ss_pred             eeEEEEecCCHHHHHHHHHHcCCccc
Confidence            34577888999999999999999753


No 295
>PRK08057 cobalt-precorrin-6x reductase; Reviewed
Probab=20.73  E-value=1.4e+02  Score=22.55  Aligned_cols=27  Identities=15%  Similarity=0.294  Sum_probs=22.4

Q ss_pred             eecCCHHHHHHHHHHcCccEEEeccCC
Q psy627           40 LNFSSKEDAIQYCQKNGWKFFVEEPKW   66 (89)
Q Consensus        40 l~F~s~e~Aiayae~~G~~Y~V~~p~~   66 (89)
                      =.|.+.|+=.+||+++++...|..-|+
T Consensus        49 G~l~~~~~l~~~l~~~~i~~VIDATHP   75 (248)
T PRK08057         49 GGFGGAEGLAAYLREEGIDLVIDATHP   75 (248)
T ss_pred             CCCCCHHHHHHHHHHCCCCEEEECCCc
Confidence            357788999999999999998887665


No 296
>cd04443 DEP_GPR155 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in GPR155-like proteins. GRP155-like proteins, also known as PGR22, contain an N-terminal permease domain, a central transmembrane region and a C-terminal DEP domain. They are orphan receptors of the class B G protein-coupled receptors. Their function is unknown.
Probab=20.71  E-value=84  Score=20.07  Aligned_cols=22  Identities=14%  Similarity=0.293  Sum_probs=18.0

Q ss_pred             cCCHHHHHHHHH---HcCccEEEec
Q psy627           42 FSSKEDAIQYCQ---KNGWKFFVEE   63 (89)
Q Consensus        42 F~s~e~Aiayae---~~G~~Y~V~~   63 (89)
                      ..|+++||.+|.   .+|+=..|..
T Consensus        46 ~~sR~eAv~lg~~Ll~~G~i~HV~~   70 (83)
T cd04443          46 AQDRGEAVLYGRRLLQGGVLQHITN   70 (83)
T ss_pred             CCCHHHHHHHHHHHHHCCCEEecCC
Confidence            589999999998   5788777754


No 297
>PRK12485 bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II-like protein; Provisional
Probab=20.65  E-value=88  Score=25.39  Aligned_cols=17  Identities=24%  Similarity=0.417  Sum_probs=15.4

Q ss_pred             CCHHHHHHHHHHcCccE
Q psy627           43 SSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y   59 (89)
                      .+.+++++||++||++.
T Consensus       173 ~~~~~~~~fA~~h~l~~  189 (369)
T PRK12485        173 ARRPDLEVFAAKHGIKI  189 (369)
T ss_pred             cChHHHHHHHHHcCCcE
Confidence            36899999999999997


No 298
>TIGR00011 YbaK_EbsC ybaK/ebsC protein. This model represents the YbaK family, bacterial proteins whose full length sequence is homologous to an insertion domain in proline--tRNA ligases. The domain deacylates mischarged tRNAs. The YbaK protein of Haemophilus influenzae (HI1434), although still considered undefined in its role in vivo, likewise deacylates Ala-tRNA(Pro), but not the correctly charged Pro-tRNA(Pro). A crystallographic study of HI1434 suggests a nucleotide binding function. Previously, a member of this family was described as EbsC and was thought to be involved in cell wall metabolism.
Probab=20.57  E-value=83  Score=21.25  Aligned_cols=17  Identities=29%  Similarity=0.380  Sum_probs=15.1

Q ss_pred             HHHHHHHHcCccEEEec
Q psy627           47 DAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        47 ~Aiayae~~G~~Y~V~~   63 (89)
                      -|+++-+++||+|++.+
T Consensus         2 ~~~~~L~~~~i~~~~~~   18 (152)
T TIGR00011         2 NAIRLLDKAKIEYEVHE   18 (152)
T ss_pred             HHHHHHHHcCCCcEEEE
Confidence            37899999999999986


No 299
>PF14174 YycC:  YycC-like protein
Probab=20.35  E-value=95  Score=18.83  Aligned_cols=17  Identities=29%  Similarity=0.305  Sum_probs=15.0

Q ss_pred             CHHHHHHHHHHcCccEE
Q psy627           44 SKEDAIQYCQKNGWKFF   60 (89)
Q Consensus        44 s~e~Aiayae~~G~~Y~   60 (89)
                      |.|-|+..|++-|.+.+
T Consensus         7 S~eTA~kLs~~L~vPlE   23 (53)
T PF14174_consen    7 SPETAVKLSKKLGVPLE   23 (53)
T ss_pred             CHHHHHHHHHHHCCcHH
Confidence            78999999999998754


No 300
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi. Mammalian metaxin (or metaxin 1) and the fungal protein Tom37 are components of preprotein import complexes of the mitochondrial outer membrane. Metaxin extends to the cytosol and is anchored to the mitochondrial membrane through its C-terminal domain. In mice, metaxin is required for embryonic development. Like the murine gene, the human metaxin gene is located downstream to the glucocerebrosidase (GBA) pseudogene and is convergently transcribed. Inherited deficiency of GBA results in Gaucher disease, which presents many diverse clinical phenotypes. Alterations in the metaxin gene, in addition to GBA mutations, may be associated with Gaucher disease. Genome sequencing shows that a third metaxin gene also exists in zebrafish, Xenopus, chicken and mammals.
Probab=20.33  E-value=1.6e+02  Score=17.67  Aligned_cols=21  Identities=14%  Similarity=0.061  Sum_probs=17.0

Q ss_pred             CCHHHHHHHHHHcCccEEEec
Q psy627           43 SSKEDAIQYCQKNGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~~G~~Y~V~~   63 (89)
                      +..=.++.|++--|++|+|..
T Consensus        17 p~clk~~~~Lr~~~~~~~v~~   37 (73)
T cd03078          17 PECLAVLAYLKFAGAPLKVVP   37 (73)
T ss_pred             HHHHHHHHHHHcCCCCEEEEe
Confidence            345568889999999999975


No 301
>TIGR00020 prfB peptide chain release factor 2. In many but not all taxa, there is a conserved real translational frameshift at a TGA codon. RF-2 helps terminate translation at TGA codons and can therefore regulate its own production by readthrough when RF-2 is insufficient. There is a Pfam model called "RF-1" for the superfamily of RF-1, RF-2, mitochondrial, RF-H, etc.
Probab=20.31  E-value=79  Score=25.67  Aligned_cols=16  Identities=13%  Similarity=0.484  Sum_probs=13.8

Q ss_pred             HHHHHHcCccEEEecc
Q psy627           49 IQYCQKNGWKFFVEEP   64 (89)
Q Consensus        49 iayae~~G~~Y~V~~p   64 (89)
                      ..||+++||.++|.+-
T Consensus       151 ~~~a~~~g~~~evi~~  166 (364)
T TIGR00020       151 LRWAERRGFKVEIIDY  166 (364)
T ss_pred             HHHHHHcCCEEEEEec
Confidence            4699999999999873


No 302
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate. GSH peroxidase contains one selenocysteine residue per subunit, which is involved in catalysis. Different isoenzymes are known in mammals,which are involved in protection against reactive oxygen species, redox regulation of many metabolic processes, peroxinitrite scavenging, and modulation of inflammatory processes.
Probab=20.28  E-value=1.1e+02  Score=20.42  Aligned_cols=21  Identities=24%  Similarity=0.485  Sum_probs=17.6

Q ss_pred             CCHHHHHHHHHH-cCccEEEec
Q psy627           43 SSKEDAIQYCQK-NGWKFFVEE   63 (89)
Q Consensus        43 ~s~e~Aiayae~-~G~~Y~V~~   63 (89)
                      ++.|++.+|+++ +|++|-|..
T Consensus        71 ~~~~~~~~f~~~~~~~~fp~~~   92 (152)
T cd00340          71 GSNEEIKEFCETNYGVTFPMFA   92 (152)
T ss_pred             CCHHHHHHHHHHhcCCCceeee
Confidence            567899999997 899998864


No 303
>PF14057 GGGtGRT:  GGGtGRT protein
Probab=20.23  E-value=84  Score=25.14  Aligned_cols=21  Identities=24%  Similarity=0.427  Sum_probs=18.4

Q ss_pred             eeecCCHHHHHHHHHHcCccE
Q psy627           39 ALNFSSKEDAIQYCQKNGWKF   59 (89)
Q Consensus        39 ~l~F~s~e~Aiayae~~G~~Y   59 (89)
                      ..-|.|+|+|-++|...|++.
T Consensus        18 ~~gi~sleea~~~c~~~gid~   38 (328)
T PF14057_consen   18 EYGIASLEEAKEICLDKGIDV   38 (328)
T ss_pred             HhCcccHHHHHHHHHHcCCCH
Confidence            356899999999999999974


No 304
>PRK08787 peptide chain release factor 2; Provisional
Probab=20.16  E-value=80  Score=25.25  Aligned_cols=16  Identities=25%  Similarity=0.636  Sum_probs=13.9

Q ss_pred             HHHHHHcCccEEEecc
Q psy627           49 IQYCQKNGWKFFVEEP   64 (89)
Q Consensus        49 iayae~~G~~Y~V~~p   64 (89)
                      ..||+++||.++|.+-
T Consensus        92 ~r~A~~~g~~~evi~~  107 (313)
T PRK08787         92 LRWAESRGWKTELMEV  107 (313)
T ss_pred             HHHHHHcCCeEEEEec
Confidence            4699999999999774


No 305
>PRK07342 peptide chain release factor 2; Provisional
Probab=20.12  E-value=80  Score=25.48  Aligned_cols=16  Identities=25%  Similarity=0.364  Sum_probs=13.9

Q ss_pred             HHHHHHcCccEEEecc
Q psy627           49 IQYCQKNGWKFFVEEP   64 (89)
Q Consensus        49 iayae~~G~~Y~V~~p   64 (89)
                      ..||+++||.++|.+-
T Consensus       115 ~~~a~~~g~~~~vi~~  130 (339)
T PRK07342        115 TRWAERQGRKVEVLEV  130 (339)
T ss_pred             HHHHHHcCCEEEEEec
Confidence            4699999999999774


No 306
>PRK00591 prfA peptide chain release factor 1; Validated
Probab=20.04  E-value=81  Score=25.56  Aligned_cols=17  Identities=24%  Similarity=0.671  Sum_probs=14.3

Q ss_pred             HHHHHHcCccEEEeccC
Q psy627           49 IQYCQKNGWKFFVEEPK   65 (89)
Q Consensus        49 iayae~~G~~Y~V~~p~   65 (89)
                      +.||+++||.++|.+-.
T Consensus       138 ~~~a~~~g~~~~vi~~~  154 (359)
T PRK00591        138 SRYAERQGWKVEILSAS  154 (359)
T ss_pred             HHHHHHCCCEEEEEecC
Confidence            56999999999998743


Done!