Query         psy6273
Match_columns 82
No_of_seqs    116 out of 1910
Neff          11.8
Searched_HMMs 46136
Date          Fri Aug 16 22:11:02 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6273.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6273hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 2.8E-28   6E-33  126.8   2.4   77    3-82    187-263 (279)
  2 KOG2462|consensus               99.9   1E-26 2.3E-31  121.0   2.2   76    2-82    160-235 (279)
  3 KOG3623|consensus               99.8 1.3E-20 2.7E-25  108.9   1.6   77    3-82    894-970 (1007)
  4 KOG3576|consensus               99.7 7.4E-19 1.6E-23   89.1  -1.3   76    3-81    117-192 (267)
  5 KOG3623|consensus               99.6 1.2E-16 2.6E-21   92.9   3.1   77    3-82    240-329 (1007)
  6 KOG1074|consensus               99.6 1.1E-16 2.4E-21   93.9   0.6   52    4-56    606-657 (958)
  7 PHA00733 hypothetical protein   99.5 7.8E-15 1.7E-19   70.8   0.9   77    2-82     39-119 (128)
  8 KOG3576|consensus               99.4 3.5E-14 7.6E-19   72.4   1.3   74    2-76    144-226 (267)
  9 PHA02768 hypothetical protein;  99.4 1.6E-13 3.6E-18   56.6   2.1   44   32-79      5-48  (55)
 10 PF13465 zf-H2C2_2:  Zinc-finge  99.3 2.8E-12   6E-17   45.9   2.7   26   47-74      1-26  (26)
 11 KOG1074|consensus               99.3 1.4E-12   3E-17   77.2   1.8   50   31-82    604-653 (958)
 12 KOG3608|consensus               99.3 5.3E-12 1.1E-16   69.1   3.6   79    1-81    290-371 (467)
 13 KOG3608|consensus               99.3 4.9E-12 1.1E-16   69.2   2.9   76    2-81    236-311 (467)
 14 PHA02768 hypothetical protein;  99.2 8.5E-12 1.8E-16   51.5   1.7   43    4-49      6-48  (55)
 15 PLN03086 PRLI-interacting fact  99.1   7E-11 1.5E-15   68.4   4.1   64    2-73    452-515 (567)
 16 PHA00733 hypothetical protein   99.1 1.7E-10 3.7E-15   55.9   4.7   54    1-57     71-124 (128)
 17 KOG3993|consensus               99.0 2.5E-11 5.4E-16   67.6  -1.8   78    4-82    268-376 (500)
 18 PLN03086 PRLI-interacting fact  99.0 8.7E-10 1.9E-14   64.1   3.7   68    2-75    477-554 (567)
 19 PHA00732 hypothetical protein   98.9 1.3E-09 2.8E-14   48.7   1.8   48    3-56      1-48  (79)
 20 PF13465 zf-H2C2_2:  Zinc-finge  98.9 8.9E-10 1.9E-14   39.3   1.0   25   18-43      1-25  (26)
 21 PHA00616 hypothetical protein   98.9 1.5E-09 3.2E-14   43.0   1.7   34   32-67      1-34  (44)
 22 PHA00616 hypothetical protein   98.8 4.3E-09 9.3E-14   41.7   1.8   34    3-37      1-34  (44)
 23 COG5189 SFP1 Putative transcri  98.8   2E-09 4.4E-14   58.5   0.8   69    2-82    348-418 (423)
 24 PF05605 zf-Di19:  Drought indu  98.7 9.6E-08 2.1E-12   39.8   5.1   51    3-56      2-53  (54)
 25 PHA00732 hypothetical protein   98.7 1.3E-08 2.7E-13   45.5   2.3   39   32-74      1-39  (79)
 26 PF05605 zf-Di19:  Drought indu  98.4 1.9E-07 4.1E-12   38.9   1.8   48   32-82      2-49  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.4 1.7E-07 3.7E-12   32.2   1.4   21    4-24      1-21  (23)
 28 PF00096 zf-C2H2:  Zinc finger,  98.3 3.4E-07 7.4E-12   31.4   1.5   23   33-55      1-23  (23)
 29 PF12756 zf-C2H2_2:  C2H2 type   98.2 1.6E-07 3.4E-12   43.4  -0.4   23    5-27      1-23  (100)
 30 KOG3993|consensus               98.2 8.1E-07 1.8E-11   50.3   2.2   54    3-56    295-380 (500)
 31 PF13912 zf-C2H2_6:  C2H2-type   98.2 1.5E-06 3.3E-11   30.9   2.1   24    3-27      1-24  (27)
 32 PF13894 zf-C2H2_4:  C2H2-type   98.1 3.3E-06 7.1E-11   29.0   1.6   20    5-24      2-21  (24)
 33 PF13912 zf-C2H2_6:  C2H2-type   98.0 1.8E-06 3.9E-11   30.8   0.6   25   32-56      1-25  (27)
 34 PF13894 zf-C2H2_4:  C2H2-type   97.9 1.5E-05 3.2E-10   27.2   2.3   24   33-56      1-24  (24)
 35 PF09237 GAGA:  GAGA factor;  I  97.9 1.9E-05 4.1E-10   32.2   2.5   32   27-58     19-50  (54)
 36 PRK04860 hypothetical protein;  97.9 1.1E-05 2.5E-10   40.6   2.3   40   32-77    119-158 (160)
 37 smart00355 ZnF_C2H2 zinc finge  97.7 5.4E-05 1.2E-09   26.1   2.1   20    5-24      2-21  (26)
 38 PF09237 GAGA:  GAGA factor;  I  97.6 7.2E-05 1.6E-09   30.5   2.0   30    1-31     22-51  (54)
 39 smart00355 ZnF_C2H2 zinc finge  97.6 0.00012 2.6E-09   25.2   2.4   24   33-56      1-24  (26)
 40 PF12171 zf-C2H2_jaz:  Zinc-fin  97.4 7.2E-05 1.6E-09   26.6   0.8   20   63-82      2-21  (27)
 41 PF12874 zf-met:  Zinc-finger o  97.4 6.6E-05 1.4E-09   26.1   0.7   19    5-23      2-20  (25)
 42 PF12874 zf-met:  Zinc-finger o  97.4 0.00011 2.5E-09   25.4   1.3   23   33-55      1-23  (25)
 43 PF13909 zf-H2C2_5:  C2H2-type   97.2 0.00024 5.3E-09   24.4   1.4   20   34-54      2-21  (24)
 44 PRK04860 hypothetical protein;  97.2 0.00018 3.9E-09   36.4   1.3   38    3-45    119-156 (160)
 45 PF13913 zf-C2HC_2:  zinc-finge  96.4  0.0028   6E-08   22.1   1.4   18   34-52      4-21  (25)
 46 KOG2893|consensus               96.3  0.0022 4.8E-08   34.5   1.1   30   35-70     13-42  (341)
 47 smart00451 ZnF_U1 U1-like zinc  96.0  0.0071 1.5E-07   22.5   1.8   22    3-24      3-24  (35)
 48 COG5189 SFP1 Putative transcri  95.8  0.0015 3.2E-08   36.5  -0.7   24    1-24    396-419 (423)
 49 KOG1146|consensus               95.8  0.0093   2E-07   39.1   2.5   53    2-54    464-540 (1406)
 50 PF13719 zinc_ribbon_5:  zinc-r  95.8    0.01 2.2E-07   22.7   1.8   34   33-73      3-36  (37)
 51 COG2888 Predicted Zn-ribbon RN  95.4   0.015 3.2E-07   24.6   1.6   32   32-70     27-58  (61)
 52 KOG2186|consensus               95.1   0.015 3.1E-07   31.7   1.5   47    3-53      3-49  (276)
 53 PF13717 zinc_ribbon_4:  zinc-r  95.1   0.023 5.1E-07   21.6   1.6   33   33-72      3-35  (36)
 54 TIGR02098 MJ0042_CXXC MJ0042 f  95.1   0.023   5E-07   21.6   1.6   33   33-72      3-35  (38)
 55 PF12756 zf-C2H2_2:  C2H2 type   94.9   0.037 8.1E-07   25.3   2.5   21    4-24     51-71  (100)
 56 KOG1146|consensus               94.8   0.004 8.6E-08   40.6  -1.2   57   26-82    459-538 (1406)
 57 PF09538 FYDLN_acid:  Protein o  94.8   0.018 3.8E-07   27.5   1.1   15   61-75     25-39  (108)
 58 cd00350 rubredoxin_like Rubred  94.7   0.012 2.7E-07   21.8   0.4    8   62-69     17-24  (33)
 59 COG1592 Rubrerythrin [Energy p  94.6   0.016 3.5E-07   29.7   0.8   23   32-69    134-156 (166)
 60 COG0068 HypF Hydrogenase matur  94.6  0.0067 1.5E-07   37.4  -0.6   57    5-70    125-181 (750)
 61 PF09986 DUF2225:  Uncharacteri  94.4  0.0042   9E-08   33.0  -1.6   22    1-22      3-24  (214)
 62 COG5048 FOG: Zn-finger [Genera  94.3  0.0053 1.1E-07   34.9  -1.4   62    3-66    289-355 (467)
 63 KOG4173|consensus               94.3   0.012 2.7E-07   31.1   0.0   72    4-81     80-165 (253)
 64 COG4049 Uncharacterized protei  94.2   0.027 5.9E-07   23.5   1.0   22    3-24     17-38  (65)
 65 cd00729 rubredoxin_SM Rubredox  94.1   0.022 4.7E-07   21.4   0.5    9   61-69     17-25  (34)
 66 TIGR00373 conserved hypothetic  93.3    0.11 2.3E-06   26.5   2.3   34   28-72    105-138 (158)
 67 KOG2186|consensus               92.9   0.061 1.3E-06   29.4   1.2   44   33-81      4-47  (276)
 68 KOG2482|consensus               92.8    0.17 3.7E-06   29.1   2.8   80    3-82    195-354 (423)
 69 PF08790 zf-LYAR:  LYAR-type C2  92.8    0.06 1.3E-06   19.3   0.7   11   63-73      1-11  (28)
 70 PRK14890 putative Zn-ribbon RN  92.7   0.097 2.1E-06   22.2   1.4   33   31-70     24-56  (59)
 71 PRK00398 rpoP DNA-directed RNA  92.3   0.037 8.1E-07   22.1  -0.1    9   62-70     21-29  (46)
 72 smart00531 TFIIE Transcription  92.3    0.48   1E-05   23.8   3.8   38   29-72     96-133 (147)
 73 PRK06266 transcription initiat  92.3    0.15 3.2E-06   26.5   2.1   33   29-72    114-146 (178)
 74 TIGR02300 FYDLN_acid conserved  91.8    0.11 2.4E-06   25.5   1.2   12   61-72     25-36  (129)
 75 PF07754 DUF1610:  Domain of un  91.4    0.12 2.5E-06   17.9   0.8   10   61-70     15-24  (24)
 76 COG5048 FOG: Zn-finger [Genera  91.3   0.071 1.5E-06   30.5   0.3   51   32-82    289-343 (467)
 77 PHA00626 hypothetical protein   91.1    0.12 2.6E-06   21.6   0.8   15   61-75     22-36  (59)
 78 PF04959 ARS2:  Arsenite-resist  90.8    0.25 5.4E-06   26.6   2.0   26    3-28     77-102 (214)
 79 smart00659 RPOLCX RNA polymera  90.7    0.19 4.1E-06   20.0   1.2   10   61-70     18-27  (44)
 80 KOG2893|consensus               90.5   0.068 1.5E-06   29.1  -0.2   32    6-42     13-44  (341)
 81 PF13451 zf-trcl:  Probable zin  90.4    0.28 6.1E-06   20.0   1.5   13    2-14      3-15  (49)
 82 PF02176 zf-TRAF:  TRAF-type zi  90.0   0.099 2.1E-06   21.8   0.1   41   31-74      8-54  (60)
 83 PRK00464 nrdR transcriptional   89.7   0.035 7.7E-07   28.1  -1.6   13   33-45     29-41  (154)
 84 KOG2482|consensus               89.0    0.57 1.2E-05   27.1   2.5   66   17-82    129-215 (423)
 85 PF10571 UPF0547:  Uncharacteri  88.6    0.21 4.6E-06   17.5   0.5   11   63-73     15-25  (26)
 86 KOG2593|consensus               87.5     1.2 2.5E-05   26.6   3.2   39   28-71    124-162 (436)
 87 PRK09678 DNA-binding transcrip  87.5    0.14   3E-06   22.7  -0.3   15   61-75     26-42  (72)
 88 TIGR00622 ssl1 transcription f  87.2    0.72 1.6E-05   22.3   2.0   67    3-75     15-94  (112)
 89 smart00834 CxxC_CXXC_SSSS Puta  86.9    0.34 7.5E-06   18.5   0.7   15   61-75      4-18  (41)
 90 COG1997 RPL43A Ribosomal prote  86.7    0.35 7.6E-06   22.2   0.8   33   32-76     35-67  (89)
 91 PF04423 Rad50_zn_hook:  Rad50   86.5     1.1 2.4E-05   18.4   2.2   11   64-74     22-32  (54)
 92 smart00154 ZnF_AN1 AN1-like Zi  86.4    0.39 8.5E-06   18.5   0.8   14   62-75     12-25  (39)
 93 PF03604 DNA_RNApol_7kD:  DNA d  85.5    0.19 4.2E-06   18.6  -0.3    7   63-69     18-24  (32)
 94 KOG4173|consensus               85.4    0.27 5.8E-06   26.3   0.1   46   32-82     79-126 (253)
 95 PF12013 DUF3505:  Protein of u  85.4    0.76 1.7E-05   21.8   1.6   26   32-57     80-109 (109)
 96 PF04959 ARS2:  Arsenite-resist  85.4    0.34 7.4E-06   26.1   0.4   29   30-58     75-103 (214)
 97 PF09723 Zn-ribbon_8:  Zinc rib  85.2    0.46 9.9E-06   18.6   0.7   15   62-76      5-19  (42)
 98 PF01428 zf-AN1:  AN1-like Zinc  84.9    0.39 8.5E-06   18.8   0.4   15   61-75     12-26  (43)
 99 smart00734 ZnF_Rad18 Rad18-lik  83.6     1.5 3.2E-05   15.3   1.8   18    5-23      3-20  (26)
100 COG1996 RPC10 DNA-directed RNA  83.3    0.43 9.2E-06   19.5   0.2   10   33-42      7-16  (49)
101 TIGR00143 hypF [NiFe] hydrogen  82.1    0.19 4.2E-06   31.6  -1.4   55    6-69     93-147 (711)
102 PF10013 DUF2256:  Uncharacteri  82.1    0.46   1E-05   18.7   0.1   14   63-76      9-22  (42)
103 KOG2231|consensus               81.9     1.1 2.4E-05   28.2   1.6   21    6-27    118-138 (669)
104 PF01927 Mut7-C:  Mut7-C RNAse   81.8     0.7 1.5E-05   23.2   0.7   19   61-79    123-141 (147)
105 TIGR02605 CxxC_CxxC_SSSS putat  81.6    0.77 1.7E-05   18.6   0.7   14   62-75      5-18  (52)
106 KOG3408|consensus               81.5     1.5 3.2E-05   21.5   1.7   27   28-54     53-79  (129)
107 smart00614 ZnF_BED BED zinc fi  80.9     2.1 4.6E-05   17.2   1.9    8   46-53     37-44  (50)
108 PF15269 zf-C2H2_7:  Zinc-finge  80.8     1.3 2.7E-05   17.7   1.1   23   33-55     21-43  (54)
109 PF02892 zf-BED:  BED zinc fing  80.8     2.5 5.4E-05   16.4   2.0   19   34-52     18-40  (45)
110 KOG1280|consensus               80.7     2.5 5.5E-05   24.6   2.6   39   31-69     78-116 (381)
111 KOG2785|consensus               80.0     4.5 9.7E-05   23.9   3.4   25    3-28    166-190 (390)
112 KOG4124|consensus               79.4    0.18 3.9E-06   29.0  -2.0   68    2-81    348-417 (442)
113 KOG2785|consensus               79.0     3.9 8.5E-05   24.1   3.0   23    2-24      2-24  (390)
114 PF08274 PhnA_Zn_Ribbon:  PhnA   78.6     1.3 2.9E-05   16.1   0.8   10   61-70     18-27  (30)
115 PRK03824 hypA hydrogenase nick  78.5    0.73 1.6E-05   22.9   0.2   13   32-44     70-82  (135)
116 PTZ00255 60S ribosomal protein  78.5    0.72 1.6E-05   21.4   0.1   33   31-75     35-67  (90)
117 PF01363 FYVE:  FYVE zinc finge  77.5     1.5 3.4E-05   18.8   1.0   26   34-73     11-36  (69)
118 PF14353 CpXC:  CpXC protein     77.2     1.4   3E-05   21.5   0.9   17   61-77     37-53  (128)
119 PF10276 zf-CHCC:  Zinc-finger   76.8     1.4   3E-05   17.2   0.7   12   61-72     28-39  (40)
120 KOG2907|consensus               76.3     1.4 3.1E-05   21.3   0.8   40   33-75     75-115 (116)
121 COG4530 Uncharacterized protei  75.7     1.1 2.5E-05   21.5   0.4   12   61-72     25-36  (129)
122 TIGR00280 L37a ribosomal prote  75.3    0.77 1.7E-05   21.3  -0.2   32   32-75     35-66  (91)
123 PF12907 zf-met2:  Zinc-binding  75.2     2.8 6.1E-05   16.4   1.3   11   17-27     18-28  (40)
124 COG1773 Rubredoxin [Energy pro  75.0     1.6 3.6E-05   18.3   0.7   16    1-16      1-16  (55)
125 cd00924 Cyt_c_Oxidase_Vb Cytoc  73.7     1.9   4E-05   20.4   0.8   13   61-73     78-90  (97)
126 KOG4167|consensus               73.4     1.3 2.9E-05   28.3   0.3   25   32-56    792-816 (907)
127 PF04780 DUF629:  Protein of un  72.5     3.7 8.1E-05   25.0   2.0   27    4-30     58-84  (466)
128 PF01286 XPA_N:  XPA protein N-  72.1     2.3 4.9E-05   16.0   0.7   15   63-77      4-18  (34)
129 PF15135 UPF0515:  Uncharacteri  72.1     3.8 8.2E-05   22.8   1.8   14   62-75    155-168 (278)
130 PF07282 OrfB_Zn_ribbon:  Putat  72.0     3.1 6.7E-05   17.9   1.3   29   33-73     29-57  (69)
131 KOG4167|consensus               72.0    0.71 1.5E-05   29.4  -1.0   24    4-28    793-816 (907)
132 COG1655 Uncharacterized protei  71.8    0.98 2.1E-05   24.7  -0.4   18    2-19     18-35  (267)
133 PLN02294 cytochrome c oxidase   70.9     2.2 4.8E-05   22.3   0.7   14   61-74    140-153 (174)
134 PRK14873 primosome assembly pr  70.8     2.6 5.7E-05   26.7   1.2   10   61-70    421-430 (665)
135 COG1326 Uncharacterized archae  69.7     7.2 0.00016   20.9   2.4   12   61-72     29-40  (201)
136 PF11672 DUF3268:  Protein of u  69.7     1.7 3.6E-05   20.7   0.2   10    2-11      1-10  (102)
137 PRK12380 hydrogenase nickel in  69.4     1.7 3.8E-05   20.9   0.2   25   32-70     70-94  (113)
138 COG5236 Uncharacterized conser  69.4     6.3 0.00014   23.2   2.3   47    5-53    222-272 (493)
139 KOG1842|consensus               69.2    0.75 1.6E-05   27.5  -1.2   18   32-49     15-32  (505)
140 PF01155 HypA:  Hydrogenase exp  68.8     1.4 3.1E-05   21.2  -0.2   25   33-71     71-95  (113)
141 COG1675 TFA1 Transcription ini  68.6     7.5 0.00016   20.5   2.4   33   28-71    109-141 (176)
142 PF05443 ROS_MUCR:  ROS/MUCR tr  67.2     3.8 8.1E-05   20.5   1.1   25   31-58     71-95  (132)
143 PF02891 zf-MIZ:  MIZ/SP-RING z  67.0     4.4 9.6E-05   16.5   1.1   10   61-70     40-49  (50)
144 COG3677 Transposase and inacti  66.9     2.9 6.3E-05   20.7   0.7   15   61-75     52-66  (129)
145 PF08792 A2L_zn_ribbon:  A2L zi  65.7     3.6 7.7E-05   15.3   0.7   12   62-73     21-32  (33)
146 PF05191 ADK_lid:  Adenylate ki  65.2     3.3   7E-05   15.7   0.5   12   63-74      2-13  (36)
147 PF01215 COX5B:  Cytochrome c o  65.1     3.5 7.7E-05   20.7   0.8   13   61-73    111-123 (136)
148 COG1656 Uncharacterized conser  65.1     3.1 6.7E-05   21.6   0.6   19   61-79    129-147 (165)
149 PF09845 DUF2072:  Zn-ribbon co  65.1     3.8 8.3E-05   20.4   0.9   15    3-17      1-15  (131)
150 cd00065 FYVE FYVE domain; Zinc  65.0     3.5 7.7E-05   16.8   0.7    9    6-14      5-13  (57)
151 PF11023 DUF2614:  Protein of u  65.0     2.9 6.2E-05   20.3   0.4   13   30-42     67-79  (114)
152 TIGR00686 phnA alkylphosphonat  64.3       3 6.5E-05   20.1   0.4    9   33-41     20-28  (109)
153 TIGR00100 hypA hydrogenase nic  64.0     2.7 5.8E-05   20.3   0.3   25   33-71     71-95  (115)
154 KOG0782|consensus               63.7     1.6 3.4E-05   27.3  -0.6   52   17-76    239-290 (1004)
155 PF12760 Zn_Tnp_IS1595:  Transp  63.7     6.9 0.00015   15.5   1.4   10   61-70     36-45  (46)
156 KOG0978|consensus               63.3     3.8 8.1E-05   26.2   0.8   22   61-82    677-698 (698)
157 COG4338 Uncharacterized protei  63.1     1.4   3E-05   17.9  -0.7   13   64-76     14-26  (54)
158 PRK03681 hypA hydrogenase nick  63.1     2.3   5E-05   20.5  -0.1   27   32-71     70-96  (114)
159 KOG2636|consensus               62.7     6.4 0.00014   23.9   1.6   28   26-53    395-423 (497)
160 PRK00432 30S ribosomal protein  62.3     4.2 9.1E-05   16.6   0.7   12   61-72     36-47  (50)
161 COG4391 Uncharacterized protei  62.1     3.7   8E-05   17.6   0.5   43   26-74     18-60  (62)
162 smart00064 FYVE Protein presen  61.9     4.1 8.9E-05   17.4   0.6    8   35-42     13-20  (68)
163 PF10537 WAC_Acf1_DNA_bd:  ATP-  60.3     9.7 0.00021   18.1   1.7   39    1-41      1-39  (102)
164 COG4957 Predicted transcriptio  60.2     6.9 0.00015   19.7   1.3   23   33-58     77-99  (148)
165 TIGR01206 lysW lysine biosynth  59.7     4.2   9E-05   17.0   0.4   11   63-73      3-13  (54)
166 PRK00564 hypA hydrogenase nick  59.4     3.5 7.6E-05   20.0   0.2   13   32-44     71-83  (117)
167 PF08209 Sgf11:  Sgf11 (transcr  59.3     5.2 0.00011   14.9   0.6   13   61-73      3-15  (33)
168 PF07503 zf-HYPF:  HypF finger;  58.8     1.1 2.3E-05   16.9  -1.3    9   62-70     21-29  (35)
169 COG1571 Predicted DNA-binding   58.2     4.3 9.2E-05   24.4   0.4   11   32-42    367-377 (421)
170 PF14255 Cys_rich_CPXG:  Cystei  58.1     4.2 9.2E-05   16.8   0.3   10   64-73      2-11  (52)
171 PRK10220 hypothetical protein;  57.6     5.5 0.00012   19.3   0.7    9   33-41     21-29  (111)
172 PF00301 Rubredoxin:  Rubredoxi  57.3     5.8 0.00013   16.0   0.6   12   63-74      2-13  (47)
173 COG3091 SprT Zn-dependent meta  57.3     4.8  0.0001   20.7   0.5   35   30-71    115-149 (156)
174 PF01844 HNH:  HNH endonuclease  56.9       5 0.00011   15.5   0.4   11   65-75      1-11  (47)
175 TIGR03831 YgiT_finger YgiT-typ  56.1     4.9 0.00011   15.5   0.3   13   61-73     31-43  (46)
176 COG1198 PriA Primosomal protei  55.9     1.3 2.9E-05   28.3  -1.9   11   61-71    474-484 (730)
177 cd00730 rubredoxin Rubredoxin;  55.8     5.2 0.00011   16.4   0.4   11   63-73      2-12  (50)
178 PRK05978 hypothetical protein;  55.6     4.1 8.9E-05   20.8   0.1   30   34-74     35-64  (148)
179 PF13878 zf-C2H2_3:  zinc-finge  55.5      14  0.0003   14.3   1.7   24   33-56     14-39  (41)
180 PF14690 zf-ISL3:  zinc-finger   54.8     5.9 0.00013   15.5   0.5   10   62-71      2-11  (47)
181 KOG0717|consensus               54.4     7.6 0.00016   23.8   1.0   22   33-54    293-314 (508)
182 PF06397 Desulfoferrod_N:  Desu  54.1     7.2 0.00016   14.9   0.6   12   61-72      5-16  (36)
183 PF14787 zf-CCHC_5:  GAG-polypr  54.0     6.8 0.00015   14.9   0.6   14   64-77      4-17  (36)
184 COG3357 Predicted transcriptio  52.7       7 0.00015   18.3   0.6   12    3-14     58-69  (97)
185 PF08271 TF_Zn_Ribbon:  TFIIB z  52.5     6.9 0.00015   15.2   0.5    8   63-70      1-8   (43)
186 PTZ00043 cytochrome c oxidase   51.5     6.8 0.00015   21.6   0.5   14   61-74    180-193 (268)
187 PF09963 DUF2197:  Uncharacteri  51.0     6.1 0.00013   16.7   0.2    7   33-39     32-38  (56)
188 PF09889 DUF2116:  Uncharacteri  50.8      13 0.00028   15.9   1.2    9    6-14      6-14  (59)
189 PF01096 TFIIS_C:  Transcriptio  50.1     8.3 0.00018   14.7   0.5   11   62-72     28-38  (39)
190 smart00440 ZnF_C2C2 C2C2 Zinc   49.8      11 0.00024   14.5   0.9   11   62-72     28-38  (40)
191 PLN03238 probable histone acet  49.6     4.4 9.6E-05   23.0  -0.3   22   61-82     47-68  (290)
192 KOG1088|consensus               49.3      13 0.00028   18.3   1.2   17   61-77     97-113 (124)
193 KOG3507|consensus               49.1      11 0.00025   16.1   0.9   10   62-71     37-46  (62)
194 PF01780 Ribosomal_L37ae:  Ribo  48.5     8.3 0.00018   18.0   0.5   32   32-75     35-66  (90)
195 COG4896 Uncharacterized protei  48.2      15 0.00033   15.8   1.2   11   31-41     30-40  (68)
196 PLN02748 tRNA dimethylallyltra  48.1      19  0.0004   22.2   1.9   22    3-24    418-440 (468)
197 PF14447 Prok-RING_4:  Prokaryo  47.3      11 0.00024   15.9   0.7   15   61-75     38-52  (55)
198 PRK02935 hypothetical protein;  47.2      16 0.00035   17.6   1.3   36   29-78     67-102 (110)
199 PF03966 Trm112p:  Trm112p-like  46.7     9.3  0.0002   16.5   0.5   13   61-73     52-64  (68)
200 COG5112 UFD2 U1-like Zn-finger  46.2      16 0.00036   17.6   1.3   26   29-54     52-77  (126)
201 PF11931 DUF3449:  Domain of un  45.8     6.8 0.00015   21.0   0.0   21   61-81    100-121 (196)
202 PF13240 zinc_ribbon_2:  zinc-r  45.7      13 0.00028   12.4   0.7    6   65-70     16-21  (23)
203 TIGR00244 transcriptional regu  45.1     9.4  0.0002   19.5   0.4   15   61-75     27-41  (147)
204 COG0675 Transposase and inacti  44.4      15 0.00033   20.7   1.2   12   61-72    321-332 (364)
205 PF13824 zf-Mss51:  Zinc-finger  44.4      12 0.00026   15.7   0.6   12   61-72     13-24  (55)
206 cd00974 DSRD Desulforedoxin (D  44.2      14 0.00029   13.5   0.7   12   61-72      3-14  (34)
207 PRK00420 hypothetical protein;  44.1      10 0.00023   18.4   0.5   11   62-72     40-50  (112)
208 PRK04023 DNA polymerase II lar  44.0      20 0.00043   24.5   1.7   11   61-71    662-672 (1121)
209 PF04606 Ogr_Delta:  Ogr/Delta-  44.0     4.2 9.2E-05   16.2  -0.7   17   61-77     24-42  (47)
210 PF13453 zf-TFIIB:  Transcripti  43.9      23  0.0005   13.5   1.6   17    5-21     21-37  (41)
211 smart00661 RPOL9 RNA polymeras  43.2      16 0.00035   14.5   0.9   13   62-74     20-32  (52)
212 COG4847 Uncharacterized protei  43.0     8.9 0.00019   18.1   0.1   15    1-15      4-18  (103)
213 PF14375 Cys_rich_CWC:  Cystein  43.0      12 0.00025   15.2   0.5    9   65-73      1-9   (50)
214 PRK01343 zinc-binding protein;  42.9      14 0.00031   15.7   0.7   10   63-72     10-19  (57)
215 PLN03239 histone acetyltransfe  42.8     5.8 0.00013   23.2  -0.5   22   61-82    105-126 (351)
216 smart00132 LIM Zinc-binding do  42.8      10 0.00022   13.6   0.3   10   63-72     28-37  (39)
217 TIGR00319 desulf_FeS4 desulfof  42.7      15 0.00032   13.4   0.7   12   61-72      6-17  (34)
218 KOG2071|consensus               42.6      18 0.00038   22.9   1.3   26    2-28    417-442 (579)
219 PF03811 Zn_Tnp_IS1:  InsA N-te  42.6     2.8 6.1E-05   15.9  -1.3    8   61-68     28-35  (36)
220 PLN00104 MYST -like histone ac  42.4     5.8 0.00013   24.1  -0.6   22   61-82    197-218 (450)
221 COG1327 Predicted transcriptio  41.5      12 0.00025   19.4   0.4   14   61-74     27-40  (156)
222 COG2331 Uncharacterized protei  41.3      11 0.00024   17.0   0.3   13   61-73     11-23  (82)
223 PF14369 zf-RING_3:  zinc-finge  41.1      13 0.00028   13.9   0.4    8   65-72     24-31  (35)
224 KOG3352|consensus               40.9      14 0.00031   19.0   0.7   13   61-73    132-144 (153)
225 PRK08222 hydrogenase 4 subunit  40.5      27 0.00058   18.4   1.7   19    3-21    114-132 (181)
226 KOG0402|consensus               40.4      13 0.00027   17.1   0.4   32   32-75     36-67  (92)
227 COG4888 Uncharacterized Zn rib  40.3      17 0.00036   17.4   0.8   10   31-40     21-30  (104)
228 TIGR03829 YokU_near_AblA uncha  40.1      28 0.00062   16.2   1.5   19    4-22     36-54  (89)
229 PRK12722 transcriptional activ  39.9      14 0.00031   19.7   0.6   27   33-69    135-161 (187)
230 TIGR01562 FdhE formate dehydro  39.8      24 0.00053   20.4   1.5   10   61-70    251-260 (305)
231 COG3880 Modulator of heat shoc  39.6       6 0.00013   20.7  -0.7   29   33-73     75-103 (176)
232 PRK03976 rpl37ae 50S ribosomal  39.5      16 0.00035   17.1   0.7   32   32-75     36-67  (90)
233 COG3364 Zn-ribbon containing p  39.5      16 0.00034   17.6   0.6   14    3-16      2-15  (112)
234 PF10263 SprT-like:  SprT-like   38.8     9.3  0.0002   19.2  -0.2   13   61-73    142-154 (157)
235 PRK12860 transcriptional activ  38.6      15 0.00032   19.7   0.5   27   33-69    135-161 (189)
236 KOG2231|consensus               38.5      47   0.001   21.7   2.6   19    6-24    185-203 (669)
237 PF02748 PyrI_C:  Aspartate car  38.4      15 0.00032   15.2   0.5   14   61-74     34-47  (52)
238 PF07975 C1_4:  TFIIH C1-like d  37.9      11 0.00024   15.6   0.0   22    3-24     21-42  (51)
239 PF06524 NOA36:  NOA36 protein;  37.9     6.3 0.00014   22.2  -0.8   11   61-71    208-218 (314)
240 smart00647 IBR In Between Ring  37.6      33 0.00072   14.0   1.5   30   35-74     21-52  (64)
241 PF03884 DUF329:  Domain of unk  37.6      17 0.00037   15.4   0.6   12   63-74      3-14  (57)
242 PF12773 DZR:  Double zinc ribb  37.3      22 0.00048   14.0   0.9   12   61-72     28-39  (50)
243 PTZ00064 histone acetyltransfe  37.2     7.9 0.00017   24.0  -0.6   22   61-82    279-300 (552)
244 PF14311 DUF4379:  Domain of un  36.9      21 0.00046   14.6   0.8   15   61-75     27-41  (55)
245 PRK06260 threonine synthase; V  36.3      16 0.00034   21.7   0.5   26    4-42      4-29  (397)
246 PF02591 DUF164:  Putative zinc  36.2      38 0.00083   13.9   2.3   32   34-71     24-55  (56)
247 PF05129 Elf1:  Transcription e  36.2      16 0.00034   16.6   0.4    9   61-69     21-29  (81)
248 PF06689 zf-C4_ClpX:  ClpX C4-t  35.8      23 0.00049   13.7   0.8   12   64-75      3-14  (41)
249 PTZ00448 hypothetical protein;  35.5      30 0.00064   20.7   1.4   23   32-54    314-336 (373)
250 TIGR03830 CxxCG_CxxCG_HTH puta  34.9      50  0.0011   15.8   2.0   19    4-22     32-50  (127)
251 KOG4727|consensus               34.8      27 0.00058   18.5   1.1   21    4-24     76-96  (193)
252 COG1579 Zn-ribbon protein, pos  34.4      42 0.00091   18.8   1.9   34   33-72    198-231 (239)
253 PF14803 Nudix_N_2:  Nudix N-te  34.4      32 0.00068   12.8   1.0   11   61-71     21-31  (34)
254 TIGR00515 accD acetyl-CoA carb  33.9      24 0.00051   20.2   0.9   10   34-43     47-56  (285)
255 PF10058 DUF2296:  Predicted in  33.5      24 0.00052   14.7   0.7   10   61-70     43-52  (54)
256 PRK12496 hypothetical protein;  33.5      24 0.00052   18.3   0.8   12   63-74    128-139 (164)
257 COG5188 PRP9 Splicing factor 3  33.4     7.9 0.00017   22.9  -1.0   21   61-81    237-257 (470)
258 PHA02942 putative transposase;  33.2      22 0.00048   21.2   0.8   12   61-72    341-352 (383)
259 COG5432 RAD18 RING-finger-cont  33.0      27 0.00058   20.3   1.0   26    9-41     43-68  (391)
260 COG2879 Uncharacterized small   32.3      53  0.0012   14.3   1.8   16   43-58     23-38  (65)
261 PF05741 zf-nanos:  Nanos RNA b  32.2      18  0.0004   15.2   0.3   11   61-71     32-42  (55)
262 CHL00174 accD acetyl-CoA carbo  32.2      27 0.00059   20.2   1.0   10   34-43     59-68  (296)
263 PRK12387 formate hydrogenlyase  31.5      41 0.00089   17.6   1.5   18    3-20    114-131 (180)
264 PF13248 zf-ribbon_3:  zinc-rib  31.4      26 0.00056   11.9   0.6    7   34-40      4-10  (26)
265 PRK14714 DNA polymerase II lar  31.4      26 0.00057   24.6   0.9    7   64-70    711-717 (1337)
266 PF13821 DUF4187:  Domain of un  31.2      15 0.00032   15.4  -0.1   16   62-77     27-42  (55)
267 PF04810 zf-Sec23_Sec24:  Sec23  31.2      35 0.00077   13.0   1.0   12   61-72     23-34  (40)
268 PF10083 DUF2321:  Uncharacteri  30.9      15 0.00032   19.1  -0.1   15   61-75     67-81  (158)
269 PF06170 DUF983:  Protein of un  30.9      24 0.00052   16.3   0.5   11   63-73      9-19  (86)
270 KOG3183|consensus               30.8      22 0.00048   19.9   0.5   14   61-74     22-35  (250)
271 PF14446 Prok-RING_1:  Prokaryo  30.5      23  0.0005   14.9   0.4   11   63-73      6-16  (54)
272 PF11789 zf-Nse:  Zinc-finger o  29.8      28  0.0006   14.6   0.6    7    8-14     29-35  (57)
273 PF03107 C1_2:  C1 domain;  Int  29.7      37 0.00079   12.0   0.9    6   33-38     16-21  (30)
274 COG1631 RPL42A Ribosomal prote  29.3      24 0.00051   16.6   0.4   13   62-74     68-80  (94)
275 KOG0227|consensus               29.1      21 0.00046   19.3   0.2   20   33-52     54-73  (222)
276 KOG2857|consensus               28.7      29 0.00063   17.8   0.6   18   62-79     17-34  (157)
277 PF05876 Terminase_GpA:  Phage   28.7      14 0.00031   23.1  -0.5   38   32-73    200-240 (557)
278 PRK05654 acetyl-CoA carboxylas  28.3      33 0.00072   19.7   0.9   10   34-43     48-57  (292)
279 PF05290 Baculo_IE-1:  Baculovi  28.2      30 0.00065   17.5   0.6   16   62-77    121-136 (140)
280 PF14952 zf-tcix:  Putative tre  27.9      27 0.00059   14.0   0.4   10   63-72     12-21  (44)
281 cd07153 Fur_like Ferric uptake  27.6      30 0.00065   16.3   0.6   13   62-74     73-85  (116)
282 PF10609 ParA:  ParA/MinD ATPas  27.6      32 0.00069   15.7   0.6   11   61-71     64-74  (81)
283 PRK04351 hypothetical protein;  27.6      28 0.00061   17.8   0.5   13   61-73    131-143 (149)
284 COG1379 PHP family phosphoeste  27.6      26 0.00055   20.8   0.4   11   62-72    265-275 (403)
285 PF04438 zf-HIT:  HIT zinc fing  27.5      45 0.00097   12.0   0.9   11    4-14     14-24  (30)
286 PF00412 LIM:  LIM domain;  Int  27.5      31 0.00067   13.8   0.6   14   62-75     26-39  (58)
287 COG5152 Uncharacterized conser  26.7      28  0.0006   19.0   0.4   15   61-75    195-209 (259)
288 KOG1994|consensus               26.5      32  0.0007   19.2   0.6   21   31-51    238-258 (268)
289 COG1545 Predicted nucleic-acid  26.5      31 0.00068   17.4   0.6   12   62-73     29-40  (140)
290 COG4640 Predicted membrane pro  26.4      55  0.0012   20.0   1.5   19   32-50     15-33  (465)
291 TIGR00627 tfb4 transcription f  26.3      37 0.00081   19.4   0.9   14   61-74    254-267 (279)
292 COG1885 Uncharacterized protei  26.3      31 0.00066   16.7   0.5   11   63-73     50-60  (115)
293 PF07649 C1_3:  C1-like domain;  26.3      42 0.00091   11.7   0.8   11   61-71     14-24  (30)
294 PF06220 zf-U1:  U1 zinc finger  26.2      54  0.0012   12.5   1.9   12    2-13      2-13  (38)
295 COG1594 RPB9 DNA-directed RNA   26.0      34 0.00075   16.6   0.6   12   62-73    100-111 (113)
296 PF01475 FUR:  Ferric uptake re  25.8      33 0.00071   16.4   0.5   13   61-73     79-91  (120)
297 PF10367 Vps39_2:  Vacuolar sor  24.6      36 0.00079   15.7   0.6   12   63-74     79-90  (109)
298 PF00935 Ribosomal_L44:  Riboso  24.6      37  0.0008   15.4   0.5   13   61-73     52-64  (77)
299 COG4306 Uncharacterized protei  24.3      21 0.00046   17.8  -0.3   14   61-74     67-80  (160)
300 PF02146 SIR2:  Sir2 family;  I  24.0 1.2E+02  0.0025   15.8   2.4   10   34-43    107-116 (178)
301 KOG3277|consensus               23.8      26 0.00055   18.3  -0.0    9    4-12     80-88  (165)
302 PF14149 YhfH:  YhfH-like prote  23.7      18  0.0004   13.9  -0.4   12   62-73     13-24  (37)
303 PF10164 DUF2367:  Uncharacteri  23.6      40 0.00086   16.1   0.6   12   61-72     87-98  (98)
304 PF10071 DUF2310:  Zn-ribbon-co  23.2      30 0.00064   19.6   0.1   29   32-69    220-248 (258)
305 smart00709 Zpr1 Duplicated dom  23.1      48   0.001   17.3   0.8   12   62-73     29-40  (160)
306 KOG2747|consensus               23.0      57  0.0012   19.8   1.2   26   31-56    157-182 (396)
307 TIGR00340 zpr1_rel ZPR1-relate  22.9      46   0.001   17.4   0.8   12   62-73     28-39  (163)
308 PF01194 RNA_pol_N:  RNA polyme  22.6      85  0.0018   13.5   1.4   15    2-16      3-17  (60)
309 smart00507 HNHc HNH nucleases.  22.6      40 0.00087   12.7   0.5   10   63-72     11-20  (52)
310 PF03367 zf-ZPR1:  ZPR1 zinc-fi  22.5      42  0.0009   17.4   0.6   12   62-73     30-41  (161)
311 PF01485 IBR:  IBR domain;  Int  22.4      39 0.00085   13.8   0.4   13   63-75     41-53  (64)
312 PF12230 PRP21_like_P:  Pre-mRN  22.4      29 0.00063   18.9   0.0   27   31-58    167-193 (229)
313 PF06353 DUF1062:  Protein of u  22.4      39 0.00084   17.3   0.4   11    4-14     14-24  (142)
314 PF09943 DUF2175:  Uncharacteri  22.3      33 0.00072   16.5   0.2   13    3-15      2-14  (101)
315 PF02148 zf-UBP:  Zn-finger in   21.9      67  0.0015   13.5   1.1   15   61-75     10-24  (63)
316 PF13408 Zn_ribbon_recom:  Reco  21.8      46   0.001   13.3   0.6   12   63-74      6-17  (58)
317 PF05766 NinG:  Bacteriophage L  21.7      52  0.0011   17.8   0.8   14    2-15      5-18  (189)
318 PHA02998 RNA polymerase subuni  21.7      54  0.0012   17.6   0.9   38   32-73    143-182 (195)
319 KOG3456|consensus               21.6      42  0.0009   16.3   0.4   14   61-74    103-116 (120)
320 COG5246 PRP11 Splicing factor   21.5      33 0.00071   18.4   0.1   21   33-53     54-74  (222)
321 PF12591 DUF3762:  Protein of u  21.4      43 0.00093   14.8   0.4   10   66-75     70-79  (80)
322 PRK05580 primosome assembly pr  21.4      21 0.00046   23.0  -0.7   11   30-40    419-429 (679)
323 PF06467 zf-FCS:  MYM-type Zinc  21.0      51  0.0011   12.4   0.6   16   61-76      5-20  (43)
324 PRK00019 rpmE 50S ribosomal pr  20.9      46 0.00099   14.9   0.5   15   62-77     13-27  (72)
325 PRK11639 zinc uptake transcrip  20.6      51  0.0011   17.1   0.7   13   62-74    100-112 (169)
326 PF07295 DUF1451:  Protein of u  20.3      34 0.00074   17.5   0.0   10   32-41    112-121 (146)
327 TIGR00310 ZPR1_znf ZPR1 zinc f  20.2      59  0.0013   17.5   0.8   12   62-73     30-41  (192)
328 TIGR00240 ATCase_reg aspartate  20.1      44 0.00095   17.3   0.4   14   62-75    132-145 (150)
329 KOG2807|consensus               20.1      96  0.0021   18.5   1.7   20   32-51    290-309 (378)

No 1  
>KOG2462|consensus
Probab=99.94  E-value=2.8e-28  Score=126.83  Aligned_cols=77  Identities=29%  Similarity=0.520  Sum_probs=70.3

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCcccccccC
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      |++|.+||+.|.....|+.|++ +|+||+||.|+.|++.|.++++|+.||++|.+.  ++|.|..|+++|+..+.|.+|.
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiR-THTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~--K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIR-THTGEKPFSCPHCGKAFADRSNLRAHMQTHSDV--KKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             CcccccccccccchHHhhcccc-cccCCCCccCCcccchhcchHHHHHHHHhhcCC--ccccCcchhhHHHHHHHHHHhh
Confidence            6789999999999999999998 999999999999999999999999999999988  8999999999999999888874


No 2  
>KOG2462|consensus
Probab=99.93  E-value=1e-26  Score=121.02  Aligned_cols=76  Identities=30%  Similarity=0.551  Sum_probs=71.9

Q ss_pred             CCcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCccccccc
Q psy6273           2 TRYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYKIH   81 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H   81 (82)
                      +.+.|++|++.|.+...|..|++ +|.  .+++|.+||+.|..++-|+-|+++|+||  |||.|+.|+++|+.+++|+.|
T Consensus       160 ka~~C~~C~K~YvSmpALkMHir-TH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGE--KPF~C~hC~kAFADRSNLRAH  234 (279)
T KOG2462|consen  160 KAFSCKYCGKVYVSMPALKMHIR-THT--LPCECGICGKAFSRPWLLQGHIRTHTGE--KPFSCPHCGKAFADRSNLRAH  234 (279)
T ss_pred             ccccCCCCCceeeehHHHhhHhh-ccC--CCcccccccccccchHHhhcccccccCC--CCccCCcccchhcchHHHHHH
Confidence            55789999999999999999998 886  5789999999999999999999999999  999999999999999999998


Q ss_pred             C
Q psy6273          82 H   82 (82)
Q Consensus        82 ~   82 (82)
                      |
T Consensus       235 m  235 (279)
T KOG2462|consen  235 M  235 (279)
T ss_pred             H
Confidence            6


No 3  
>KOG3623|consensus
Probab=99.80  E-value=1.3e-20  Score=108.92  Aligned_cols=77  Identities=29%  Similarity=0.579  Sum_probs=74.1

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCcccccccC
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      .|.|..|+++|--.+.|.+|.- -|+|.+||+|.+|.++|..+-.|..|++.|.||  +||.|..|++.|+...+..+||
T Consensus       894 myaCDqCDK~FqKqSSLaRHKY-EHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGE--KPfQCdKClKRFSHSGSYSQHM  970 (1007)
T KOG3623|consen  894 MYACDQCDKAFQKQSSLARHKY-EHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGE--KPFQCDKCLKRFSHSGSYSQHM  970 (1007)
T ss_pred             cchHHHHHHHHHhhHHHHHhhh-hhcCCCCcccchhhHhhhhhhhhhhhhhhccCC--CcchhhhhhhhcccccchHhhh
Confidence            5889999999999999999987 999999999999999999999999999999999  9999999999999999988886


No 4  
>KOG3576|consensus
Probab=99.70  E-value=7.4e-19  Score=89.05  Aligned_cols=76  Identities=22%  Similarity=0.538  Sum_probs=70.4

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCccccccc
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYKIH   81 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H   81 (82)
                      .|.|.+|++.|....-|.+|++ -|...+.+-|..|++.|.+.-.|.+|+++|+|-  +||+|..|+++|.+.-+|..|
T Consensus       117 ~ftCrvCgK~F~lQRmlnrh~k-ch~~vkr~lct~cgkgfndtfdlkrh~rthtgv--rpykc~~c~kaftqrcslesh  192 (267)
T KOG3576|consen  117 SFTCRVCGKKFGLQRMLNRHLK-CHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGV--RPYKCSLCEKAFTQRCSLESH  192 (267)
T ss_pred             eeeeehhhhhhhHHHHHHHHhh-hccHHHHHHHhhccCcccchhhhhhhhccccCc--cccchhhhhHHHHhhccHHHH
Confidence            4789999999999999999998 899889999999999999999999999999999  999999999999998887765


No 5  
>KOG3623|consensus
Probab=99.64  E-value=1.2e-16  Score=92.91  Aligned_cols=77  Identities=29%  Similarity=0.615  Sum_probs=69.7

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCC-------------CCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccc
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTE-------------TKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCG   69 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~-------------~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~   69 (82)
                      .|.|..|..+|.....|.+|+. .|..             .+-|.|..|+++|..+-.|..|++.|.||  +||.|+.|+
T Consensus       240 nfsC~lCsytFAyRtQLErhm~-~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGE--KPfeCpnCk  316 (1007)
T KOG3623|consen  240 NFSCMLCSYTFAYRTQLERHMQ-LHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGE--KPFECPNCK  316 (1007)
T ss_pred             CCcchhhhhhhhhHHHHHHHHH-hhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCC--CCcCCcccc
Confidence            4789999999999999999987 6642             24589999999999999999999999999  999999999


Q ss_pred             ccccCcccccccC
Q psy6273          70 EVFRSHQGYKIHH   82 (82)
Q Consensus        70 ~~f~~~~~l~~H~   82 (82)
                      +.|+...++..||
T Consensus       317 KRFSHSGSySSHm  329 (1007)
T KOG3623|consen  317 KRFSHSGSYSSHM  329 (1007)
T ss_pred             cccccCCcccccc
Confidence            9999999888876


No 6  
>KOG1074|consensus
Probab=99.61  E-value=1.1e-16  Score=93.85  Aligned_cols=52  Identities=27%  Similarity=0.420  Sum_probs=26.7

Q ss_pred             cccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhc
Q psy6273           4 YKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMH   56 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~   56 (82)
                      ..|-.|-+...-...|+.|++ +|+|++||+|.+|+++|..+.+|..|+..|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyr-tHtGERPFkCKiCgRAFtTkGNLkaH~~vHk  657 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYR-THTGERPFKCKICGRAFTTKGNLKAHMSVHK  657 (958)
T ss_pred             cceeeeeecccchhhhhhhhh-cccCcCccccccccchhccccchhhcccccc
Confidence            344445555555555555554 5555555555555555555555555554443


No 7  
>PHA00733 hypothetical protein
Probab=99.48  E-value=7.8e-15  Score=70.79  Aligned_cols=77  Identities=25%  Similarity=0.420  Sum_probs=62.0

Q ss_pred             CCcccCcCCccccCHHHHHhH--HH--hhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCccc
Q psy6273           2 TRYKCHACDVETKTRQALDNH--IL--CVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQG   77 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l~~h--~~--~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~   77 (82)
                      |++.|.+|.+.+.....|..+  ..  ..+.+..+|.|+.|++.|.....|..|++.+  +  .+|.|..|++.|.....
T Consensus        39 ~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~--~~~~C~~CgK~F~~~~s  114 (128)
T PHA00733         39 KRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--E--HSKVCPVCGKEFRNTDS  114 (128)
T ss_pred             hhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--C--cCccCCCCCCccCCHHH
Confidence            567788888888877766655  11  1234578999999999999999999999876  3  67999999999999999


Q ss_pred             ccccC
Q psy6273          78 YKIHH   82 (82)
Q Consensus        78 l~~H~   82 (82)
                      |..|+
T Consensus       115 L~~H~  119 (128)
T PHA00733        115 TLDHV  119 (128)
T ss_pred             HHHHH
Confidence            98774


No 8  
>KOG3576|consensus
Probab=99.44  E-value=3.5e-14  Score=72.36  Aligned_cols=74  Identities=24%  Similarity=0.484  Sum_probs=62.4

Q ss_pred             CCcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCC---------CCCeeecCcccccc
Q psy6273           2 TRYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDE---------FVNLFSCPLCGEVF   72 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~---------~~~~~~C~~C~~~f   72 (82)
                      |.+-|..||+.|.+-.+|++|.+ +|+|.+||.|..|++.|...-+|..|++.-+|.         ..+-|.|..||..-
T Consensus       144 kr~lct~cgkgfndtfdlkrh~r-thtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg~t~  222 (267)
T KOG3576|consen  144 KRHLCTFCGKGFNDTFDLKRHTR-THTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCGYTS  222 (267)
T ss_pred             HHHHHhhccCcccchhhhhhhhc-cccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccCCCC
Confidence            34678999999999999999999 999999999999999999999999998765431         12789999999765


Q ss_pred             cCcc
Q psy6273          73 RSHQ   76 (82)
Q Consensus        73 ~~~~   76 (82)
                      ....
T Consensus       223 ~~~e  226 (267)
T KOG3576|consen  223 ERPE  226 (267)
T ss_pred             CChh
Confidence            4443


No 9  
>PHA02768 hypothetical protein; Provisional
Probab=99.40  E-value=1.6e-13  Score=56.58  Aligned_cols=44  Identities=16%  Similarity=0.394  Sum_probs=36.7

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCccccc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYK   79 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~   79 (82)
                      .|.|+.|++.|...++|..|++.|+    ++++|..|++.|...+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~----k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN----TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC----CcccCCcccceecccceeE
Confidence            4788899999999999999999888    5788888999888777663


No 10 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.31  E-value=2.8e-12  Score=45.90  Aligned_cols=26  Identities=35%  Similarity=0.811  Sum_probs=23.0

Q ss_pred             HHHHHHHHhcCCCCCeeecCcccccccC
Q psy6273          47 ALLQHKRKMHDEFVNLFSCPLCGEVFRS   74 (82)
Q Consensus        47 ~l~~h~~~~~~~~~~~~~C~~C~~~f~~   74 (82)
                      +|..|++.|+++  +||.|+.|++.|..
T Consensus         1 ~l~~H~~~H~~~--k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGE--KPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSS--SSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCC--CCCCCCCCcCeeCc
Confidence            578999999999  99999999999863


No 11 
>KOG1074|consensus
Probab=99.28  E-value=1.4e-12  Score=77.22  Aligned_cols=50  Identities=30%  Similarity=0.572  Sum_probs=47.6

Q ss_pred             CccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCcccccccC
Q psy6273          31 KSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        31 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      .+-+|..|.+...-+++|+.|.++|+||  +||+|+.||++|..+.+|+.||
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyrtHtGE--RPFkCKiCgRAFtTkGNLkaH~  653 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYRTHTGE--RPFKCKICGRAFTTKGNLKAHM  653 (958)
T ss_pred             CccceeeeeecccchhhhhhhhhcccCc--Cccccccccchhccccchhhcc
Confidence            4678999999999999999999999999  9999999999999999999996


No 12 
>KOG3608|consensus
Probab=99.27  E-value=5.3e-12  Score=69.08  Aligned_cols=79  Identities=24%  Similarity=0.570  Sum_probs=50.4

Q ss_pred             CCCcccCcCCccccCHHHHHhHHHhhCCCCCcccccc--chhhhcCcHHHHHHHHHhc-CCCCCeeecCcccccccCccc
Q psy6273           1 MTRYKCHACDVETKTRQALDNHILCVHTETKSFACDQ--CVSYFKTNSALLQHKRKMH-DEFVNLFSCPLCGEVFRSHQG   77 (82)
Q Consensus         1 ~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~--c~~~~~~~~~l~~h~~~~~-~~~~~~~~C~~C~~~f~~~~~   77 (82)
                      +|||+|..|+..+.....|..|.. .|+ +..|.|..  |...+.+...+.+|++-+. |....+|.|-.|.+.|....+
T Consensus       290 dkpfKCd~Cd~~c~~esdL~kH~~-~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~  367 (467)
T KOG3608|consen  290 DKPFKCDECDTRCVRESDLAKHVQ-VHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKS  367 (467)
T ss_pred             CCCccccchhhhhccHHHHHHHHH-hcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchh
Confidence            356666666666666666666665 555 44566633  6666666666666666543 444456777777777777777


Q ss_pred             cccc
Q psy6273          78 YKIH   81 (82)
Q Consensus        78 l~~H   81 (82)
                      |.+|
T Consensus       368 L~~H  371 (467)
T KOG3608|consen  368 LSAH  371 (467)
T ss_pred             HHHH
Confidence            7665


No 13 
>KOG3608|consensus
Probab=99.26  E-value=4.9e-12  Score=69.21  Aligned_cols=76  Identities=22%  Similarity=0.459  Sum_probs=51.9

Q ss_pred             CCcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCccccccc
Q psy6273           2 TRYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYKIH   81 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H   81 (82)
                      .+|.|..|-+.|.++..|..|+. .|.  ..|.|+.|+-+...+++|..|+++.+.+ .+||+|..|...|...+.|.+|
T Consensus       236 n~fqC~~C~KrFaTeklL~~Hv~-rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~-dkpfKCd~Cd~~c~~esdL~kH  311 (467)
T KOG3608|consen  236 NSFQCAQCFKRFATEKLLKSHVV-RHV--NCYKCPLCDMTCSSASSLTTHIRYRHSK-DKPFKCDECDTRCVRESDLAKH  311 (467)
T ss_pred             CchHHHHHHHHHhHHHHHHHHHH-Hhh--hcccccccccCCCChHHHHHHHHhhhcc-CCCccccchhhhhccHHHHHHH
Confidence            35677777777777777777766 453  3467777777777777777777764433 2777777777777777777665


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=99.20  E-value=8.5e-12  Score=51.53  Aligned_cols=43  Identities=16%  Similarity=0.386  Sum_probs=38.2

Q ss_pred             cccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHH
Q psy6273           4 YKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALL   49 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~   49 (82)
                      |+|+.||+.|...++|..|++ +|.  +++.|..|++.|...+.|.
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r-~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLR-KHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHH-hcC--CcccCCcccceecccceeE
Confidence            789999999999999999999 887  6889999999988776553


No 15 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.14  E-value=7e-11  Score=68.44  Aligned_cols=64  Identities=19%  Similarity=0.589  Sum_probs=51.7

Q ss_pred             CCcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccccc
Q psy6273           2 TRYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFR   73 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~   73 (82)
                      +.+.|+.|++.|. ...|..|+. .+.  .++.|+ |+..+ ....|..|+..+.++  +++.|..|+..|.
T Consensus       452 ~H~~C~~Cgk~f~-~s~LekH~~-~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~--Kpi~C~fC~~~v~  515 (567)
T PLN03086        452 NHVHCEKCGQAFQ-QGEMEKHMK-VFH--EPLQCP-CGVVL-EKEQMVQHQASTCPL--RLITCRFCGDMVQ  515 (567)
T ss_pred             cCccCCCCCCccc-hHHHHHHHH-hcC--CCccCC-CCCCc-chhHHHhhhhccCCC--CceeCCCCCCccc
Confidence            4567899999885 677899987 663  678898 98654 568888999888888  8999999998884


No 16 
>PHA00733 hypothetical protein
Probab=99.13  E-value=1.7e-10  Score=55.85  Aligned_cols=54  Identities=26%  Similarity=0.488  Sum_probs=47.7

Q ss_pred             CCCcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcC
Q psy6273           1 MTRYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHD   57 (82)
Q Consensus         1 ~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   57 (82)
                      .+||.|+.|++.|.....|..|+. .+  ..++.|..|++.|.....|..|+...++
T Consensus        71 ~kPy~C~~Cgk~Fss~s~L~~H~r-~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733         71 VSPYVCPLCLMPFSSSVSLKQHIR-YT--EHSKVCPVCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCccCCCCCCcCCCHHHHHHHHh-cC--CcCccCCCCCCccCCHHHHHHHHHHhcC
Confidence            368999999999999999999987 65  3578999999999999999999887654


No 17 
>KOG3993|consensus
Probab=98.98  E-value=2.5e-11  Score=67.62  Aligned_cols=78  Identities=26%  Similarity=0.520  Sum_probs=64.7

Q ss_pred             cccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCC------------------------
Q psy6273           4 YKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEF------------------------   59 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~------------------------   59 (82)
                      |.|..|...|.+...|.+|.. ...-...|.|+.|++.|.-+.+|..|.+.|....                        
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC-~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRC-PRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccC-CeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            678889999999999999976 6666667999999999999999999998874210                        


Q ss_pred             -------CCeeecCcccccccCcccccccC
Q psy6273          60 -------VNLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        60 -------~~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                             ..-|.|..|++.|.....|++|+
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHq  376 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQ  376 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhH
Confidence                   12489999999999999999984


No 18 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.96  E-value=8.7e-10  Score=64.06  Aligned_cols=68  Identities=15%  Similarity=0.356  Sum_probs=56.5

Q ss_pred             CCcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcC----------cHHHHHHHHHhcCCCCCeeecCccccc
Q psy6273           2 TRYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKT----------NSALLQHKRKMHDEFVNLFSCPLCGEV   71 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~----------~~~l~~h~~~~~~~~~~~~~C~~C~~~   71 (82)
                      +|+.|+ |+..+ ....|..|+. ++...+++.|+.|+..+..          .+.|..|+... |.  +++.|..||+.
T Consensus       477 kpv~Cp-Cg~~~-~R~~L~~H~~-thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~--rt~~C~~Cgk~  550 (567)
T PLN03086        477 EPLQCP-CGVVL-EKEQMVQHQA-STCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GS--RTAPCDSCGRS  550 (567)
T ss_pred             CCccCC-CCCCc-chhHHHhhhh-ccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CC--cceEccccCCe
Confidence            578899 99755 6789999987 8999999999999998842          34788998885 67  89999999988


Q ss_pred             ccCc
Q psy6273          72 FRSH   75 (82)
Q Consensus        72 f~~~   75 (82)
                      +..+
T Consensus       551 Vrlr  554 (567)
T PLN03086        551 VMLK  554 (567)
T ss_pred             eeeh
Confidence            8654


No 19 
>PHA00732 hypothetical protein
Probab=98.87  E-value=1.3e-09  Score=48.67  Aligned_cols=48  Identities=31%  Similarity=0.430  Sum_probs=36.4

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhc
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMH   56 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~   56 (82)
                      ||.|..|++.|.....|..|++..|.   ++.|+.|++.|.   .+..|..+..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccC
Confidence            68899999999999999999862244   357999999886   4666664443


No 20 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.87  E-value=8.9e-10  Score=39.31  Aligned_cols=25  Identities=32%  Similarity=0.647  Sum_probs=22.8

Q ss_pred             HHHhHHHhhCCCCCccccccchhhhc
Q psy6273          18 ALDNHILCVHTETKSFACDQCVSYFK   43 (82)
Q Consensus        18 ~l~~h~~~~~~~~~~~~c~~c~~~~~   43 (82)
                      +|..|++ +|+++++|.|+.|++.|.
T Consensus         1 ~l~~H~~-~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMR-THTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHH-HHSSSSSEEESSSSEEES
T ss_pred             CHHHHhh-hcCCCCCCCCCCCcCeeC
Confidence            5789998 999999999999999885


No 21 
>PHA00616 hypothetical protein
Probab=98.86  E-value=1.5e-09  Score=42.96  Aligned_cols=34  Identities=18%  Similarity=0.513  Sum_probs=20.6

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPL   67 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~   67 (82)
                      +++|+.||+.|...+.+..|++.++++  +++.|..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~--~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQ--NKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCC--CccceeE
Confidence            355666666666666666666666666  5665543


No 22 
>PHA00616 hypothetical protein
Probab=98.79  E-value=4.3e-09  Score=41.65  Aligned_cols=34  Identities=15%  Similarity=0.389  Sum_probs=31.4

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCCCCcccccc
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTETKSFACDQ   37 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~   37 (82)
                      ||.|+.||+.|.....|..|++ .+++++++.++.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r-~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLL-SVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHH-HhcCCCccceeE
Confidence            7899999999999999999998 899999988764


No 23 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.77  E-value=2e-09  Score=58.53  Aligned_cols=69  Identities=22%  Similarity=0.467  Sum_probs=42.0

Q ss_pred             CCcccCc--CCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCccccc
Q psy6273           2 TRYKCHA--CDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYK   79 (82)
Q Consensus         2 k~~~c~~--c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~   79 (82)
                      |||+|++  |++.+.....|+-|++..|...+..+-+.          -..+.-+-..+  +||.|+.|++.+.....|+
T Consensus       348 KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~----------p~~~~~F~~~~--KPYrCevC~KRYKNlNGLK  415 (423)
T COG5189         348 KPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPS----------PEKMNIFSAKD--KPYRCEVCDKRYKNLNGLK  415 (423)
T ss_pred             ceecCCCCCchhhhccccchhhhhhccccCcccCCCCC----------ccccccccccC--CceeccccchhhccCccce
Confidence            6777765  77777777777777653332222211110          01111122233  8999999999999999998


Q ss_pred             ccC
Q psy6273          80 IHH   82 (82)
Q Consensus        80 ~H~   82 (82)
                      -|+
T Consensus       416 YHr  418 (423)
T COG5189         416 YHR  418 (423)
T ss_pred             ecc
Confidence            774


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.73  E-value=9.6e-08  Score=39.78  Aligned_cols=51  Identities=24%  Similarity=0.451  Sum_probs=38.9

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCCC-CccccccchhhhcCcHHHHHHHHHhc
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTET-KSFACDQCVSYFKTNSALLQHKRKMH   56 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~-~~~~c~~c~~~~~~~~~l~~h~~~~~   56 (82)
                      .|.|+.|++ ..+...|..|....|..+ +.+.|+.|...+.  .+|..|+..++
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            578999999 566788999977566654 4688999987543  48888888765


No 25 
>PHA00732 hypothetical protein
Probab=98.71  E-value=1.3e-08  Score=45.49  Aligned_cols=39  Identities=38%  Similarity=0.673  Sum_probs=32.7

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccC
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRS   74 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~   74 (82)
                      +|.|..|++.|....+|..|++.++.    ++.|+.|++.|..
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~----~~~C~~CgKsF~~   39 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT----LTKCPVCNKSYRR   39 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC----CCccCCCCCEeCC
Confidence            57899999999999999999985332    3579999999984


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.41  E-value=1.9e-07  Score=38.90  Aligned_cols=48  Identities=25%  Similarity=0.448  Sum_probs=35.0

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCcccccccC
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      .|.|+.|++ ..+...|..|....+....+.+.|+.|...+..  +|..|+
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~~--~l~~Hl   49 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVTD--NLIRHL   49 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhhh--HHHHHH
Confidence            478999999 566788999987654432368999999876553  555553


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.41  E-value=1.7e-07  Score=32.24  Aligned_cols=21  Identities=29%  Similarity=0.695  Sum_probs=11.1

Q ss_pred             cccCcCCccccCHHHHHhHHH
Q psy6273           4 YKCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h~~   24 (82)
                      |.|+.|++.|.+...|..|++
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHh
Confidence            345555555555555555544


No 28 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.34  E-value=3.4e-07  Score=31.45  Aligned_cols=23  Identities=30%  Similarity=0.658  Sum_probs=21.0

Q ss_pred             cccccchhhhcCcHHHHHHHHHh
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKM   55 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~   55 (82)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhHC
Confidence            57999999999999999999864


No 29 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=98.24  E-value=1.6e-07  Score=43.45  Aligned_cols=23  Identities=26%  Similarity=0.434  Sum_probs=0.0

Q ss_pred             ccCcCCccccCHHHHHhHHHhhC
Q psy6273           5 KCHACDVETKTRQALDNHILCVH   27 (82)
Q Consensus         5 ~c~~c~~~~~~~~~l~~h~~~~~   27 (82)
                      +|..|+..|.+...|..|+...|
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H   23 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKH   23 (100)
T ss_dssp             -----------------------
T ss_pred             Ccccccccccccccccccccccc
Confidence            48889999999999999986444


No 30 
>KOG3993|consensus
Probab=98.24  E-value=8.1e-07  Score=50.30  Aligned_cols=54  Identities=22%  Similarity=0.472  Sum_probs=44.6

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCC--------------------------------CCCccccccchhhhcCcHHHHH
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHT--------------------------------ETKSFACDQCVSYFKTNSALLQ   50 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~--------------------------------~~~~~~c~~c~~~~~~~~~l~~   50 (82)
                      -|+|++|++.|.-..||..|.++...                                .+.-|.|..|++.|.....|..
T Consensus       295 EYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrK  374 (500)
T KOG3993|consen  295 EYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRK  374 (500)
T ss_pred             eecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHH
Confidence            38899999999999999999875111                                1124899999999999999999


Q ss_pred             HHHHhc
Q psy6273          51 HKRKMH   56 (82)
Q Consensus        51 h~~~~~   56 (82)
                      |+.+|.
T Consensus       375 Hqlthq  380 (500)
T KOG3993|consen  375 HQLTHQ  380 (500)
T ss_pred             hHHhhh
Confidence            988776


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.21  E-value=1.5e-06  Score=30.95  Aligned_cols=24  Identities=25%  Similarity=0.531  Sum_probs=17.6

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhC
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVH   27 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~   27 (82)
                      ||.|..|++.|.+...|..|++ .|
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~-~h   24 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKR-SH   24 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHC-TT
T ss_pred             CCCCCccCCccCChhHHHHHhH-Hh
Confidence            5677777777777777777775 44


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=98.06  E-value=3.3e-06  Score=28.95  Aligned_cols=20  Identities=20%  Similarity=0.614  Sum_probs=9.7

Q ss_pred             ccCcCCccccCHHHHHhHHH
Q psy6273           5 KCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         5 ~c~~c~~~~~~~~~l~~h~~   24 (82)
                      .|+.|+..|.+...|..|+.
T Consensus         2 ~C~~C~~~~~~~~~l~~H~~   21 (24)
T PF13894_consen    2 QCPICGKSFRSKSELRQHMR   21 (24)
T ss_dssp             E-SSTS-EESSHHHHHHHHH
T ss_pred             CCcCCCCcCCcHHHHHHHHH
Confidence            45555555555555555544


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=98.02  E-value=1.8e-06  Score=30.75  Aligned_cols=25  Identities=44%  Similarity=0.757  Sum_probs=19.5

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMH   56 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~   56 (82)
                      ++.|..|+..|.....|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4678888888888888888887664


No 34 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.93  E-value=1.5e-05  Score=27.21  Aligned_cols=24  Identities=42%  Similarity=0.762  Sum_probs=19.6

Q ss_pred             cccccchhhhcCcHHHHHHHHHhc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMH   56 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~   56 (82)
                      |.|+.|+..|.....|..|+..++
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            579999999999999999998763


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.89  E-value=1.9e-05  Score=32.16  Aligned_cols=32  Identities=16%  Similarity=0.291  Sum_probs=23.1

Q ss_pred             CCCCCccccccchhhhcCcHHHHHHHHHhcCC
Q psy6273          27 HTETKSFACDQCVSYFKTNSALLQHKRKMHDE   58 (82)
Q Consensus        27 ~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~   58 (82)
                      ...+.|..|+.|+..+....+|.+|+...++.
T Consensus        19 ~~S~~PatCP~C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   19 SQSEQPATCPICGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             CTTS--EE-TTT--EESSHHHHHHHHHHHTTT
T ss_pred             hccCCCCCCCcchhhccchhhHHHHHHHHhcc
Confidence            44577889999999999999999999888776


No 36 
>PRK04860 hypothetical protein; Provisional
Probab=97.89  E-value=1.1e-05  Score=40.63  Aligned_cols=40  Identities=23%  Similarity=0.628  Sum_probs=33.7

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCccc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQG   77 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~   77 (82)
                      +|.|. |+.   ....+..|.+++.++  ++|.|..|+..|.....
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~ri~~g~--~~YrC~~C~~~l~~~~~  158 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNRVVRGE--AVYRCRRCGETLVFKGE  158 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHHHhcCC--ccEECCCCCceeEEecc
Confidence            58897 876   667889999999999  99999999998875543


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.69  E-value=5.4e-05  Score=26.11  Aligned_cols=20  Identities=30%  Similarity=0.677  Sum_probs=9.6

Q ss_pred             ccCcCCccccCHHHHHhHHH
Q psy6273           5 KCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         5 ~c~~c~~~~~~~~~l~~h~~   24 (82)
                      .|..|++.|.....|..|+.
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (26)
T smart00355        2 RCPECGKVFKSKSALKEHMR   21 (26)
T ss_pred             CCCCCcchhCCHHHHHHHHH
Confidence            34445555555544444443


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.59  E-value=7.2e-05  Score=30.49  Aligned_cols=30  Identities=17%  Similarity=0.338  Sum_probs=20.2

Q ss_pred             CCCcccCcCCccccCHHHHHhHHHhhCCCCC
Q psy6273           1 MTRYKCHACDVETKTRQALDNHILCVHTETK   31 (82)
Q Consensus         1 ~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~   31 (82)
                      +.|-.|++|+..+....+|.+|+. ...+.+
T Consensus        22 ~~PatCP~C~a~~~~srnLrRHle-~~H~~k   51 (54)
T PF09237_consen   22 EQPATCPICGAVIRQSRNLRRHLE-IRHFKK   51 (54)
T ss_dssp             S--EE-TTT--EESSHHHHHHHHH-HHTTTS
T ss_pred             CCCCCCCcchhhccchhhHHHHHH-HHhccc
Confidence            357789999999999999999997 444443


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.57  E-value=0.00012  Score=25.16  Aligned_cols=24  Identities=38%  Similarity=0.725  Sum_probs=21.1

Q ss_pred             cccccchhhhcCcHHHHHHHHHhc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMH   56 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~   56 (82)
                      +.|..|++.|.....|..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            468999999999999999998654


No 40 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.39  E-value=7.2e-05  Score=26.58  Aligned_cols=20  Identities=35%  Similarity=0.692  Sum_probs=14.4

Q ss_pred             eecCcccccccCcccccccC
Q psy6273          63 FSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        63 ~~C~~C~~~f~~~~~l~~H~   82 (82)
                      |.|..|++.|.....+..|+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCT
T ss_pred             CCcccCCCCcCCHHHHHHHH
Confidence            56777777777777777664


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.39  E-value=6.6e-05  Score=26.06  Aligned_cols=19  Identities=21%  Similarity=0.632  Sum_probs=10.2

Q ss_pred             ccCcCCccccCHHHHHhHH
Q psy6273           5 KCHACDVETKTRQALDNHI   23 (82)
Q Consensus         5 ~c~~c~~~~~~~~~l~~h~   23 (82)
                      .|..|+..|.+...+..|.
T Consensus         2 ~C~~C~~~f~s~~~~~~H~   20 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHL   20 (25)
T ss_dssp             EETTTTEEESSHHHHHHHH
T ss_pred             CCCCCCCCcCCHHHHHHHH
Confidence            4555555555555555554


No 42 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.39  E-value=0.00011  Score=25.44  Aligned_cols=23  Identities=39%  Similarity=0.723  Sum_probs=20.3

Q ss_pred             cccccchhhhcCcHHHHHHHHHh
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKM   55 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~   55 (82)
                      |.|..|+..|.+...+..|++.+
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56999999999999999998764


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.25  E-value=0.00024  Score=24.38  Aligned_cols=20  Identities=25%  Similarity=0.527  Sum_probs=8.5

Q ss_pred             ccccchhhhcCcHHHHHHHHH
Q psy6273          34 ACDQCVSYFKTNSALLQHKRK   54 (82)
Q Consensus        34 ~c~~c~~~~~~~~~l~~h~~~   54 (82)
                      .|+.|+.... ...|..|++.
T Consensus         2 ~C~~C~y~t~-~~~l~~H~~~   21 (24)
T PF13909_consen    2 KCPHCSYSTS-KSNLKRHLKR   21 (24)
T ss_dssp             E-SSSS-EES-HHHHHHHHHH
T ss_pred             CCCCCCCcCC-HHHHHHHHHh
Confidence            3444544444 4445555444


No 44 
>PRK04860 hypothetical protein; Provisional
Probab=97.22  E-value=0.00018  Score=36.41  Aligned_cols=38  Identities=18%  Similarity=0.498  Sum_probs=31.3

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCc
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTN   45 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~   45 (82)
                      +|.|. |+.   ....+.+|.+ ++.++++|.|..|+..+...
T Consensus       119 ~Y~C~-C~~---~~~~~rrH~r-i~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        119 PYRCK-CQE---HQLTVRRHNR-VVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEcC-CCC---eeCHHHHHHH-HhcCCccEECCCCCceeEEe
Confidence            57897 887   5566789998 99999999999999877544


No 45 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.43  E-value=0.0028  Score=22.11  Aligned_cols=18  Identities=28%  Similarity=0.584  Sum_probs=7.7

Q ss_pred             ccccchhhhcCcHHHHHHH
Q psy6273          34 ACDQCVSYFKTNSALLQHK   52 (82)
Q Consensus        34 ~c~~c~~~~~~~~~l~~h~   52 (82)
                      +|+.|++.| ..+.|..|+
T Consensus         4 ~C~~CgR~F-~~~~l~~H~   21 (25)
T PF13913_consen    4 PCPICGRKF-NPDRLEKHE   21 (25)
T ss_pred             cCCCCCCEE-CHHHHHHHH
Confidence            344444444 333444443


No 46 
>KOG2893|consensus
Probab=96.25  E-value=0.0022  Score=34.54  Aligned_cols=30  Identities=30%  Similarity=0.765  Sum_probs=15.1

Q ss_pred             cccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccc
Q psy6273          35 CDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGE   70 (82)
Q Consensus        35 c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~   70 (82)
                      |..|++.|.....|.+|++    .  +.|+|-.|-+
T Consensus        13 cwycnrefddekiliqhqk----a--khfkchichk   42 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQK----A--KHFKCHICHK   42 (341)
T ss_pred             eeecccccchhhhhhhhhh----h--ccceeeeehh
Confidence            4455555555555555443    1  3455555544


No 47 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=96.03  E-value=0.0071  Score=22.46  Aligned_cols=22  Identities=18%  Similarity=0.581  Sum_probs=14.7

Q ss_pred             CcccCcCCccccCHHHHHhHHH
Q psy6273           3 RYKCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~   24 (82)
                      +|.|..|+..|.+...+..|+.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~   24 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLK   24 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHC
Confidence            4667777777776666666654


No 48 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=95.83  E-value=0.0015  Score=36.55  Aligned_cols=24  Identities=29%  Similarity=0.542  Sum_probs=17.2

Q ss_pred             CCCcccCcCCccccCHHHHHhHHH
Q psy6273           1 MTRYKCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         1 ~k~~~c~~c~~~~~~~~~l~~h~~   24 (82)
                      +|||.|++|++.+.....|+-|+.
T Consensus       396 ~KPYrCevC~KRYKNlNGLKYHr~  419 (423)
T COG5189         396 DKPYRCEVCDKRYKNLNGLKYHRK  419 (423)
T ss_pred             CCceeccccchhhccCccceeccc
Confidence            367777777777777777776653


No 49 
>KOG1146|consensus
Probab=95.83  E-value=0.0093  Score=39.06  Aligned_cols=53  Identities=28%  Similarity=0.464  Sum_probs=43.1

Q ss_pred             CCcccCcCCccccCHHHHHhHHHhhCC------------------------CCCccccccchhhhcCcHHHHHHHHH
Q psy6273           2 TRYKCHACDVETKTRQALDNHILCVHT------------------------ETKSFACDQCVSYFKTNSALLQHKRK   54 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l~~h~~~~~~------------------------~~~~~~c~~c~~~~~~~~~l~~h~~~   54 (82)
                      |-+.|+.|+..|.....|..|++..|.                        +.+++.|..|...+..+.+|..|+..
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHHH
Confidence            457899999999999999999983232                        23578899999999999999888764


No 50 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=95.83  E-value=0.01  Score=22.68  Aligned_cols=34  Identities=29%  Similarity=0.710  Sum_probs=20.1

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFR   73 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~   73 (82)
                      ..|+.|...|.....-     ...+.  ....|+.|+..|.
T Consensus         3 i~CP~C~~~f~v~~~~-----l~~~~--~~vrC~~C~~~f~   36 (37)
T PF13719_consen    3 ITCPNCQTRFRVPDDK-----LPAGG--RKVRCPKCGHVFR   36 (37)
T ss_pred             EECCCCCceEEcCHHH-----cccCC--cEEECCCCCcEee
Confidence            3577777777666541     22233  5677777776664


No 51 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=95.40  E-value=0.015  Score=24.58  Aligned_cols=32  Identities=28%  Similarity=0.550  Sum_probs=20.7

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGE   70 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~   70 (82)
                      .|.|++|++.....-.     +-..-.  .+|.|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc~-----~CRk~g--~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCA-----KCRKLG--NPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhh-----hHHHcC--CceECCCcCc
Confidence            4889999965444332     222223  6899999985


No 52 
>KOG2186|consensus
Probab=95.14  E-value=0.015  Score=31.68  Aligned_cols=47  Identities=19%  Similarity=0.518  Sum_probs=28.0

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHH
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKR   53 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~   53 (82)
                      -|.|..||....- ..+.+|+. .-++ .-|+|.+|++.|.. ..+..|..
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~s-rCrn-~~fSCIDC~k~F~~-~sYknH~k   49 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMS-RCRN-AYFSCIDCGKTFER-VSYKNHTK   49 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHH-hccC-CeeEEeeccccccc-chhhhhhh
Confidence            3567777766553 33566764 4343 45777778777776 33445543


No 53 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=95.07  E-value=0.023  Score=21.56  Aligned_cols=33  Identities=21%  Similarity=0.599  Sum_probs=17.5

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVF   72 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f   72 (82)
                      ..|+.|...|.-.+..     .-...  ....|+.|+..|
T Consensus         3 i~Cp~C~~~y~i~d~~-----ip~~g--~~v~C~~C~~~f   35 (36)
T PF13717_consen    3 ITCPNCQAKYEIDDEK-----IPPKG--RKVRCSKCGHVF   35 (36)
T ss_pred             EECCCCCCEEeCCHHH-----CCCCC--cEEECCCCCCEe
Confidence            3566666666555542     11222  456677676655


No 54 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=95.06  E-value=0.023  Score=21.62  Aligned_cols=33  Identities=21%  Similarity=0.563  Sum_probs=15.7

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVF   72 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f   72 (82)
                      ..|+.|+..|......     .....  ....|+.|+..|
T Consensus         3 ~~CP~C~~~~~v~~~~-----~~~~~--~~v~C~~C~~~~   35 (38)
T TIGR02098         3 IQCPNCKTSFRVVDSQ-----LGANG--GKVRCGKCGHVW   35 (38)
T ss_pred             EECCCCCCEEEeCHHH-----cCCCC--CEEECCCCCCEE
Confidence            3566666555544432     11111  245666666554


No 55 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=94.94  E-value=0.037  Score=25.30  Aligned_cols=21  Identities=29%  Similarity=0.806  Sum_probs=10.0

Q ss_pred             cccCcCCccccCHHHHHhHHH
Q psy6273           4 YKCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h~~   24 (82)
                      +.|..|++.|.+...|..|+.
T Consensus        51 ~~C~~C~~~f~s~~~l~~Hm~   71 (100)
T PF12756_consen   51 FRCPYCNKTFRSREALQEHMR   71 (100)
T ss_dssp             EEBSSSS-EESSHHHHHHHHH
T ss_pred             CCCCccCCCCcCHHHHHHHHc
Confidence            445555555555555555544


No 56 
>KOG1146|consensus
Probab=94.83  E-value=0.004  Score=40.61  Aligned_cols=57  Identities=25%  Similarity=0.419  Sum_probs=45.0

Q ss_pred             hCCCCCccccccchhhhcCcHHHHHHHHHhcCCC-----------------------CCeeecCcccccccCcccccccC
Q psy6273          26 VHTETKSFACDQCVSYFKTNSALLQHKRKMHDEF-----------------------VNLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        26 ~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~-----------------------~~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      .+...+.+.|+.|+-.+.....|..||+..+.+.                       .++|.|..|..++....+|.+|+
T Consensus       459 L~S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihl  538 (1406)
T KOG1146|consen  459 LHSFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHL  538 (1406)
T ss_pred             eecccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHH
Confidence            4445578999999999999999999998822110                       26899999999999988887774


No 57 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.76  E-value=0.018  Score=27.47  Aligned_cols=15  Identities=33%  Similarity=0.886  Sum_probs=9.4

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      .|..|+.||..|.-.
T Consensus        25 ~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   25 DPIVCPKCGTEFPPE   39 (108)
T ss_pred             CCccCCCCCCccCcc
Confidence            566777777666543


No 58 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.69  E-value=0.012  Score=21.84  Aligned_cols=8  Identities=50%  Similarity=1.634  Sum_probs=4.4

Q ss_pred             eeecCccc
Q psy6273          62 LFSCPLCG   69 (82)
Q Consensus        62 ~~~C~~C~   69 (82)
                      ++.|+.||
T Consensus        17 ~~~CP~Cg   24 (33)
T cd00350          17 PWVCPVCG   24 (33)
T ss_pred             CCcCcCCC
Confidence            55555554


No 59 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=94.62  E-value=0.016  Score=29.66  Aligned_cols=23  Identities=30%  Similarity=0.749  Sum_probs=18.5

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCG   69 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~   69 (82)
                      -|.|++||..             +.|+  .|..||.||
T Consensus       134 ~~vC~vCGy~-------------~~ge--~P~~CPiCg  156 (166)
T COG1592         134 VWVCPVCGYT-------------HEGE--APEVCPICG  156 (166)
T ss_pred             EEEcCCCCCc-------------ccCC--CCCcCCCCC
Confidence            5999999875             3445  899999998


No 60 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=94.57  E-value=0.0067  Score=37.36  Aligned_cols=57  Identities=21%  Similarity=0.368  Sum_probs=39.8

Q ss_pred             ccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccc
Q psy6273           5 KCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGE   70 (82)
Q Consensus         5 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~   70 (82)
                      .|..||-+|+....|---+.++...+-+ .|+.|.+.+.++.+-    ++|.    .|..|+.||=
T Consensus       125 ~CT~CGPRfTIi~alPYDR~nTsM~~F~-lC~~C~~EY~dP~nR----RfHA----Qp~aCp~CGP  181 (750)
T COG0068         125 NCTNCGPRFTIIEALPYDRENTSMADFP-LCPFCDKEYKDPLNR----RFHA----QPIACPKCGP  181 (750)
T ss_pred             ccCCCCcceeeeccCCCCcccCccccCc-CCHHHHHHhcCcccc----cccc----ccccCcccCC
Confidence            3899999999877765443323333333 689999988887763    4555    5889999984


No 61 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=94.41  E-value=0.0042  Score=33.00  Aligned_cols=22  Identities=23%  Similarity=0.460  Sum_probs=16.1

Q ss_pred             CCCcccCcCCccccCHHHHHhH
Q psy6273           1 MTRYKCHACDVETKTRQALDNH   22 (82)
Q Consensus         1 ~k~~~c~~c~~~~~~~~~l~~h   22 (82)
                      +|...|++|++.|.++......
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs~~   24 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRSGK   24 (214)
T ss_pred             CCceECCCCCCeeeeeEEEcCC
Confidence            4677899999999887544433


No 62 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=94.33  E-value=0.0053  Score=34.95  Aligned_cols=62  Identities=23%  Similarity=0.363  Sum_probs=42.9

Q ss_pred             CcccCcCCccccCHHHHHhHHHh-hCCCC--Cccccc--cchhhhcCcHHHHHHHHHhcCCCCCeeecC
Q psy6273           3 RYKCHACDVETKTRQALDNHILC-VHTET--KSFACD--QCVSYFKTNSALLQHKRKMHDEFVNLFSCP   66 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~   66 (82)
                      ++.|..|...+.....+..|... .|.++  .++.|+  .|++.|.....+..|...+.+.  .++.+.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~  355 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSI--SPAKEK  355 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCC--Cccccc
Confidence            45667777777777777777652 46667  777777  6777777777777777777766  555543


No 63 
>KOG4173|consensus
Probab=94.29  E-value=0.012  Score=31.07  Aligned_cols=72  Identities=22%  Similarity=0.471  Sum_probs=45.1

Q ss_pred             cccCc--CCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhc----------CCCCCeeec--Cccc
Q psy6273           4 YKCHA--CDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMH----------DEFVNLFSC--PLCG   69 (82)
Q Consensus         4 ~~c~~--c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~----------~~~~~~~~C--~~C~   69 (82)
                      +.|++  |-+.+.....+..|.. +..+   -.|..|.+.|.+..-|..|+.-.+          |.  .-|.|  ..|+
T Consensus        80 ~~cqvagc~~~~d~lD~~E~hY~-~~h~---~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~--dMy~ClvEgCt  153 (253)
T KOG4173|consen   80 FACQVAGCCQVFDALDDYEHHYH-TLHG---NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQ--DMYQCLVEGCT  153 (253)
T ss_pred             ccccccchHHHHhhhhhHHHhhh-hccc---chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCc--cHHHHHHHhhh
Confidence            44555  5667777777777765 4333   368888888887777766654322          22  45777  3487


Q ss_pred             ccccCccccccc
Q psy6273          70 EVFRSHQGYKIH   81 (82)
Q Consensus        70 ~~f~~~~~l~~H   81 (82)
                      ..|.....-+.|
T Consensus       154 ~KFkT~r~RkdH  165 (253)
T KOG4173|consen  154 EKFKTSRDRKDH  165 (253)
T ss_pred             hhhhhhhhhhhH
Confidence            777766554444


No 64 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=94.22  E-value=0.027  Score=23.49  Aligned_cols=22  Identities=18%  Similarity=0.446  Sum_probs=16.2

Q ss_pred             CcccCcCCccccCHHHHHhHHH
Q psy6273           3 RYKCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~   24 (82)
                      -+.|+-|+..|.....+.+|..
T Consensus        17 ~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          17 FLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             eeeCCchhHHHHHhHHHHHHhh
Confidence            3567778888877777777765


No 65 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=94.05  E-value=0.022  Score=21.37  Aligned_cols=9  Identities=44%  Similarity=1.243  Sum_probs=5.0

Q ss_pred             CeeecCccc
Q psy6273          61 NLFSCPLCG   69 (82)
Q Consensus        61 ~~~~C~~C~   69 (82)
                      .|..|+.||
T Consensus        17 ~p~~CP~Cg   25 (34)
T cd00729          17 APEKCPICG   25 (34)
T ss_pred             CCCcCcCCC
Confidence            345666665


No 66 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=93.27  E-value=0.11  Score=26.51  Aligned_cols=34  Identities=32%  Similarity=0.648  Sum_probs=24.1

Q ss_pred             CCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccc
Q psy6273          28 TETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVF   72 (82)
Q Consensus        28 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f   72 (82)
                      ....-|.|+.|+..|....++.           .-|.|+.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~-----------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME-----------LNFTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH-----------cCCcCCCCCCEe
Confidence            3456788988887776666653           358999998653


No 67 
>KOG2186|consensus
Probab=92.94  E-value=0.061  Score=29.42  Aligned_cols=44  Identities=32%  Similarity=0.696  Sum_probs=32.5

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCccccccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYKIH   81 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H   81 (82)
                      |.|..|+....-+ .+.+|+....+.   .|.|-.|+..|.. .+.+.|
T Consensus         4 FtCnvCgEsvKKp-~vekH~srCrn~---~fSCIDC~k~F~~-~sYknH   47 (276)
T KOG2186|consen    4 FTCNVCGESVKKP-QVEKHMSRCRNA---YFSCIDCGKTFER-VSYKNH   47 (276)
T ss_pred             Eehhhhhhhcccc-chHHHHHhccCC---eeEEeeccccccc-chhhhh
Confidence            6889999876554 456788777764   7999999999987 344444


No 68 
>KOG2482|consensus
Probab=92.84  E-value=0.17  Score=29.06  Aligned_cols=80  Identities=21%  Similarity=0.493  Sum_probs=53.8

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCCCC----------------------------------------------------
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHTET----------------------------------------------------   30 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~----------------------------------------------------   30 (82)
                      .+.|-.|.+.|..+..|..||+......                                                    
T Consensus       195 r~~CLyCekifrdkntLkeHMrkK~HrrinPknreYDkfyiINY~ev~ks~t~~~~e~dret~~d~~E~D~~wsDw~ed~  274 (423)
T KOG2482|consen  195 RLRCLYCEKIFRDKNTLKEHMRKKRHRRINPKNREYDKFYIINYLEVGKSWTIVHSEDDRETNEDINETDDTWSDWNEDD  274 (423)
T ss_pred             hheeeeeccccCCcHHHHHHHHhccCcccCCCccccceEEEEeHhhcCCccchhhhhhhhhhhccccccccchhhhhcCC
Confidence            3578889999999999999987411100                                                    


Q ss_pred             -C--ccccccchhhhcCcHHHHHHHHHhcC--------C-C----------------CCeeecCcccccccCcccccccC
Q psy6273          31 -K--SFACDQCVSYFKTNSALLQHKRKMHD--------E-F----------------VNLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        31 -~--~~~c~~c~~~~~~~~~l~~h~~~~~~--------~-~----------------~~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                       .  ...|-.|.........|..||..-+.        + +                ...-.|..|.-.|.....|..||
T Consensus       275 a~a~~v~CLfC~~~~en~~~l~eHmk~vHe~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm  354 (423)
T KOG2482|consen  275 AEALSVVCLFCTNFYENPVFLFEHMKIVHEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHM  354 (423)
T ss_pred             CCccceEEEeeccchhhHHHHHHHHHHHHHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhc
Confidence             0  13677787777777888888864321        0 0                02245667778888888887775


No 69 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=92.76  E-value=0.06  Score=19.32  Aligned_cols=11  Identities=45%  Similarity=0.939  Sum_probs=7.8

Q ss_pred             eecCccccccc
Q psy6273          63 FSCPLCGEVFR   73 (82)
Q Consensus        63 ~~C~~C~~~f~   73 (82)
                      |.|..|++.|.
T Consensus         1 ~sCiDC~~~F~   11 (28)
T PF08790_consen    1 FSCIDCSKDFD   11 (28)
T ss_dssp             EEETTTTEEEE
T ss_pred             CeeecCCCCcC
Confidence            46777877774


No 70 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=92.68  E-value=0.097  Score=22.18  Aligned_cols=33  Identities=24%  Similarity=0.602  Sum_probs=20.1

Q ss_pred             CccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccc
Q psy6273          31 KSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGE   70 (82)
Q Consensus        31 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~   70 (82)
                      ..|.|+.|+......-.     +-....  .+|.|+.||.
T Consensus        24 ~~F~CPnCG~~~I~RC~-----~CRk~~--~~Y~CP~CGF   56 (59)
T PRK14890         24 VKFLCPNCGEVIIYRCE-----KCRKQS--NPYTCPKCGF   56 (59)
T ss_pred             CEeeCCCCCCeeEeech-----hHHhcC--CceECCCCCC
Confidence            35889999876333221     222223  6899999985


No 71 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=92.31  E-value=0.037  Score=22.07  Aligned_cols=9  Identities=44%  Similarity=1.110  Sum_probs=4.3

Q ss_pred             eeecCcccc
Q psy6273          62 LFSCPLCGE   70 (82)
Q Consensus        62 ~~~C~~C~~   70 (82)
                      ...|+.||.
T Consensus        21 ~~~Cp~CG~   29 (46)
T PRK00398         21 GVRCPYCGY   29 (46)
T ss_pred             ceECCCCCC
Confidence            345555543


No 72 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=92.30  E-value=0.48  Score=23.82  Aligned_cols=38  Identities=26%  Similarity=0.619  Sum_probs=24.5

Q ss_pred             CCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccc
Q psy6273          29 ETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVF   72 (82)
Q Consensus        29 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f   72 (82)
                      ....|.|+.|+..|.....+.    ....+  ..|.|+.||...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~----~~d~~--~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQ----LLDMD--GTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHH----hcCCC--CcEECCCCCCEE
Confidence            455789999998876544332    11113  459999998754


No 73 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=92.27  E-value=0.15  Score=26.54  Aligned_cols=33  Identities=33%  Similarity=0.735  Sum_probs=20.9

Q ss_pred             CCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccc
Q psy6273          29 ETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVF   72 (82)
Q Consensus        29 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f   72 (82)
                      ...-|.|+.|+..|....++.           .-|.|+.||...
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~-----------~~F~Cp~Cg~~L  146 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME-----------YGFRCPQCGEML  146 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh-----------cCCcCCCCCCCC
Confidence            345677888877665555442           358888887543


No 74 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=91.77  E-value=0.11  Score=25.50  Aligned_cols=12  Identities=33%  Similarity=0.490  Sum_probs=6.4

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      .|..|+.||..|
T Consensus        25 ~p~vcP~cg~~~   36 (129)
T TIGR02300        25 RPAVSPYTGEQF   36 (129)
T ss_pred             CCccCCCcCCcc
Confidence            455555555544


No 75 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=91.42  E-value=0.12  Score=17.88  Aligned_cols=10  Identities=50%  Similarity=1.105  Sum_probs=6.7

Q ss_pred             CeeecCcccc
Q psy6273          61 NLFSCPLCGE   70 (82)
Q Consensus        61 ~~~~C~~C~~   70 (82)
                      .+|.|+.||+
T Consensus        15 v~f~CPnCG~   24 (24)
T PF07754_consen   15 VPFPCPNCGF   24 (24)
T ss_pred             ceEeCCCCCC
Confidence            4677777763


No 76 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=91.26  E-value=0.071  Score=30.47  Aligned_cols=51  Identities=35%  Similarity=0.658  Sum_probs=42.3

Q ss_pred             ccccccchhhhcCcHHHHHHHH--HhcCCCCCeeecC--cccccccCcccccccC
Q psy6273          32 SFACDQCVSYFKTNSALLQHKR--KMHDEFVNLFSCP--LCGEVFRSHQGYKIHH   82 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~--~~~~~~~~~~~C~--~C~~~f~~~~~l~~H~   82 (82)
                      .+.|..|...|.....+..|.+  .|.++..+|+.|+  .|++.|.....+..|.
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~  343 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHI  343 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCc
Confidence            5788889999999999999999  6776522599999  7999999998887763


No 77 
>PHA00626 hypothetical protein
Probab=91.11  E-value=0.12  Score=21.63  Aligned_cols=15  Identities=20%  Similarity=0.350  Sum_probs=11.1

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      ..|.|+.||..|+..
T Consensus        22 nrYkCkdCGY~ft~~   36 (59)
T PHA00626         22 DDYVCCDCGYNDSKD   36 (59)
T ss_pred             cceEcCCCCCeechh
Confidence            568888888777654


No 78 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=90.82  E-value=0.25  Score=26.56  Aligned_cols=26  Identities=23%  Similarity=0.528  Sum_probs=20.2

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCC
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHT   28 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~   28 (82)
                      .|.|..|++.|.-...+..|+...|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            47899999999999999999986554


No 79 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=90.72  E-value=0.19  Score=19.99  Aligned_cols=10  Identities=30%  Similarity=0.903  Sum_probs=5.5

Q ss_pred             CeeecCcccc
Q psy6273          61 NLFSCPLCGE   70 (82)
Q Consensus        61 ~~~~C~~C~~   70 (82)
                      .+..|+.||.
T Consensus        18 ~~irC~~CG~   27 (44)
T smart00659       18 DVVRCRECGY   27 (44)
T ss_pred             CceECCCCCc
Confidence            3556666653


No 80 
>KOG2893|consensus
Probab=90.45  E-value=0.068  Score=29.10  Aligned_cols=32  Identities=28%  Similarity=0.581  Sum_probs=26.2

Q ss_pred             cCcCCccccCHHHHHhHHHhhCCCCCccccccchhhh
Q psy6273           6 CHACDVETKTRQALDNHILCVHTETKSFACDQCVSYF   42 (82)
Q Consensus         6 c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~   42 (82)
                      |=.|++.|..+..|.+|++.     +.|.|-+|.+..
T Consensus        13 cwycnrefddekiliqhqka-----khfkchichkkl   44 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKA-----KHFKCHICHKKL   44 (341)
T ss_pred             eeecccccchhhhhhhhhhh-----ccceeeeehhhh
Confidence            67799999999999999883     348899998643


No 81 
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=90.37  E-value=0.28  Score=20.05  Aligned_cols=13  Identities=23%  Similarity=0.595  Sum_probs=7.2

Q ss_pred             CCcccCcCCcccc
Q psy6273           2 TRYKCHACDVETK   14 (82)
Q Consensus         2 k~~~c~~c~~~~~   14 (82)
                      +.+.|..||..|.
T Consensus         3 k~l~C~dCg~~Fv   15 (49)
T PF13451_consen    3 KTLTCKDCGAEFV   15 (49)
T ss_pred             eeEEcccCCCeEE
Confidence            4555666665544


No 82 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=90.04  E-value=0.099  Score=21.83  Aligned_cols=41  Identities=20%  Similarity=0.444  Sum_probs=22.9

Q ss_pred             Ccccccc--chhhhcCcHHHHHHHHHhcCCCCCeeecCc----ccccccC
Q psy6273          31 KSFACDQ--CVSYFKTNSALLQHKRKMHDEFVNLFSCPL----CGEVFRS   74 (82)
Q Consensus        31 ~~~~c~~--c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~----C~~~f~~   74 (82)
                      .+..|+.  |... .....|..|....-..  ++..|+.    |+..+..
T Consensus         8 ~~v~C~~~cc~~~-i~r~~l~~H~~~~C~~--~~v~C~~~~~GC~~~~~~   54 (60)
T PF02176_consen    8 RPVPCPNGCCNEM-IPRKELDDHLENECPK--RPVPCPYSPYGCKERVPR   54 (60)
T ss_dssp             SEEE-TT--S-BE-EECCCHHHHHHTTSTT--SEEE-SS----S--EEEH
T ss_pred             CEeeCCCCCcccc-eeHHHHHHHHHccCCC--CcEECCCCCCCCCCccch
Confidence            3456766  4333 3355678888866666  7888888    7766543


No 83 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=89.72  E-value=0.035  Score=28.14  Aligned_cols=13  Identities=31%  Similarity=0.439  Sum_probs=7.0

Q ss_pred             cccccchhhhcCc
Q psy6273          33 FACDQCVSYFKTN   45 (82)
Q Consensus        33 ~~c~~c~~~~~~~   45 (82)
                      ++|+.|+..|...
T Consensus        29 ~~c~~c~~~f~~~   41 (154)
T PRK00464         29 RECLACGKRFTTF   41 (154)
T ss_pred             eeccccCCcceEe
Confidence            4555666555443


No 84 
>KOG2482|consensus
Probab=88.97  E-value=0.57  Score=27.07  Aligned_cols=66  Identities=24%  Similarity=0.350  Sum_probs=40.7

Q ss_pred             HHHHhHHHhhCCCCCccccccchhhhcCc-HHHHHHHHHhcC----CC----------------CCeeecCcccccccCc
Q psy6273          17 QALDNHILCVHTETKSFACDQCVSYFKTN-SALLQHKRKMHD----EF----------------VNLFSCPLCGEVFRSH   75 (82)
Q Consensus        17 ~~l~~h~~~~~~~~~~~~c~~c~~~~~~~-~~l~~h~~~~~~----~~----------------~~~~~C~~C~~~f~~~   75 (82)
                      ..|.++++-........+|-.|+..+... +.+..|+-.-++    ..                ...+.|-.|.+.|..+
T Consensus       129 eaLeqqQ~Eredt~fslqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdk  208 (423)
T KOG2482|consen  129 EALEQQQKEREDTIFSLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDK  208 (423)
T ss_pred             HHHHHHHHHhcCCeeeeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCc
Confidence            44555554222223456788888766555 445556543221    10                1347899999999999


Q ss_pred             ccccccC
Q psy6273          76 QGYKIHH   82 (82)
Q Consensus        76 ~~l~~H~   82 (82)
                      ..|+.||
T Consensus       209 ntLkeHM  215 (423)
T KOG2482|consen  209 NTLKEHM  215 (423)
T ss_pred             HHHHHHH
Confidence            9998886


No 85 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=88.63  E-value=0.21  Score=17.52  Aligned_cols=11  Identities=45%  Similarity=0.939  Sum_probs=6.1

Q ss_pred             eecCccccccc
Q psy6273          63 FSCPLCGEVFR   73 (82)
Q Consensus        63 ~~C~~C~~~f~   73 (82)
                      -.|+.||..|.
T Consensus        15 ~~Cp~CG~~F~   25 (26)
T PF10571_consen   15 KFCPHCGYDFE   25 (26)
T ss_pred             CcCCCCCCCCc
Confidence            35566665553


No 86 
>KOG2593|consensus
Probab=87.52  E-value=1.2  Score=26.57  Aligned_cols=39  Identities=23%  Similarity=0.523  Sum_probs=26.1

Q ss_pred             CCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccc
Q psy6273          28 TETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEV   71 (82)
Q Consensus        28 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~   71 (82)
                      .....|.|+.|.+.|.....++   -.-...  -.|.|..|+..
T Consensus       124 t~~~~Y~Cp~C~kkyt~Lea~~---L~~~~~--~~F~C~~C~ge  162 (436)
T KOG2593|consen  124 TNVAGYVCPNCQKKYTSLEALQ---LLDNET--GEFHCENCGGE  162 (436)
T ss_pred             cccccccCCccccchhhhHHHH---hhcccC--ceEEEecCCCc
Confidence            3456799999999887766653   222223  46999998743


No 87 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=87.51  E-value=0.14  Score=22.70  Aligned_cols=15  Identities=20%  Similarity=0.545  Sum_probs=7.9

Q ss_pred             CeeecC--cccccccCc
Q psy6273          61 NLFSCP--LCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~--~C~~~f~~~   75 (82)
                      ..+.|.  +||..|...
T Consensus        26 ~Y~qC~N~eCg~tF~t~   42 (72)
T PRK09678         26 RYHQCQNVNCSATFITY   42 (72)
T ss_pred             eeeecCCCCCCCEEEEE
Confidence            455554  566555443


No 88 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=87.19  E-value=0.72  Score=22.29  Aligned_cols=67  Identities=18%  Similarity=0.369  Sum_probs=38.9

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCC------CCCc-------cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccc
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHT------ETKS-------FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCG   69 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~------~~~~-------~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~   69 (82)
                      |..|+.|+-.......|.+..-  |.      .+.+       -.|..|...|........  ......  ..|.|+.|.
T Consensus        15 P~~CpiCgLtLVss~HLARSyH--HLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~--~~y~C~~C~   88 (112)
T TIGR00622        15 PVECPICGLTLILSTHLARSYH--HLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDS--HRYVCAVCK   88 (112)
T ss_pred             CCcCCcCCCEEeccchHHHhhh--ccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccc--cceeCCCCC
Confidence            6778899988877777776532  21      0111       137777777765431110  001122  579999999


Q ss_pred             ccccCc
Q psy6273          70 EVFRSH   75 (82)
Q Consensus        70 ~~f~~~   75 (82)
                      ..|--.
T Consensus        89 ~~FC~d   94 (112)
T TIGR00622        89 NVFCVD   94 (112)
T ss_pred             Cccccc
Confidence            888644


No 89 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=86.94  E-value=0.34  Score=18.46  Aligned_cols=15  Identities=27%  Similarity=0.682  Sum_probs=11.0

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      -.|.|..||..|...
T Consensus         4 Y~y~C~~Cg~~fe~~   18 (41)
T smart00834        4 YEYRCEDCGHTFEVL   18 (41)
T ss_pred             EEEEcCCCCCEEEEE
Confidence            358899999877533


No 90 
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=86.74  E-value=0.35  Score=22.21  Aligned_cols=33  Identities=18%  Similarity=0.438  Sum_probs=21.3

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCcc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQ   76 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~   76 (82)
                      .+.|+.|++....          ..+.  .-|.|..||..|+-.+
T Consensus        35 ~~~Cp~C~~~~Vk----------R~a~--GIW~C~kCg~~fAGga   67 (89)
T COG1997          35 KHVCPFCGRTTVK----------RIAT--GIWKCRKCGAKFAGGA   67 (89)
T ss_pred             CCcCCCCCCccee----------eecc--CeEEcCCCCCeecccc
Confidence            4788888865211          1122  5699999998886543


No 91 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=86.47  E-value=1.1  Score=18.44  Aligned_cols=11  Identities=45%  Similarity=1.265  Sum_probs=5.4

Q ss_pred             ecCcccccccC
Q psy6273          64 SCPLCGEVFRS   74 (82)
Q Consensus        64 ~C~~C~~~f~~   74 (82)
                      .|+.|++.|..
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            88888887753


No 92 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=86.42  E-value=0.39  Score=18.52  Aligned_cols=14  Identities=36%  Similarity=0.899  Sum_probs=11.6

Q ss_pred             eeecCcccccccCc
Q psy6273          62 LFSCPLCGEVFRSH   75 (82)
Q Consensus        62 ~~~C~~C~~~f~~~   75 (82)
                      ||.|..|+..|-..
T Consensus        12 ~f~C~~C~~~FC~~   25 (39)
T smart00154       12 GFKCRHCGNLFCGE   25 (39)
T ss_pred             CeECCccCCccccc
Confidence            89999999888654


No 93 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=85.51  E-value=0.19  Score=18.58  Aligned_cols=7  Identities=57%  Similarity=1.673  Sum_probs=3.1

Q ss_pred             eecCccc
Q psy6273          63 FSCPLCG   69 (82)
Q Consensus        63 ~~C~~C~   69 (82)
                      ..|+.||
T Consensus        18 irC~~CG   24 (32)
T PF03604_consen   18 IRCPECG   24 (32)
T ss_dssp             SSBSSSS
T ss_pred             EECCcCC
Confidence            3444444


No 94 
>KOG4173|consensus
Probab=85.44  E-value=0.27  Score=26.32  Aligned_cols=46  Identities=26%  Similarity=0.606  Sum_probs=32.7

Q ss_pred             cccccc--chhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCcccccccC
Q psy6273          32 SFACDQ--CVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        32 ~~~c~~--c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      .+.|++  |...|...+.+..|-.+.++.     .|..|.+.|.+...|..|+
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~-----sCs~C~r~~Pt~hLLd~HI  126 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGN-----SCSFCKRAFPTGHLLDAHI  126 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccc-----hhHHHHHhCCchhhhhHHH
Confidence            456755  556677667677766655555     7999999999887776664


No 95 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=85.42  E-value=0.76  Score=21.79  Aligned_cols=26  Identities=23%  Similarity=0.547  Sum_probs=20.8

Q ss_pred             cccc----ccchhhhcCcHHHHHHHHHhcC
Q psy6273          32 SFAC----DQCVSYFKTNSALLQHKRKMHD   57 (82)
Q Consensus        32 ~~~c----~~c~~~~~~~~~l~~h~~~~~~   57 (82)
                      .|.|    ..|++...+...+..|.+..+|
T Consensus        80 G~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            4788    8888888888888888887653


No 96 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=85.39  E-value=0.34  Score=26.06  Aligned_cols=29  Identities=24%  Similarity=0.429  Sum_probs=22.1

Q ss_pred             CCccccccchhhhcCcHHHHHHHHHhcCC
Q psy6273          30 TKSFACDQCVSYFKTNSALLQHKRKMHDE   58 (82)
Q Consensus        30 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~   58 (82)
                      +.-|.|..|++.|.....+..|+...+.+
T Consensus        75 ~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   75 EDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             CCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            44589999999999999999999876654


No 97 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=85.20  E-value=0.46  Score=18.58  Aligned_cols=15  Identities=33%  Similarity=0.758  Sum_probs=11.0

Q ss_pred             eeecCcccccccCcc
Q psy6273          62 LFSCPLCGEVFRSHQ   76 (82)
Q Consensus        62 ~~~C~~C~~~f~~~~   76 (82)
                      .|.|..||..|....
T Consensus         5 ey~C~~Cg~~fe~~~   19 (42)
T PF09723_consen    5 EYRCEECGHEFEVLQ   19 (42)
T ss_pred             EEEeCCCCCEEEEEE
Confidence            588999998776443


No 98 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=84.94  E-value=0.39  Score=18.84  Aligned_cols=15  Identities=33%  Similarity=0.720  Sum_probs=9.4

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      -|+.|..|+..|-..
T Consensus        12 ~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKHCGKSFCLK   26 (43)
T ss_dssp             SHEE-TTTS-EE-TT
T ss_pred             CCeECCCCCcccCcc
Confidence            489999999888643


No 99 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=83.63  E-value=1.5  Score=15.28  Aligned_cols=18  Identities=22%  Similarity=0.654  Sum_probs=9.3

Q ss_pred             ccCcCCccccCHHHHHhHH
Q psy6273           5 KCHACDVETKTRQALDNHI   23 (82)
Q Consensus         5 ~c~~c~~~~~~~~~l~~h~   23 (82)
                      .|+.|++.+ ....+..|.
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            466666665 334444443


No 100
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=83.28  E-value=0.43  Score=19.52  Aligned_cols=10  Identities=20%  Similarity=0.760  Sum_probs=5.7

Q ss_pred             cccccchhhh
Q psy6273          33 FACDQCVSYF   42 (82)
Q Consensus        33 ~~c~~c~~~~   42 (82)
                      |.|..|++.+
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5555665555


No 101
>TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=82.12  E-value=0.19  Score=31.57  Aligned_cols=55  Identities=22%  Similarity=0.399  Sum_probs=34.4

Q ss_pred             cCcCCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccc
Q psy6273           6 CHACDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCG   69 (82)
Q Consensus         6 c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~   69 (82)
                      |..||-.|.....|-.-..++-. ..--.|+.|.+.+.++.+-    ++|.    .+-.|+.||
T Consensus        93 Ct~CGPr~~i~~~lpydr~~t~m-~~f~~C~~C~~ey~~p~~r----r~h~----~~~~C~~Cg  147 (711)
T TIGR00143        93 CTHCGPRFTIIEALPYDRENTSM-ADFPLCPDCAKEYKDPLDR----RFHA----QPIACPRCG  147 (711)
T ss_pred             ccCCCCCeEEeecCCCCCCCcCC-CCCcCCHHHHHHhcCCccc----cCCC----CCccCCCCC
Confidence            88899888876654432211212 2223788898887776542    3444    578899998


No 102
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=82.12  E-value=0.46  Score=18.72  Aligned_cols=14  Identities=36%  Similarity=0.906  Sum_probs=9.6

Q ss_pred             eecCcccccccCcc
Q psy6273          63 FSCPLCGEVFRSHQ   76 (82)
Q Consensus        63 ~~C~~C~~~f~~~~   76 (82)
                      =.|+.|++.|++.-
T Consensus         9 K~C~~C~rpf~WRK   22 (42)
T PF10013_consen    9 KICPVCGRPFTWRK   22 (42)
T ss_pred             CcCcccCCcchHHH
Confidence            36778888887653


No 103
>KOG2231|consensus
Probab=81.88  E-value=1.1  Score=28.24  Aligned_cols=21  Identities=38%  Similarity=0.662  Sum_probs=12.7

Q ss_pred             cCcCCccccCHHHHHhHHHhhC
Q psy6273           6 CHACDVETKTRQALDNHILCVH   27 (82)
Q Consensus         6 c~~c~~~~~~~~~l~~h~~~~~   27 (82)
                      |..| ..|.+...|..|+...|
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H  138 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQH  138 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhh
Confidence            3444 44457788888875334


No 104
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=81.78  E-value=0.7  Score=23.23  Aligned_cols=19  Identities=21%  Similarity=0.899  Sum_probs=15.6

Q ss_pred             CeeecCcccccccCccccc
Q psy6273          61 NLFSCPLCGEVFRSHQGYK   79 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~l~   79 (82)
                      .-+.|+.||+.|+..+.+.
T Consensus       123 ~f~~C~~C~kiyW~GsH~~  141 (147)
T PF01927_consen  123 EFWRCPGCGKIYWEGSHWR  141 (147)
T ss_pred             eEEECCCCCCEecccccHH
Confidence            4689999999999876654


No 105
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=81.56  E-value=0.77  Score=18.59  Aligned_cols=14  Identities=29%  Similarity=0.797  Sum_probs=10.2

Q ss_pred             eeecCcccccccCc
Q psy6273          62 LFSCPLCGEVFRSH   75 (82)
Q Consensus        62 ~~~C~~C~~~f~~~   75 (82)
                      -|.|..||..|...
T Consensus         5 ey~C~~Cg~~fe~~   18 (52)
T TIGR02605         5 EYRCTACGHRFEVL   18 (52)
T ss_pred             EEEeCCCCCEeEEE
Confidence            47888888877543


No 106
>KOG3408|consensus
Probab=81.49  E-value=1.5  Score=21.55  Aligned_cols=27  Identities=30%  Similarity=0.559  Sum_probs=22.5

Q ss_pred             CCCCccccccchhhhcCcHHHHHHHHH
Q psy6273          28 TETKSFACDQCVSYFKTNSALLQHKRK   54 (82)
Q Consensus        28 ~~~~~~~c~~c~~~~~~~~~l~~h~~~   54 (82)
                      +|...|-|..|.+.|.+...|..|.++
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhc
Confidence            345568899999999999999988765


No 107
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=80.86  E-value=2.1  Score=17.25  Aligned_cols=8  Identities=50%  Similarity=0.576  Sum_probs=4.0

Q ss_pred             HHHHHHHH
Q psy6273          46 SALLQHKR   53 (82)
Q Consensus        46 ~~l~~h~~   53 (82)
                      ++|.+|+.
T Consensus        37 s~L~rHl~   44 (50)
T smart00614       37 SNLRRHLR   44 (50)
T ss_pred             HHHHHHHH
Confidence            44555554


No 108
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=80.83  E-value=1.3  Score=17.75  Aligned_cols=23  Identities=26%  Similarity=0.465  Sum_probs=17.9

Q ss_pred             cccccchhhhcCcHHHHHHHHHh
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKM   55 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~   55 (82)
                      |.|-+|.......+.|-.||...
T Consensus        21 ykcfqcpftc~~kshl~nhmky~   43 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHMKYS   43 (54)
T ss_pred             ceeecCCcccchHHHHHHHHHHH
Confidence            57778877777888888888754


No 109
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=80.81  E-value=2.5  Score=16.40  Aligned_cols=19  Identities=32%  Similarity=0.511  Sum_probs=8.1

Q ss_pred             ccccchhhhcC----cHHHHHHH
Q psy6273          34 ACDQCVSYFKT----NSALLQHK   52 (82)
Q Consensus        34 ~c~~c~~~~~~----~~~l~~h~   52 (82)
                      .|..|+..+..    .++|..|+
T Consensus        18 ~C~~C~~~~~~~~~~ts~l~~HL   40 (45)
T PF02892_consen   18 KCKYCGKVIKYSSGGTSNLKRHL   40 (45)
T ss_dssp             EETTTTEE-----SSTHHHHHHH
T ss_pred             EeCCCCeEEeeCCCcHHHHHHhh
Confidence            45555544333    24555555


No 110
>KOG1280|consensus
Probab=80.72  E-value=2.5  Score=24.61  Aligned_cols=39  Identities=31%  Similarity=0.490  Sum_probs=26.8

Q ss_pred             CccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccc
Q psy6273          31 KSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCG   69 (82)
Q Consensus        31 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~   69 (82)
                      ..|.|+.|+..-.....+..|....+.+...-..|+.|+
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            468888888877777888888877665533344556554


No 111
>KOG2785|consensus
Probab=79.97  E-value=4.5  Score=23.92  Aligned_cols=25  Identities=20%  Similarity=0.389  Sum_probs=19.0

Q ss_pred             CcccCcCCccccCHHHHHhHHHhhCC
Q psy6273           3 RYKCHACDVETKTRQALDNHILCVHT   28 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~~~~~   28 (82)
                      |-.|-.|++.+.+...-..|+. .+.
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~-~~H  190 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMF-KEH  190 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHh-hcc
Confidence            4457889999998888888886 444


No 112
>KOG4124|consensus
Probab=79.37  E-value=0.18  Score=29.05  Aligned_cols=68  Identities=26%  Similarity=0.563  Sum_probs=35.8

Q ss_pred             CCcccCc--CCccccCHHHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCccccc
Q psy6273           2 TRYKCHA--CDVETKTRQALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGYK   79 (82)
Q Consensus         2 k~~~c~~--c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l~   79 (82)
                      +|+.|++  |++.+.....|..|..  +....+.     .  ...+ .-..|+......  |++.|+.|.+++.....|+
T Consensus       348 ~~~~~~vp~~~~~~~n~ng~~~~~~--~~h~s~i-----~--~~s~-~~~ph~~~~~~n--k~~r~~i~~~~~k~~~~l~  415 (442)
T KOG4124|consen  348 KPYKCPVPNCDKAYKNQNGLKYHKL--HGHCSPI-----T--TPTP-APIPHQGFVVEN--KPYRCEVCSKRYKNLNGLK  415 (442)
T ss_pred             CCCCCCCCcchhhcccCcceeeccc--cCcCCCC-----C--CCCC-CCCCcceeeecc--CcccChhhhhhhccCCCCC
Confidence            6777754  7777777666666643  1111111     0  0001 112233323333  7888888888777666665


Q ss_pred             cc
Q psy6273          80 IH   81 (82)
Q Consensus        80 ~H   81 (82)
                      -|
T Consensus       416 ~~  417 (442)
T KOG4124|consen  416 YH  417 (442)
T ss_pred             ce
Confidence            44


No 113
>KOG2785|consensus
Probab=79.00  E-value=3.9  Score=24.13  Aligned_cols=23  Identities=26%  Similarity=0.585  Sum_probs=17.5

Q ss_pred             CCcccCcCCccccCHHHHHhHHH
Q psy6273           2 TRYKCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l~~h~~   24 (82)
                      .-|.|..|...|.+...-..|.+
T Consensus         2 t~ftC~tC~v~F~~ad~Qr~HyK   24 (390)
T KOG2785|consen    2 TGFTCNTCNVEFDDADEQRAHYK   24 (390)
T ss_pred             CcceeeceeeeeccHHHHHHHhh
Confidence            34789999999988876666654


No 114
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=78.61  E-value=1.3  Score=16.09  Aligned_cols=10  Identities=50%  Similarity=1.354  Sum_probs=6.6

Q ss_pred             CeeecCcccc
Q psy6273          61 NLFSCPLCGE   70 (82)
Q Consensus        61 ~~~~C~~C~~   70 (82)
                      ..+.|+.|+.
T Consensus        18 ~~~vCp~C~~   27 (30)
T PF08274_consen   18 ELLVCPECGH   27 (30)
T ss_dssp             SSEEETTTTE
T ss_pred             CEEeCCcccc
Confidence            4677777764


No 115
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=78.47  E-value=0.73  Score=22.92  Aligned_cols=13  Identities=15%  Similarity=0.547  Sum_probs=7.5

Q ss_pred             ccccccchhhhcC
Q psy6273          32 SFACDQCVSYFKT   44 (82)
Q Consensus        32 ~~~c~~c~~~~~~   44 (82)
                      .+.|..|+..|..
T Consensus        70 ~~~C~~CG~~~~~   82 (135)
T PRK03824         70 VLKCRNCGNEWSL   82 (135)
T ss_pred             EEECCCCCCEEec
Confidence            3566666655544


No 116
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=78.46  E-value=0.72  Score=21.38  Aligned_cols=33  Identities=12%  Similarity=0.349  Sum_probs=20.8

Q ss_pred             CccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCc
Q psy6273          31 KSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSH   75 (82)
Q Consensus        31 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~   75 (82)
                      ..|.|+.|++.-....          +.  -.|.|..|++.|+-.
T Consensus        35 a~y~CpfCgk~~vkR~----------a~--GIW~C~~C~~~~AGG   67 (90)
T PTZ00255         35 AKYFCPFCGKHAVKRQ----------AV--GIWRCKGCKKTVAGG   67 (90)
T ss_pred             CCccCCCCCCCceeee----------ee--EEEEcCCCCCEEeCC
Confidence            3578888875422111          11  568999999888643


No 117
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=77.50  E-value=1.5  Score=18.78  Aligned_cols=26  Identities=27%  Similarity=0.524  Sum_probs=9.7

Q ss_pred             ccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccccc
Q psy6273          34 ACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFR   73 (82)
Q Consensus        34 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~   73 (82)
                      .|..|++.|...            .  +.+-|..||..|-
T Consensus        11 ~C~~C~~~F~~~------------~--rrhhCr~CG~~vC   36 (69)
T PF01363_consen   11 NCMICGKKFSLF------------R--RRHHCRNCGRVVC   36 (69)
T ss_dssp             B-TTT--B-BSS------------S---EEE-TTT--EEE
T ss_pred             cCcCcCCcCCCc------------e--eeEccCCCCCEEC
Confidence            566677766331            1  5566666666553


No 118
>PF14353 CpXC:  CpXC protein
Probab=77.19  E-value=1.4  Score=21.51  Aligned_cols=17  Identities=41%  Similarity=0.858  Sum_probs=11.7

Q ss_pred             CeeecCcccccccCccc
Q psy6273          61 NLFSCPLCGEVFRSHQG   77 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~   77 (82)
                      -.+.|+.||..|.-...
T Consensus        37 ~~~~CP~Cg~~~~~~~p   53 (128)
T PF14353_consen   37 FSFTCPSCGHKFRLEYP   53 (128)
T ss_pred             CEEECCCCCCceecCCC
Confidence            46888888877754443


No 119
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=76.78  E-value=1.4  Score=17.21  Aligned_cols=12  Identities=33%  Similarity=1.038  Sum_probs=8.8

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      .+..|+.|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            467888888766


No 120
>KOG2907|consensus
Probab=76.26  E-value=1.4  Score=21.26  Aligned_cols=40  Identities=20%  Similarity=0.453  Sum_probs=22.5

Q ss_pred             cccccchhhhcCcHHHHHHHHH-hcCCCCCeeecCcccccccCc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRK-MHDEFVNLFSCPLCGEVFRSH   75 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~~~C~~C~~~f~~~   75 (82)
                      ..|+.|+..-..-..++  +|+ ..|. ..-|.|+.|+..|...
T Consensus        75 ~kCpkCghe~m~Y~T~Q--lRSADEGQ-TVFYTC~kC~~k~~e~  115 (116)
T KOG2907|consen   75 HKCPKCGHEEMSYHTLQ--LRSADEGQ-TVFYTCPKCKYKFTEN  115 (116)
T ss_pred             ccCcccCCchhhhhhhh--cccccCCc-eEEEEcCccceeeecc
Confidence            47888875433222221  122 2232 1468999999888754


No 121
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=75.68  E-value=1.1  Score=21.53  Aligned_cols=12  Identities=17%  Similarity=0.528  Sum_probs=6.3

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      .|..|+.||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            455555555554


No 122
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=75.31  E-value=0.77  Score=21.33  Aligned_cols=32  Identities=19%  Similarity=0.561  Sum_probs=20.1

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSH   75 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~   75 (82)
                      .|.|+.|++.-...          .+-  -.|.|..|++.|+-.
T Consensus        35 ~y~CpfCgk~~vkR----------~a~--GIW~C~~C~~~~AGG   66 (91)
T TIGR00280        35 KYVCPFCGKKTVKR----------GST--GIWTCRKCGAKFAGG   66 (91)
T ss_pred             CccCCCCCCCceEE----------Eee--EEEEcCCCCCEEeCC
Confidence            47888887542111          111  468999998887643


No 123
>PF12907 zf-met2:  Zinc-binding
Probab=75.20  E-value=2.8  Score=16.37  Aligned_cols=11  Identities=27%  Similarity=0.302  Sum_probs=4.5

Q ss_pred             HHHHhHHHhhC
Q psy6273          17 QALDNHILCVH   27 (82)
Q Consensus        17 ~~l~~h~~~~~   27 (82)
                      ..|..|..+.|
T Consensus        18 ~~L~eH~enKH   28 (40)
T PF12907_consen   18 PQLKEHAENKH   28 (40)
T ss_pred             HHHHHHHHccC
Confidence            33444443333


No 124
>COG1773 Rubredoxin [Energy production and conversion]
Probab=74.99  E-value=1.6  Score=18.29  Aligned_cols=16  Identities=25%  Similarity=0.729  Sum_probs=10.9

Q ss_pred             CCCcccCcCCccccCH
Q psy6273           1 MTRYKCHACDVETKTR   16 (82)
Q Consensus         1 ~k~~~c~~c~~~~~~~   16 (82)
                      ++.|+|..||..|.-.
T Consensus         1 m~~~~C~~CG~vYd~e   16 (55)
T COG1773           1 MKRWRCSVCGYVYDPE   16 (55)
T ss_pred             CCceEecCCceEeccc
Confidence            3567788888776654


No 125
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=73.66  E-value=1.9  Score=20.35  Aligned_cols=13  Identities=46%  Similarity=1.099  Sum_probs=11.4

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      +|..|.+||..|.
T Consensus        78 ~~~rC~eCG~~fk   90 (97)
T cd00924          78 KPKRCPECGHVFK   90 (97)
T ss_pred             CceeCCCCCcEEE
Confidence            6999999998885


No 126
>KOG4167|consensus
Probab=73.40  E-value=1.3  Score=28.30  Aligned_cols=25  Identities=20%  Similarity=0.389  Sum_probs=22.1

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMH   56 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~   56 (82)
                      -|.|..|++.|....++..||++|.
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHH
Confidence            4899999999999899999998875


No 127
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=72.47  E-value=3.7  Score=24.95  Aligned_cols=27  Identities=15%  Similarity=0.313  Sum_probs=22.0

Q ss_pred             cccCcCCccccCHHHHHhHHHhhCCCC
Q psy6273           4 YKCHACDVETKTRQALDNHILCVHTET   30 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h~~~~~~~~   30 (82)
                      +.|+.|.+.|.....+..|+...|.+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~~~   84 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHPAG   84 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhhhh
Confidence            678999999999999999987666553


No 128
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=72.10  E-value=2.3  Score=16.00  Aligned_cols=15  Identities=27%  Similarity=0.474  Sum_probs=7.1

Q ss_pred             eecCcccccccCccc
Q psy6273          63 FSCPLCGEVFRSHQG   77 (82)
Q Consensus        63 ~~C~~C~~~f~~~~~   77 (82)
                      -.|.+|++.|..+.-
T Consensus         4 ~~C~eC~~~f~dSyL   18 (34)
T PF01286_consen    4 PKCDECGKPFMDSYL   18 (34)
T ss_dssp             EE-TTT--EES-SSC
T ss_pred             chHhHhCCHHHHHHH
Confidence            467788887765543


No 129
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=72.09  E-value=3.8  Score=22.83  Aligned_cols=14  Identities=43%  Similarity=0.992  Sum_probs=9.6

Q ss_pred             eeecCcccccccCc
Q psy6273          62 LFSCPLCGEVFRSH   75 (82)
Q Consensus        62 ~~~C~~C~~~f~~~   75 (82)
                      -|.|+.|+..|...
T Consensus       155 ef~C~~C~h~F~G~  168 (278)
T PF15135_consen  155 EFHCPKCRHNFRGF  168 (278)
T ss_pred             eeecccccccchhh
Confidence            37788887777543


No 130
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=72.05  E-value=3.1  Score=17.85  Aligned_cols=29  Identities=28%  Similarity=0.639  Sum_probs=17.9

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFR   73 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~   73 (82)
                      ..|+.|+.....          ....  +.|.|+.||..+.
T Consensus        29 q~C~~CG~~~~~----------~~~~--r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   29 QTCPRCGHRNKK----------RRSG--RVFTCPNCGFEMD   57 (69)
T ss_pred             cCccCccccccc----------cccc--ceEEcCCCCCEEC
Confidence            457777654433          1223  6899999987654


No 131
>KOG4167|consensus
Probab=72.00  E-value=0.71  Score=29.38  Aligned_cols=24  Identities=17%  Similarity=0.436  Sum_probs=21.3

Q ss_pred             cccCcCCccccCHHHHHhHHHhhCC
Q psy6273           4 YKCHACDVETKTRQALDNHILCVHT   28 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h~~~~~~   28 (82)
                      |.|.+|++.|.-...+..|++ +|.
T Consensus       793 FpCreC~kvF~KiKSrNAHMK-~Hr  816 (907)
T KOG4167|consen  793 FPCRECGKVFFKIKSRNAHMK-THR  816 (907)
T ss_pred             eehHHHHHHHHHHhhhhHHHH-HHH
Confidence            789999999998888999988 775


No 132
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=71.83  E-value=0.98  Score=24.72  Aligned_cols=18  Identities=17%  Similarity=0.501  Sum_probs=10.2

Q ss_pred             CCcccCcCCccccCHHHH
Q psy6273           2 TRYKCHACDVETKTRQAL   19 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l   19 (82)
                      +.+.|++|+..|......
T Consensus        18 k~ieCPvC~tkFkkeev~   35 (267)
T COG1655          18 KTIECPVCNTKFKKEEVK   35 (267)
T ss_pred             ceeccCcccchhhhhhee
Confidence            345677776666554433


No 133
>PLN02294 cytochrome c oxidase subunit Vb
Probab=70.93  E-value=2.2  Score=22.25  Aligned_cols=14  Identities=36%  Similarity=1.025  Sum_probs=11.7

Q ss_pred             CeeecCcccccccC
Q psy6273          61 NLFSCPLCGEVFRS   74 (82)
Q Consensus        61 ~~~~C~~C~~~f~~   74 (82)
                      +|..|++||..|.-
T Consensus       140 kp~RCpeCG~~fkL  153 (174)
T PLN02294        140 KSFECPVCTQYFEL  153 (174)
T ss_pred             CceeCCCCCCEEEE
Confidence            68999999988853


No 134
>PRK14873 primosome assembly protein PriA; Provisional
Probab=70.84  E-value=2.6  Score=26.70  Aligned_cols=10  Identities=40%  Similarity=1.122  Sum_probs=6.4

Q ss_pred             CeeecCcccc
Q psy6273          61 NLFSCPLCGE   70 (82)
Q Consensus        61 ~~~~C~~C~~   70 (82)
                      .|+.|+.||.
T Consensus       421 ~p~~Cp~Cgs  430 (665)
T PRK14873        421 PDWRCPRCGS  430 (665)
T ss_pred             cCccCCCCcC
Confidence            4667777764


No 135
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=69.75  E-value=7.2  Score=20.93  Aligned_cols=12  Identities=42%  Similarity=0.902  Sum_probs=7.2

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      ....|..||..+
T Consensus        29 ~lvrC~eCG~V~   40 (201)
T COG1326          29 PLVRCEECGTVH   40 (201)
T ss_pred             eEEEccCCCcEe
Confidence            456666666555


No 136
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=69.70  E-value=1.7  Score=20.72  Aligned_cols=10  Identities=20%  Similarity=0.431  Sum_probs=5.9

Q ss_pred             CCcccCcCCc
Q psy6273           2 TRYKCHACDV   11 (82)
Q Consensus         2 k~~~c~~c~~   11 (82)
                      ||..|+.|+.
T Consensus         1 ~p~~CpYCg~   10 (102)
T PF11672_consen    1 KPIICPYCGG   10 (102)
T ss_pred             CCcccCCCCC
Confidence            4556666664


No 137
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=69.37  E-value=1.7  Score=20.92  Aligned_cols=25  Identities=20%  Similarity=0.465  Sum_probs=15.5

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGE   70 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~   70 (82)
                      ...|..|+..|....              ..+.|+.||.
T Consensus        70 ~~~C~~Cg~~~~~~~--------------~~~~CP~Cgs   94 (113)
T PRK12380         70 QAWCWDCSQVVEIHQ--------------HDAQCPHCHG   94 (113)
T ss_pred             EEEcccCCCEEecCC--------------cCccCcCCCC
Confidence            357888876554322              3456888874


No 138
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=69.37  E-value=6.3  Score=23.20  Aligned_cols=47  Identities=26%  Similarity=0.400  Sum_probs=28.0

Q ss_pred             ccCcCCccccCHHHHHhHHHhhCCCCCccccccch----hhhcCcHHHHHHHH
Q psy6273           5 KCHACDVETKTRQALDNHILCVHTETKSFACDQCV----SYFKTNSALLQHKR   53 (82)
Q Consensus         5 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~----~~~~~~~~l~~h~~   53 (82)
                      .|..|...|-+...|..|.+.  ..++.+.|..-+    ..|.+-..|..|-+
T Consensus       222 ~C~FC~~~FYdDDEL~~HcR~--~HE~ChICD~v~p~~~QYFK~Y~~Le~HF~  272 (493)
T COG5236         222 LCIFCKIYFYDDDELRRHCRL--RHEACHICDMVGPIRYQYFKSYEDLEAHFR  272 (493)
T ss_pred             hhhhccceecChHHHHHHHHh--hhhhhhhhhccCccchhhhhCHHHHHHHhh
Confidence            477788888888888888762  234445554332    13555555655544


No 139
>KOG1842|consensus
Probab=69.17  E-value=0.75  Score=27.52  Aligned_cols=18  Identities=33%  Similarity=0.519  Sum_probs=10.4

Q ss_pred             ccccccchhhhcCcHHHH
Q psy6273          32 SFACDQCVSYFKTNSALL   49 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~   49 (82)
                      .|.|+.|..-|...+.|.
T Consensus        15 gflCPiC~~dl~~~~~L~   32 (505)
T KOG1842|consen   15 GFLCPICLLDLPNLSALN   32 (505)
T ss_pred             cccCchHhhhhhhHHHHH
Confidence            356666666665555554


No 140
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=68.84  E-value=1.4  Score=21.16  Aligned_cols=25  Identities=36%  Similarity=0.809  Sum_probs=14.4

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEV   71 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~   71 (82)
                      ..|..|+..|....              ..+.|+.||..
T Consensus        71 ~~C~~Cg~~~~~~~--------------~~~~CP~Cgs~   95 (113)
T PF01155_consen   71 ARCRDCGHEFEPDE--------------FDFSCPRCGSP   95 (113)
T ss_dssp             EEETTTS-EEECHH--------------CCHH-SSSSSS
T ss_pred             EECCCCCCEEecCC--------------CCCCCcCCcCC
Confidence            57788887765433              23568888754


No 141
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=68.63  E-value=7.5  Score=20.50  Aligned_cols=33  Identities=33%  Similarity=0.740  Sum_probs=18.6

Q ss_pred             CCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccc
Q psy6273          28 TETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEV   71 (82)
Q Consensus        28 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~   71 (82)
                      ....-|.|+.|...+..-.+..           ..|.|+.||..
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~~-----------~~F~Cp~Cg~~  141 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAME-----------LGFTCPKCGED  141 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHHH-----------hCCCCCCCCch
Confidence            3445677877665443333221           34788888754


No 142
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=67.16  E-value=3.8  Score=20.51  Aligned_cols=25  Identities=36%  Similarity=0.547  Sum_probs=14.7

Q ss_pred             CccccccchhhhcCcHHHHHHHHHhcCC
Q psy6273          31 KSFACDQCVSYFKTNSALLQHKRKMHDE   58 (82)
Q Consensus        31 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~   58 (82)
                      ....|-.||+.|..   |.+|++.|+|.
T Consensus        71 d~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   71 DYIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             S-EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             CeeEEccCCcccch---HHHHHHHccCC
Confidence            34678889888755   47888888664


No 143
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=67.00  E-value=4.4  Score=16.46  Aligned_cols=10  Identities=30%  Similarity=1.188  Sum_probs=3.1

Q ss_pred             CeeecCcccc
Q psy6273          61 NLFSCPLCGE   70 (82)
Q Consensus        61 ~~~~C~~C~~   70 (82)
                      ..|.|+.|++
T Consensus        40 ~~W~CPiC~~   49 (50)
T PF02891_consen   40 PKWKCPICNK   49 (50)
T ss_dssp             ---B-TTT--
T ss_pred             CCeECcCCcC
Confidence            3477777764


No 144
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=66.85  E-value=2.9  Score=20.74  Aligned_cols=15  Identities=27%  Similarity=0.822  Sum_probs=12.5

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      ..|.|+.|++.|...
T Consensus        52 qRyrC~~C~~tf~~~   66 (129)
T COG3677          52 QRYKCKSCGSTFTVE   66 (129)
T ss_pred             cccccCCcCcceeee
Confidence            689999999988654


No 145
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=65.71  E-value=3.6  Score=15.26  Aligned_cols=12  Identities=33%  Similarity=0.816  Sum_probs=7.5

Q ss_pred             eeecCccccccc
Q psy6273          62 LFSCPLCGEVFR   73 (82)
Q Consensus        62 ~~~C~~C~~~f~   73 (82)
                      -+.|..|+.+|.
T Consensus        21 ~~~C~~Cg~~~~   32 (33)
T PF08792_consen   21 YEVCIFCGSSFP   32 (33)
T ss_pred             eEEcccCCcEee
Confidence            466777776653


No 146
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=65.21  E-value=3.3  Score=15.68  Aligned_cols=12  Identities=33%  Similarity=1.041  Sum_probs=8.0

Q ss_pred             eecCcccccccC
Q psy6273          63 FSCPLCGEVFRS   74 (82)
Q Consensus        63 ~~C~~C~~~f~~   74 (82)
                      +.|+.||+.|.-
T Consensus         2 r~C~~Cg~~Yh~   13 (36)
T PF05191_consen    2 RICPKCGRIYHI   13 (36)
T ss_dssp             EEETTTTEEEET
T ss_pred             cCcCCCCCcccc
Confidence            467778777643


No 147
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=65.14  E-value=3.5  Score=20.72  Aligned_cols=13  Identities=46%  Similarity=1.150  Sum_probs=11.4

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      +|..|+.||..|.
T Consensus       111 ~~~RCpeCG~~fk  123 (136)
T PF01215_consen  111 KPQRCPECGQVFK  123 (136)
T ss_dssp             SEEEETTTEEEEE
T ss_pred             CccCCCCCCeEEE
Confidence            6899999998885


No 148
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=65.11  E-value=3.1  Score=21.60  Aligned_cols=19  Identities=21%  Similarity=0.964  Sum_probs=14.8

Q ss_pred             CeeecCcccccccCccccc
Q psy6273          61 NLFSCPLCGEVFRSHQGYK   79 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~l~   79 (82)
                      .-+.|+.||+.|+..+.+.
T Consensus       129 ~f~~C~~CgkiYW~GsHw~  147 (165)
T COG1656         129 EFYRCPKCGKIYWKGSHWR  147 (165)
T ss_pred             ceeECCCCcccccCchHHH
Confidence            4578999999998776553


No 149
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=65.09  E-value=3.8  Score=20.45  Aligned_cols=15  Identities=13%  Similarity=0.337  Sum_probs=11.9

Q ss_pred             CcccCcCCccccCHH
Q psy6273           3 RYKCHACDVETKTRQ   17 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~   17 (82)
                      |++|..||+.|.+.+
T Consensus         1 PH~Ct~Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTKCGRVFEDGS   15 (131)
T ss_pred             CcccCcCCCCcCCCc
Confidence            678888998888654


No 150
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=65.01  E-value=3.5  Score=16.81  Aligned_cols=9  Identities=22%  Similarity=0.667  Sum_probs=4.0

Q ss_pred             cCcCCcccc
Q psy6273           6 CHACDVETK   14 (82)
Q Consensus         6 c~~c~~~~~   14 (82)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            444444443


No 151
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=64.97  E-value=2.9  Score=20.28  Aligned_cols=13  Identities=15%  Similarity=0.388  Sum_probs=8.5

Q ss_pred             CCccccccchhhh
Q psy6273          30 TKSFACDQCVSYF   42 (82)
Q Consensus        30 ~~~~~c~~c~~~~   42 (82)
                      .....|+.|++..
T Consensus        67 av~V~CP~C~K~T   79 (114)
T PF11023_consen   67 AVQVECPNCGKQT   79 (114)
T ss_pred             ceeeECCCCCChH
Confidence            3456788887654


No 152
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=64.28  E-value=3  Score=20.08  Aligned_cols=9  Identities=22%  Similarity=0.774  Sum_probs=4.2

Q ss_pred             cccccchhh
Q psy6273          33 FACDQCVSY   41 (82)
Q Consensus        33 ~~c~~c~~~   41 (82)
                      +.|+.|+..
T Consensus        20 ~iCpeC~~E   28 (109)
T TIGR00686        20 LICPSCLYE   28 (109)
T ss_pred             eECcccccc
Confidence            445555443


No 153
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=63.96  E-value=2.7  Score=20.33  Aligned_cols=25  Identities=24%  Similarity=0.829  Sum_probs=15.8

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEV   71 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~   71 (82)
                      ..|..|+..|....              ..+.|+.||..
T Consensus        71 ~~C~~Cg~~~~~~~--------------~~~~CP~Cgs~   95 (115)
T TIGR00100        71 CECEDCSEEVSPEI--------------DLYRCPKCHGI   95 (115)
T ss_pred             EEcccCCCEEecCC--------------cCccCcCCcCC
Confidence            57888876654432              24678888753


No 154
>KOG0782|consensus
Probab=63.71  E-value=1.6  Score=27.31  Aligned_cols=52  Identities=19%  Similarity=0.367  Sum_probs=34.5

Q ss_pred             HHHHhHHHhhCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCcc
Q psy6273          17 QALDNHILCVHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQ   76 (82)
Q Consensus        17 ~~l~~h~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~   76 (82)
                      ..+.+|-= +|.....-.|..|++.|..+-.      +|..|. ....|.+|..+|..+-
T Consensus       239 ~~fvrHHW-VHrrRqeGkC~~CgKgFQQKf~------FhsKEi-vAisCSWCKqayH~Kv  290 (1004)
T KOG0782|consen  239 SGFVRHHW-VHRRRQEGKCNTCGKGFQQKFF------FHSKEI-VAISCSWCKQAYHLKV  290 (1004)
T ss_pred             ccchHHhH-hhHhhhccccchhhhhhhhhee------eccccE-EEEEehHHHHHhhcch
Confidence            35556553 6666666789999998865543      454442 4688999988876543


No 155
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=63.69  E-value=6.9  Score=15.45  Aligned_cols=10  Identities=20%  Similarity=0.816  Sum_probs=7.3

Q ss_pred             CeeecCcccc
Q psy6273          61 NLFSCPLCGE   70 (82)
Q Consensus        61 ~~~~C~~C~~   70 (82)
                      ..|.|..|++
T Consensus        36 ~~~~C~~C~~   45 (46)
T PF12760_consen   36 GRYRCKACRK   45 (46)
T ss_pred             CeEECCCCCC
Confidence            6788887764


No 156
>KOG0978|consensus
Probab=63.27  E-value=3.8  Score=26.23  Aligned_cols=22  Identities=27%  Similarity=0.593  Sum_probs=17.7

Q ss_pred             CeeecCcccccccCcccccccC
Q psy6273          61 NLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      +.-+||.|+.+|...--++.|+
T Consensus       677 RqRKCP~Cn~aFganDv~~I~l  698 (698)
T KOG0978|consen  677 RQRKCPKCNAAFGANDVHRIHL  698 (698)
T ss_pred             hcCCCCCCCCCCCcccccccCC
Confidence            6679999999999877666654


No 157
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=63.09  E-value=1.4  Score=17.91  Aligned_cols=13  Identities=31%  Similarity=0.866  Sum_probs=8.6

Q ss_pred             ecCcccccccCcc
Q psy6273          64 SCPLCGEVFRSHQ   76 (82)
Q Consensus        64 ~C~~C~~~f~~~~   76 (82)
                      .|+.|++.|++..
T Consensus        14 ICpvCqRPFsWRk   26 (54)
T COG4338          14 ICPVCQRPFSWRK   26 (54)
T ss_pred             hhhhhcCchHHHH
Confidence            5777777776543


No 158
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=63.06  E-value=2.3  Score=20.54  Aligned_cols=27  Identities=22%  Similarity=0.591  Sum_probs=15.6

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEV   71 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~   71 (82)
                      ...|..|+..|.....             ..+.|+.||..
T Consensus        70 ~~~C~~Cg~~~~~~~~-------------~~~~CP~Cgs~   96 (114)
T PRK03681         70 ECWCETCQQYVTLLTQ-------------RVRRCPQCHGD   96 (114)
T ss_pred             EEEcccCCCeeecCCc-------------cCCcCcCcCCC
Confidence            3578888765433211             12668888843


No 159
>KOG2636|consensus
Probab=62.70  E-value=6.4  Score=23.92  Aligned_cols=28  Identities=21%  Similarity=0.439  Sum_probs=22.3

Q ss_pred             hCCCCCccccccch-hhhcCcHHHHHHHH
Q psy6273          26 VHTETKSFACDQCV-SYFKTNSALLQHKR   53 (82)
Q Consensus        26 ~~~~~~~~~c~~c~-~~~~~~~~l~~h~~   53 (82)
                      .|.-...|.|.+|| +.+..+..+++|-.
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHhH
Confidence            45556789999999 78888888888853


No 160
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=62.32  E-value=4.2  Score=16.62  Aligned_cols=12  Identities=25%  Similarity=0.631  Sum_probs=8.3

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      ..+.|..||..+
T Consensus        36 ~r~~C~~Cgyt~   47 (50)
T PRK00432         36 DRWHCGKCGYTE   47 (50)
T ss_pred             CcEECCCcCCEE
Confidence            357888887654


No 161
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=62.07  E-value=3.7  Score=17.65  Aligned_cols=43  Identities=19%  Similarity=0.355  Sum_probs=26.0

Q ss_pred             hCCCCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccC
Q psy6273          26 VHTETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRS   74 (82)
Q Consensus        26 ~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~   74 (82)
                      ++.+..++.|+.-+..+..+..+..   . ..+  .--.|+.|+..|..
T Consensus        18 I~~~~~~l~C~g~~~p~~HPrV~L~---m-g~~--gev~CPYC~t~y~l   60 (62)
T COG4391          18 IEIGDLPLMCPGPEPPNDHPRVFLD---M-GDE--GEVVCPYCSTRYRL   60 (62)
T ss_pred             EEeCCeeEEcCCCCCCCCCCEEEEE---c-CCC--CcEecCccccEEEe
Confidence            5667778888765555444433221   1 222  45789999988763


No 162
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=60.29  E-value=9.7  Score=18.15  Aligned_cols=39  Identities=3%  Similarity=0.053  Sum_probs=28.4

Q ss_pred             CCCcccCcCCccccCHHHHHhHHHhhCCCCCccccccchhh
Q psy6273           1 MTRYKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSY   41 (82)
Q Consensus         1 ~k~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   41 (82)
                      ++.|.|+.-+..|.+...+...+. . -..+-|.|...|+.
T Consensus         1 eeVf~i~~T~EiF~dYe~Y~~R~~-~-y~~~vwtC~~TGk~   39 (102)
T PF10537_consen    1 EEVFYIPFTGEIFRDYEEYLKRMI-L-YNQRVWTCEITGKS   39 (102)
T ss_pred             CceEEeCCCCcccCCHHHHHHHHH-H-HhCCeeEEecCCCC
Confidence            356788888999999988887765 3 33466888877663


No 164
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=60.20  E-value=6.9  Score=19.74  Aligned_cols=23  Identities=17%  Similarity=0.148  Sum_probs=16.8

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCC
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDE   58 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~   58 (82)
                      ..|-.+|+.|   .+|.+|+.+|.+.
T Consensus        77 IicLEDGkkf---KSLKRHL~t~~gm   99 (148)
T COG4957          77 IICLEDGKKF---KSLKRHLTTHYGL   99 (148)
T ss_pred             EEEeccCcch---HHHHHHHhcccCC
Confidence            4666677766   5688898888775


No 165
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=59.71  E-value=4.2  Score=17.00  Aligned_cols=11  Identities=45%  Similarity=1.207  Sum_probs=7.4

Q ss_pred             eecCccccccc
Q psy6273          63 FSCPLCGEVFR   73 (82)
Q Consensus        63 ~~C~~C~~~f~   73 (82)
                      |.|+.||..+.
T Consensus         3 ~~CP~CG~~ie   13 (54)
T TIGR01206         3 FECPDCGAEIE   13 (54)
T ss_pred             cCCCCCCCEEe
Confidence            56777776554


No 166
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=59.36  E-value=3.5  Score=20.03  Aligned_cols=13  Identities=31%  Similarity=0.887  Sum_probs=8.2

Q ss_pred             ccccccchhhhcC
Q psy6273          32 SFACDQCVSYFKT   44 (82)
Q Consensus        32 ~~~c~~c~~~~~~   44 (82)
                      ...|..|+..|..
T Consensus        71 ~~~C~~Cg~~~~~   83 (117)
T PRK00564         71 ELECKDCSHVFKP   83 (117)
T ss_pred             EEEhhhCCCcccc
Confidence            3577888765543


No 167
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=59.34  E-value=5.2  Score=14.89  Aligned_cols=13  Identities=31%  Similarity=0.812  Sum_probs=8.3

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      ..+.|+.|++.+.
T Consensus         3 ~~~~C~nC~R~v~   15 (33)
T PF08209_consen    3 PYVECPNCGRPVA   15 (33)
T ss_dssp             -EEE-TTTSSEEE
T ss_pred             CeEECCCCcCCcc
Confidence            4678999987654


No 168
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=58.80  E-value=1.1  Score=16.93  Aligned_cols=9  Identities=44%  Similarity=1.161  Sum_probs=3.5

Q ss_pred             eeecCcccc
Q psy6273          62 LFSCPLCGE   70 (82)
Q Consensus        62 ~~~C~~C~~   70 (82)
                      +..|..||=
T Consensus        21 ~isC~~CGP   29 (35)
T PF07503_consen   21 FISCTNCGP   29 (35)
T ss_dssp             T--BTTCC-
T ss_pred             CccCCCCCC
Confidence            455666653


No 169
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=58.25  E-value=4.3  Score=24.38  Aligned_cols=11  Identities=27%  Similarity=0.785  Sum_probs=5.3

Q ss_pred             ccccccchhhh
Q psy6273          32 SFACDQCVSYF   42 (82)
Q Consensus        32 ~~~c~~c~~~~   42 (82)
                      .|.|..|++.+
T Consensus       367 g~rC~kCg~~~  377 (421)
T COG1571         367 GFRCKKCGTRA  377 (421)
T ss_pred             CcccccccccC
Confidence            45555555443


No 170
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=58.11  E-value=4.2  Score=16.84  Aligned_cols=10  Identities=50%  Similarity=1.351  Sum_probs=6.5

Q ss_pred             ecCccccccc
Q psy6273          64 SCPLCGEVFR   73 (82)
Q Consensus        64 ~C~~C~~~f~   73 (82)
                      .|+.||..+.
T Consensus         2 ~CPyCge~~~   11 (52)
T PF14255_consen    2 QCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCeeE
Confidence            5777776553


No 171
>PRK10220 hypothetical protein; Provisional
Probab=57.62  E-value=5.5  Score=19.26  Aligned_cols=9  Identities=22%  Similarity=0.944  Sum_probs=4.6

Q ss_pred             cccccchhh
Q psy6273          33 FACDQCVSY   41 (82)
Q Consensus        33 ~~c~~c~~~   41 (82)
                      +.|+.|+..
T Consensus        21 ~vCpeC~hE   29 (111)
T PRK10220         21 YICPECAHE   29 (111)
T ss_pred             EECCcccCc
Confidence            555555543


No 172
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=57.34  E-value=5.8  Score=16.03  Aligned_cols=12  Identities=42%  Similarity=1.392  Sum_probs=7.9

Q ss_pred             eecCcccccccC
Q psy6273          63 FSCPLCGEVFRS   74 (82)
Q Consensus        63 ~~C~~C~~~f~~   74 (82)
                      |.|..|+..+..
T Consensus         2 y~C~~CgyvYd~   13 (47)
T PF00301_consen    2 YQCPVCGYVYDP   13 (47)
T ss_dssp             EEETTTSBEEET
T ss_pred             cCCCCCCEEEcC
Confidence            677777766543


No 173
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=57.25  E-value=4.8  Score=20.70  Aligned_cols=35  Identities=20%  Similarity=0.590  Sum_probs=21.0

Q ss_pred             CCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccc
Q psy6273          30 TKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEV   71 (82)
Q Consensus        30 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~   71 (82)
                      .-+|.|. |+..+....   +|-....|   ..|.|..|+..
T Consensus       115 ~~~Y~C~-C~q~~l~~R---Rhn~~~~g---~~YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRIR---RHNTVRRG---EVYRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchhh---hccccccc---ceEEeccCCce
Confidence            4568888 887754432   23223333   36999999753


No 174
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=56.88  E-value=5  Score=15.50  Aligned_cols=11  Identities=27%  Similarity=0.760  Sum_probs=3.0

Q ss_pred             cCcccccccCc
Q psy6273          65 CPLCGEVFRSH   75 (82)
Q Consensus        65 C~~C~~~f~~~   75 (82)
                      |..|++.+...
T Consensus         1 C~~C~~~~~~~   11 (47)
T PF01844_consen    1 CQYCGKPGSDN   11 (47)
T ss_dssp             -TTT--B--GG
T ss_pred             CCCCCCcCccC
Confidence            45565555443


No 175
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=56.09  E-value=4.9  Score=15.46  Aligned_cols=13  Identities=38%  Similarity=1.002  Sum_probs=8.7

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      ..+.|+.||..+-
T Consensus        31 p~~~C~~CGE~~~   43 (46)
T TIGR03831        31 PALVCPQCGEEYL   43 (46)
T ss_pred             CccccccCCCEee
Confidence            4567888886554


No 176
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=55.94  E-value=1.3  Score=28.27  Aligned_cols=11  Identities=45%  Similarity=0.824  Sum_probs=8.5

Q ss_pred             CeeecCccccc
Q psy6273          61 NLFSCPLCGEV   71 (82)
Q Consensus        61 ~~~~C~~C~~~   71 (82)
                      .|..|+.||..
T Consensus       474 ~p~~Cp~Cgs~  484 (730)
T COG1198         474 IPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCC
Confidence            68888888754


No 177
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=55.85  E-value=5.2  Score=16.39  Aligned_cols=11  Identities=27%  Similarity=1.271  Sum_probs=7.4

Q ss_pred             eecCccccccc
Q psy6273          63 FSCPLCGEVFR   73 (82)
Q Consensus        63 ~~C~~C~~~f~   73 (82)
                      |.|..||..+.
T Consensus         2 y~C~~CgyiYd   12 (50)
T cd00730           2 YECRICGYIYD   12 (50)
T ss_pred             cCCCCCCeEEC
Confidence            56777776655


No 178
>PRK05978 hypothetical protein; Provisional
Probab=55.64  E-value=4.1  Score=20.79  Aligned_cols=30  Identities=27%  Similarity=0.445  Sum_probs=17.3

Q ss_pred             ccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccC
Q psy6273          34 ACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRS   74 (82)
Q Consensus        34 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~   74 (82)
                      .|+.|++.-.....|.           -.-.|+.||..|..
T Consensus        35 rCP~CG~G~LF~g~Lk-----------v~~~C~~CG~~~~~   64 (148)
T PRK05978         35 RCPACGEGKLFRAFLK-----------PVDHCAACGEDFTH   64 (148)
T ss_pred             cCCCCCCCcccccccc-----------cCCCccccCCcccc
Confidence            6788876533332221           34578888876653


No 179
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=55.53  E-value=14  Score=14.34  Aligned_cols=24  Identities=17%  Similarity=0.317  Sum_probs=13.7

Q ss_pred             cccccchhhhcC--cHHHHHHHHHhc
Q psy6273          33 FACDQCVSYFKT--NSALLQHKRKMH   56 (82)
Q Consensus        33 ~~c~~c~~~~~~--~~~l~~h~~~~~   56 (82)
                      ..|+.|+-.+..  +..-..|.+.|.
T Consensus        14 ~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   14 TTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             cCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            477888755443  344555665553


No 180
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=54.80  E-value=5.9  Score=15.45  Aligned_cols=10  Identities=40%  Similarity=0.913  Sum_probs=7.2

Q ss_pred             eeecCccccc
Q psy6273          62 LFSCPLCGEV   71 (82)
Q Consensus        62 ~~~C~~C~~~   71 (82)
                      |..|+.||..
T Consensus         2 ~~~Cp~Cg~~   11 (47)
T PF14690_consen    2 PPRCPHCGSP   11 (47)
T ss_pred             CccCCCcCCC
Confidence            5678888843


No 181
>KOG0717|consensus
Probab=54.39  E-value=7.6  Score=23.77  Aligned_cols=22  Identities=27%  Similarity=0.563  Sum_probs=18.7

Q ss_pred             cccccchhhhcCcHHHHHHHHH
Q psy6273          33 FACDQCVSYFKTNSALLQHKRK   54 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~   54 (82)
                      +-|..|++.|.+...+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            6799999999999998888654


No 182
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=54.13  E-value=7.2  Score=14.86  Aligned_cols=12  Identities=25%  Similarity=1.093  Sum_probs=6.9

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      +-|+|..||...
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            579999998653


No 183
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=54.02  E-value=6.8  Score=14.93  Aligned_cols=14  Identities=36%  Similarity=0.802  Sum_probs=7.3

Q ss_pred             ecCcccccccCccc
Q psy6273          64 SCPLCGEVFRSHQG   77 (82)
Q Consensus        64 ~C~~C~~~f~~~~~   77 (82)
                      .|+-|++.|-+.+.
T Consensus         4 ~CprC~kg~Hwa~~   17 (36)
T PF14787_consen    4 LCPRCGKGFHWASE   17 (36)
T ss_dssp             C-TTTSSSCS-TTT
T ss_pred             cCcccCCCcchhhh
Confidence            46667776655544


No 184
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=52.66  E-value=7  Score=18.29  Aligned_cols=12  Identities=25%  Similarity=0.753  Sum_probs=5.3

Q ss_pred             CcccCcCCcccc
Q psy6273           3 RYKCHACDVETK   14 (82)
Q Consensus         3 ~~~c~~c~~~~~   14 (82)
                      |-.|..||..|.
T Consensus        58 Pa~CkkCGfef~   69 (97)
T COG3357          58 PARCKKCGFEFR   69 (97)
T ss_pred             ChhhcccCcccc
Confidence            334444444443


No 185
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=52.46  E-value=6.9  Score=15.17  Aligned_cols=8  Identities=50%  Similarity=1.502  Sum_probs=4.4

Q ss_pred             eecCcccc
Q psy6273          63 FSCPLCGE   70 (82)
Q Consensus        63 ~~C~~C~~   70 (82)
                      |.|+.|+.
T Consensus         1 m~Cp~Cg~    8 (43)
T PF08271_consen    1 MKCPNCGS    8 (43)
T ss_dssp             ESBTTTSS
T ss_pred             CCCcCCcC
Confidence            35666654


No 186
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=51.48  E-value=6.8  Score=21.59  Aligned_cols=14  Identities=29%  Similarity=0.774  Sum_probs=11.8

Q ss_pred             CeeecCcccccccC
Q psy6273          61 NLFSCPLCGEVFRS   74 (82)
Q Consensus        61 ~~~~C~~C~~~f~~   74 (82)
                      ++..|++||..|.-
T Consensus       180 kpqRCpECGqVFKL  193 (268)
T PTZ00043        180 FLYRCGECDQIFML  193 (268)
T ss_pred             CCccCCCCCcEEEE
Confidence            68999999988854


No 187
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=50.96  E-value=6.1  Score=16.69  Aligned_cols=7  Identities=43%  Similarity=1.526  Sum_probs=3.4

Q ss_pred             cccccch
Q psy6273          33 FACDQCV   39 (82)
Q Consensus        33 ~~c~~c~   39 (82)
                      |.|..|.
T Consensus        32 YmC~eC~   38 (56)
T PF09963_consen   32 YMCDECK   38 (56)
T ss_pred             eeChhHH
Confidence            4555544


No 188
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=50.82  E-value=13  Score=15.88  Aligned_cols=9  Identities=22%  Similarity=0.693  Sum_probs=6.0

Q ss_pred             cCcCCcccc
Q psy6273           6 CHACDVETK   14 (82)
Q Consensus         6 c~~c~~~~~   14 (82)
                      |..||+...
T Consensus         6 C~~CG~~Ip   14 (59)
T PF09889_consen    6 CPVCGKPIP   14 (59)
T ss_pred             CCcCCCcCC
Confidence            777776644


No 189
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=50.13  E-value=8.3  Score=14.74  Aligned_cols=11  Identities=27%  Similarity=0.957  Sum_probs=6.4

Q ss_pred             eeecCcccccc
Q psy6273          62 LFSCPLCGEVF   72 (82)
Q Consensus        62 ~~~C~~C~~~f   72 (82)
                      -|.|..|+..|
T Consensus        28 fy~C~~C~~~w   38 (39)
T PF01096_consen   28 FYVCCNCGHRW   38 (39)
T ss_dssp             EEEESSSTEEE
T ss_pred             EEEeCCCCCee
Confidence            36666666544


No 190
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=49.82  E-value=11  Score=14.52  Aligned_cols=11  Identities=27%  Similarity=1.081  Sum_probs=6.7

Q ss_pred             eeecCcccccc
Q psy6273          62 LFSCPLCGEVF   72 (82)
Q Consensus        62 ~~~C~~C~~~f   72 (82)
                      -|.|..|+..+
T Consensus        28 fy~C~~C~~~w   38 (40)
T smart00440       28 FYVCTKCGHRW   38 (40)
T ss_pred             EEEeCCCCCEe
Confidence            46676676544


No 191
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=49.64  E-value=4.4  Score=23.04  Aligned_cols=22  Identities=23%  Similarity=0.528  Sum_probs=17.6

Q ss_pred             CeeecCcccccccCcccccccC
Q psy6273          61 NLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      .-|.|..|-+-|.....+.+|+
T Consensus        47 ~lyiCe~Clky~~~~~~l~~H~   68 (290)
T PLN03238         47 KLYICEYCLKYMRKKKSLLRHL   68 (290)
T ss_pred             eEEEcCCCcchhCCHHHHHHHH
Confidence            6788888888888888877763


No 192
>KOG1088|consensus
Probab=49.33  E-value=13  Score=18.30  Aligned_cols=17  Identities=35%  Similarity=0.714  Sum_probs=13.4

Q ss_pred             CeeecCcccccccCccc
Q psy6273          61 NLFSCPLCGEVFRSHQG   77 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~   77 (82)
                      -...|+.||+.|.-+..
T Consensus        97 G~l~CpetG~vfpI~~G  113 (124)
T KOG1088|consen   97 GELVCPETGRVFPISDG  113 (124)
T ss_pred             ceEecCCCCcEeecccC
Confidence            67999999999875443


No 193
>KOG3507|consensus
Probab=49.06  E-value=11  Score=16.06  Aligned_cols=10  Identities=30%  Similarity=0.793  Sum_probs=6.0

Q ss_pred             eeecCccccc
Q psy6273          62 LFSCPLCGEV   71 (82)
Q Consensus        62 ~~~C~~C~~~   71 (82)
                      ++.|.+||..
T Consensus        37 ~irCReCG~R   46 (62)
T KOG3507|consen   37 VIRCRECGYR   46 (62)
T ss_pred             cEehhhcchH
Confidence            5666666643


No 194
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=48.54  E-value=8.3  Score=18.00  Aligned_cols=32  Identities=19%  Similarity=0.559  Sum_probs=20.2

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSH   75 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~   75 (82)
                      .|.|+.|++.-....          +.  --|.|..|++.|+--
T Consensus        35 ky~Cp~Cgk~~vkR~----------a~--GIW~C~~C~~~~AGG   66 (90)
T PF01780_consen   35 KYTCPFCGKTSVKRV----------AT--GIWKCKKCGKKFAGG   66 (90)
T ss_dssp             -BEESSSSSSEEEEE----------ET--TEEEETTTTEEEE-B
T ss_pred             CCcCCCCCCceeEEe----------ee--EEeecCCCCCEEeCC
Confidence            478888887532221          11  469999999888644


No 195
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=48.21  E-value=15  Score=15.81  Aligned_cols=11  Identities=18%  Similarity=0.869  Sum_probs=6.2

Q ss_pred             Cccccccchhh
Q psy6273          31 KSFACDQCVSY   41 (82)
Q Consensus        31 ~~~~c~~c~~~   41 (82)
                      ..|.|+.|...
T Consensus        30 rtymC~eC~~R   40 (68)
T COG4896          30 RTYMCPECEHR   40 (68)
T ss_pred             eeEechhhHhh
Confidence            34666666543


No 196
>PLN02748 tRNA dimethylallyltransferase
Probab=48.11  E-value=19  Score=22.20  Aligned_cols=22  Identities=23%  Similarity=0.536  Sum_probs=13.7

Q ss_pred             CcccCcCCc-cccCHHHHHhHHH
Q psy6273           3 RYKCHACDV-ETKTRQALDNHIL   24 (82)
Q Consensus         3 ~~~c~~c~~-~~~~~~~l~~h~~   24 (82)
                      .|.|..|+. .+.....+..|.+
T Consensus       418 ~~~Ce~C~~~~~~G~~eW~~Hlk  440 (468)
T PLN02748        418 QYVCEACGNKVLRGAHEWEQHKQ  440 (468)
T ss_pred             cccccCCCCcccCCHHHHHHHhc
Confidence            455677775 5666666666654


No 197
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=47.35  E-value=11  Score=15.88  Aligned_cols=15  Identities=33%  Similarity=0.886  Sum_probs=9.3

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      +--.|+.|++.|...
T Consensus        38 rYngCPfC~~~~~~~   52 (55)
T PF14447_consen   38 RYNGCPFCGTPFEFD   52 (55)
T ss_pred             hccCCCCCCCcccCC
Confidence            344677787776543


No 198
>PRK02935 hypothetical protein; Provisional
Probab=47.24  E-value=16  Score=17.62  Aligned_cols=36  Identities=17%  Similarity=0.375  Sum_probs=22.0

Q ss_pred             CCCccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCcccc
Q psy6273          29 ETKSFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSHQGY   78 (82)
Q Consensus        29 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~~~l   78 (82)
                      ...+..|+.|++..+           ..|   +...|..|+....-..++
T Consensus        67 kavqV~CP~C~K~TK-----------mLG---rvD~CM~C~~PLTLd~~l  102 (110)
T PRK02935         67 KAVQVICPSCEKPTK-----------MLG---RVDACMHCNQPLTLDRSL  102 (110)
T ss_pred             cceeeECCCCCchhh-----------hcc---ceeecCcCCCcCCcCccc
Confidence            345568888877532           122   567888888765544443


No 199
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=46.72  E-value=9.3  Score=16.49  Aligned_cols=13  Identities=31%  Similarity=0.894  Sum_probs=10.8

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      ....|+.|++.|.
T Consensus        52 g~L~Cp~c~r~YP   64 (68)
T PF03966_consen   52 GELICPECGREYP   64 (68)
T ss_dssp             TEEEETTTTEEEE
T ss_pred             CEEEcCCCCCEEe
Confidence            6789999998875


No 200
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=46.21  E-value=16  Score=17.62  Aligned_cols=26  Identities=35%  Similarity=0.685  Sum_probs=20.5

Q ss_pred             CCCccccccchhhhcCcHHHHHHHHH
Q psy6273          29 ETKSFACDQCVSYFKTNSALLQHKRK   54 (82)
Q Consensus        29 ~~~~~~c~~c~~~~~~~~~l~~h~~~   54 (82)
                      |-..+-|..|.+.|.+...|..|.+.
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhcc
Confidence            34457799999999999999888653


No 201
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=45.81  E-value=6.8  Score=21.03  Aligned_cols=21  Identities=19%  Similarity=0.854  Sum_probs=0.0

Q ss_pred             CeeecCccc-ccccCccccccc
Q psy6273          61 NLFSCPLCG-EVFRSHQGYKIH   81 (82)
Q Consensus        61 ~~~~C~~C~-~~f~~~~~l~~H   81 (82)
                      +.|.|..|| .++.-+..+.+|
T Consensus       100 ~ey~CEICGN~~Y~GrkaFekH  121 (196)
T PF11931_consen  100 VEYKCEICGNQSYKGRKAFEKH  121 (196)
T ss_dssp             ----------------------
T ss_pred             CeeeeEeCCCcceecHHHHHHh
Confidence            568888886 344444444333


No 202
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=45.71  E-value=13  Score=12.41  Aligned_cols=6  Identities=67%  Similarity=1.890  Sum_probs=3.1

Q ss_pred             cCcccc
Q psy6273          65 CPLCGE   70 (82)
Q Consensus        65 C~~C~~   70 (82)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            555553


No 203
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=45.10  E-value=9.4  Score=19.54  Aligned_cols=15  Identities=27%  Similarity=0.476  Sum_probs=11.3

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      +.-.|..|++.|++.
T Consensus        27 RRReC~~C~~RFTTy   41 (147)
T TIGR00244        27 RRRECLECHERFTTF   41 (147)
T ss_pred             ecccCCccCCcccee
Confidence            457888898888754


No 204
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=44.42  E-value=15  Score=20.67  Aligned_cols=12  Identities=58%  Similarity=1.270  Sum_probs=8.8

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      +.|.|+.||..+
T Consensus       321 r~~~C~~cg~~~  332 (364)
T COG0675         321 RLFKCPRCGFVH  332 (364)
T ss_pred             eeEECCCCCCee
Confidence            578888888654


No 205
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=44.35  E-value=12  Score=15.74  Aligned_cols=12  Identities=42%  Similarity=0.791  Sum_probs=8.8

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      ..|.|+.||-.+
T Consensus        13 v~~~Cp~cGipt   24 (55)
T PF13824_consen   13 VNFECPDCGIPT   24 (55)
T ss_pred             cCCcCCCCCCcC
Confidence            578898888543


No 206
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=44.24  E-value=14  Score=13.52  Aligned_cols=12  Identities=25%  Similarity=1.218  Sum_probs=9.1

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      +-|+|..||...
T Consensus         3 ~~ykC~~CGniv   14 (34)
T cd00974           3 EVYKCEICGNIV   14 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            468999998654


No 207
>PRK00420 hypothetical protein; Validated
Probab=44.10  E-value=10  Score=18.44  Aligned_cols=11  Identities=36%  Similarity=0.975  Sum_probs=6.7

Q ss_pred             eeecCcccccc
Q psy6273          62 LFSCPLCGEVF   72 (82)
Q Consensus        62 ~~~C~~C~~~f   72 (82)
                      ...|+.||...
T Consensus        40 ~~~Cp~Cg~~~   50 (112)
T PRK00420         40 EVVCPVHGKVY   50 (112)
T ss_pred             ceECCCCCCee
Confidence            45677776643


No 208
>PRK04023 DNA polymerase II large subunit; Validated
Probab=44.04  E-value=20  Score=24.50  Aligned_cols=11  Identities=27%  Similarity=0.585  Sum_probs=6.3

Q ss_pred             CeeecCccccc
Q psy6273          61 NLFSCPLCGEV   71 (82)
Q Consensus        61 ~~~~C~~C~~~   71 (82)
                      .++.|+.||..
T Consensus       662 ~~y~CPKCG~E  672 (1121)
T PRK04023        662 EEDECEKCGRE  672 (1121)
T ss_pred             CCCcCCCCCCC
Confidence            34566666643


No 209
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=43.96  E-value=4.2  Score=16.23  Aligned_cols=17  Identities=24%  Similarity=0.557  Sum_probs=9.4

Q ss_pred             CeeecCc--ccccccCccc
Q psy6273          61 NLFSCPL--CGEVFRSHQG   77 (82)
Q Consensus        61 ~~~~C~~--C~~~f~~~~~   77 (82)
                      .-+.|..  ||-.|....+
T Consensus        24 ~Y~qC~N~~Cg~tfv~~~~   42 (47)
T PF04606_consen   24 LYCQCTNPECGHTFVANLE   42 (47)
T ss_pred             EEEEECCCcCCCEEEEEEE
Confidence            4556643  7766654433


No 210
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=43.89  E-value=23  Score=13.51  Aligned_cols=17  Identities=18%  Similarity=0.286  Sum_probs=11.4

Q ss_pred             ccCcCCccccCHHHHHh
Q psy6273           5 KCHACDVETKTRQALDN   21 (82)
Q Consensus         5 ~c~~c~~~~~~~~~l~~   21 (82)
                      .|+.|+-.|.....|..
T Consensus        21 ~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   21 VCPSCGGIWFDAGELEK   37 (41)
T ss_pred             ECCCCCeEEccHHHHHH
Confidence            46777777777666654


No 211
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=43.19  E-value=16  Score=14.49  Aligned_cols=13  Identities=31%  Similarity=0.493  Sum_probs=8.4

Q ss_pred             eeecCcccccccC
Q psy6273          62 LFSCPLCGEVFRS   74 (82)
Q Consensus        62 ~~~C~~C~~~f~~   74 (82)
                      .+.|+.||..+.-
T Consensus        20 ~~vC~~Cg~~~~~   32 (52)
T smart00661       20 RFVCRKCGYEEPI   32 (52)
T ss_pred             EEECCcCCCeEEC
Confidence            5777777765543


No 212
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=43.04  E-value=8.9  Score=18.09  Aligned_cols=15  Identities=20%  Similarity=0.565  Sum_probs=10.6

Q ss_pred             CCCcccCcCCccccC
Q psy6273           1 MTRYKCHACDVETKT   15 (82)
Q Consensus         1 ~k~~~c~~c~~~~~~   15 (82)
                      ++.|+|.+|+.....
T Consensus         4 lkewkC~VCg~~iie   18 (103)
T COG4847           4 LKEWKCYVCGGTIIE   18 (103)
T ss_pred             cceeeEeeeCCEeee
Confidence            356889999876443


No 213
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=42.99  E-value=12  Score=15.18  Aligned_cols=9  Identities=56%  Similarity=1.501  Sum_probs=5.6

Q ss_pred             cCccccccc
Q psy6273          65 CPLCGEVFR   73 (82)
Q Consensus        65 C~~C~~~f~   73 (82)
                      |+.||..|.
T Consensus         1 CP~Cg~~f~    9 (50)
T PF14375_consen    1 CPRCGAPFE    9 (50)
T ss_pred             CCCCCCcCC
Confidence            566666664


No 214
>PRK01343 zinc-binding protein; Provisional
Probab=42.88  E-value=14  Score=15.67  Aligned_cols=10  Identities=40%  Similarity=0.939  Sum_probs=4.7

Q ss_pred             eecCcccccc
Q psy6273          63 FSCPLCGEVF   72 (82)
Q Consensus        63 ~~C~~C~~~f   72 (82)
                      ..|+.|++.+
T Consensus        10 ~~CP~C~k~~   19 (57)
T PRK01343         10 RPCPECGKPS   19 (57)
T ss_pred             CcCCCCCCcC
Confidence            3455555443


No 215
>PLN03239 histone acetyltransferase; Provisional
Probab=42.83  E-value=5.8  Score=23.24  Aligned_cols=22  Identities=14%  Similarity=0.242  Sum_probs=18.2

Q ss_pred             CeeecCcccccccCcccccccC
Q psy6273          61 NLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      .-|.|..|.+-|.....|.+|+
T Consensus       105 ~lYiCE~Clky~~~~~~l~~H~  126 (351)
T PLN03239        105 VLYVCEFSFGFFARKSELLRFQ  126 (351)
T ss_pred             eEEEeccchhhhcCHHHHHHHH
Confidence            6899999999888888877663


No 216
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=42.77  E-value=10  Score=13.62  Aligned_cols=10  Identities=40%  Similarity=1.212  Sum_probs=5.3

Q ss_pred             eecCcccccc
Q psy6273          63 FSCPLCGEVF   72 (82)
Q Consensus        63 ~~C~~C~~~f   72 (82)
                      |.|..|++.+
T Consensus        28 f~C~~C~~~L   37 (39)
T smart00132       28 FKCSKCGKPL   37 (39)
T ss_pred             CCCcccCCcC
Confidence            5555555443


No 217
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=42.75  E-value=15  Score=13.37  Aligned_cols=12  Identities=25%  Similarity=1.185  Sum_probs=9.3

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      +-|+|..||...
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            579999998654


No 218
>KOG2071|consensus
Probab=42.63  E-value=18  Score=22.92  Aligned_cols=26  Identities=15%  Similarity=0.516  Sum_probs=19.9

Q ss_pred             CCcccCcCCccccCHHHHHhHHHhhCC
Q psy6273           2 TRYKCHACDVETKTRQALDNHILCVHT   28 (82)
Q Consensus         2 k~~~c~~c~~~~~~~~~l~~h~~~~~~   28 (82)
                      .|..|..||.+|........|+. .|.
T Consensus       417 ~pnqC~~CG~R~~~~ee~sk~md-~H~  442 (579)
T KOG2071|consen  417 SPNQCKSCGLRFDDSEERSKHMD-IHD  442 (579)
T ss_pred             CcchhcccccccccchhhhhHhh-hhh
Confidence            46789999999998877776665 443


No 219
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=42.60  E-value=2.8  Score=15.90  Aligned_cols=8  Identities=25%  Similarity=0.908  Sum_probs=3.7

Q ss_pred             CeeecCcc
Q psy6273          61 NLFSCPLC   68 (82)
Q Consensus        61 ~~~~C~~C   68 (82)
                      ..|.|..|
T Consensus        28 qryrC~~C   35 (36)
T PF03811_consen   28 QRYRCKDC   35 (36)
T ss_pred             EeEecCcC
Confidence            34555444


No 220
>PLN00104 MYST -like histone acetyltransferase; Provisional
Probab=42.37  E-value=5.8  Score=24.08  Aligned_cols=22  Identities=18%  Similarity=0.572  Sum_probs=18.8

Q ss_pred             CeeecCcccccccCcccccccC
Q psy6273          61 NLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      .-|.|..|.+-|.....|.+|+
T Consensus       197 ~lyiCe~Cl~y~~~~~~~~~H~  218 (450)
T PLN00104        197 KLYFCEFCLKFMKRKEQLQRHM  218 (450)
T ss_pred             eEEEchhhhhhhcCHHHHHHHH
Confidence            5799999999999988888874


No 221
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=41.51  E-value=12  Score=19.37  Aligned_cols=14  Identities=36%  Similarity=0.702  Sum_probs=10.2

Q ss_pred             CeeecCcccccccC
Q psy6273          61 NLFSCPLCGEVFRS   74 (82)
Q Consensus        61 ~~~~C~~C~~~f~~   74 (82)
                      +.-.|..|+..|.+
T Consensus        27 RRReC~~C~~RFTT   40 (156)
T COG1327          27 RRRECLECGERFTT   40 (156)
T ss_pred             hhhcccccccccch
Confidence            45678888888764


No 222
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.31  E-value=11  Score=17.03  Aligned_cols=13  Identities=31%  Similarity=0.879  Sum_probs=9.2

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      -.|.|..|+..|.
T Consensus        11 Y~Y~c~~cg~~~d   23 (82)
T COG2331          11 YSYECTECGNRFD   23 (82)
T ss_pred             eEEeecccchHHH
Confidence            3578888887664


No 223
>PF14369 zf-RING_3:  zinc-finger
Probab=41.14  E-value=13  Score=13.92  Aligned_cols=8  Identities=50%  Similarity=1.244  Sum_probs=4.1

Q ss_pred             cCcccccc
Q psy6273          65 CPLCGEVF   72 (82)
Q Consensus        65 C~~C~~~f   72 (82)
                      |+.|+..|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            55555444


No 224
>KOG3352|consensus
Probab=40.85  E-value=14  Score=18.99  Aligned_cols=13  Identities=38%  Similarity=1.030  Sum_probs=10.5

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      +...|.+||..|.
T Consensus       132 e~~rc~eCG~~fk  144 (153)
T KOG3352|consen  132 ETQRCPECGHYFK  144 (153)
T ss_pred             CcccCCcccceEE
Confidence            4778999998775


No 225
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=40.49  E-value=27  Score=18.39  Aligned_cols=19  Identities=11%  Similarity=0.366  Sum_probs=12.6

Q ss_pred             CcccCcCCccccCHHHHHh
Q psy6273           3 RYKCHACDVETKTRQALDN   21 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~   21 (82)
                      ...|..||+.|.....+..
T Consensus       114 ~~~C~~Cg~~f~~~k~i~~  132 (181)
T PRK08222        114 LQRCSRCERPFAPQKTVAL  132 (181)
T ss_pred             cCcCcccCCccCcHhHHHH
Confidence            4567788888876655543


No 226
>KOG0402|consensus
Probab=40.42  E-value=13  Score=17.14  Aligned_cols=32  Identities=19%  Similarity=0.487  Sum_probs=19.7

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSH   75 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~   75 (82)
                      .|.|+.|++.......          -  --|.|..|.+.+.--
T Consensus        36 ky~CsfCGK~~vKR~A----------v--GiW~C~~C~kv~agg   67 (92)
T KOG0402|consen   36 KYTCSFCGKKTVKRKA----------V--GIWKCGSCKKVVAGG   67 (92)
T ss_pred             hhhhhhcchhhhhhhc----------e--eEEecCCccceeccc
Confidence            3788888875322211          1  468888888877543


No 227
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=40.30  E-value=17  Score=17.41  Aligned_cols=10  Identities=40%  Similarity=1.085  Sum_probs=5.2

Q ss_pred             Cccccccchh
Q psy6273          31 KSFACDQCVS   40 (82)
Q Consensus        31 ~~~~c~~c~~   40 (82)
                      +-|.|+.|+.
T Consensus        21 k~FtCp~Cgh   30 (104)
T COG4888          21 KTFTCPRCGH   30 (104)
T ss_pred             ceEecCccCC
Confidence            3455555553


No 228
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=40.11  E-value=28  Score=16.25  Aligned_cols=19  Identities=16%  Similarity=0.485  Sum_probs=13.8

Q ss_pred             cccCcCCccccCHHHHHhH
Q psy6273           4 YKCHACDVETKTRQALDNH   22 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h   22 (82)
                      ..|+.||..|.+.+.+..-
T Consensus        36 ~~C~~CGe~y~~dev~~eI   54 (89)
T TIGR03829        36 ISCSHCGMEYQDDTTVKEI   54 (89)
T ss_pred             ccccCCCcEeecHHHHHHH
Confidence            4588899888887766543


No 229
>PRK12722 transcriptional activator FlhC; Provisional
Probab=39.93  E-value=14  Score=19.74  Aligned_cols=27  Identities=33%  Similarity=0.695  Sum_probs=15.9

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCG   69 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~   69 (82)
                      ..|..|+..|....+          +....|.|+.|.
T Consensus       135 ~~C~~Cgg~fv~~~~----------e~~~~f~CplC~  161 (187)
T PRK12722        135 SSCNCCGGHFVTHAH----------DPVGSFVCGLCQ  161 (187)
T ss_pred             ccCCCCCCCeecccc----------ccCCCCcCCCCC
Confidence            467777776653221          212578888885


No 230
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=39.75  E-value=24  Score=20.42  Aligned_cols=10  Identities=20%  Similarity=0.521  Sum_probs=6.5

Q ss_pred             CeeecCcccc
Q psy6273          61 NLFSCPLCGE   70 (82)
Q Consensus        61 ~~~~C~~C~~   70 (82)
                      +...|..|+.
T Consensus       251 r~e~C~~C~~  260 (305)
T TIGR01562       251 KAETCDSCQG  260 (305)
T ss_pred             EEeecccccc
Confidence            5667777753


No 231
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=39.58  E-value=6  Score=20.71  Aligned_cols=29  Identities=31%  Similarity=0.700  Sum_probs=16.8

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFR   73 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~   73 (82)
                      ..|+.|+.+|...-        +.    ..|-|..|.+.|.
T Consensus        75 l~C~~C~~Tfk~f~--------~~----g~fGCaeCY~tf~  103 (176)
T COG3880          75 LGCHNCGMTFKEFI--------QS----GLFGCAECYKTFE  103 (176)
T ss_pred             hcCccccccHHHHH--------Hh----cccchHHHHHHHH
Confidence            46777776663321        11    3577777777664


No 232
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=39.49  E-value=16  Score=17.07  Aligned_cols=32  Identities=19%  Similarity=0.470  Sum_probs=20.9

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccCc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRSH   75 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~~   75 (82)
                      .|.|+.|++.-...          .+-  -.|.|..|++.|+-.
T Consensus        36 ~y~CpfCgk~~vkR----------~a~--GIW~C~~C~~~~AGG   67 (90)
T PRK03976         36 KHVCPVCGRPKVKR----------VGT--GIWECRKCGAKFAGG   67 (90)
T ss_pred             CccCCCCCCCceEE----------EEE--EEEEcCCCCCEEeCC
Confidence            57899997542211          111  579999999988653


No 233
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=39.46  E-value=16  Score=17.58  Aligned_cols=14  Identities=14%  Similarity=0.337  Sum_probs=11.4

Q ss_pred             CcccCcCCccccCH
Q psy6273           3 RYKCHACDVETKTR   16 (82)
Q Consensus         3 ~~~c~~c~~~~~~~   16 (82)
                      |+.|.-||..|.+-
T Consensus         2 pH~CtrCG~vf~~g   15 (112)
T COG3364           2 PHQCTRCGEVFDDG   15 (112)
T ss_pred             Cceecccccccccc
Confidence            67888899888875


No 234
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=38.79  E-value=9.3  Score=19.18  Aligned_cols=13  Identities=23%  Similarity=0.685  Sum_probs=7.8

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      ..|.|..|+..+.
T Consensus       142 ~~~~C~~C~~~l~  154 (157)
T PF10263_consen  142 KRYRCGRCGGPLV  154 (157)
T ss_pred             hhEECCCCCCEEE
Confidence            3467777765543


No 235
>PRK12860 transcriptional activator FlhC; Provisional
Probab=38.64  E-value=15  Score=19.73  Aligned_cols=27  Identities=30%  Similarity=0.588  Sum_probs=15.4

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCG   69 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~   69 (82)
                      ..|..|+..|....        +...  ..|.|+.|.
T Consensus       135 ~~C~~Cgg~fv~~~--------~e~~--~~f~CplC~  161 (189)
T PRK12860        135 ARCCRCGGKFVTHA--------HDLR--HNFVCGLCQ  161 (189)
T ss_pred             ccCCCCCCCeeccc--------cccC--CCCcCCCCC
Confidence            46777776665322        1112  578888875


No 236
>KOG2231|consensus
Probab=38.50  E-value=47  Score=21.68  Aligned_cols=19  Identities=21%  Similarity=0.433  Sum_probs=11.6

Q ss_pred             cCcCCccccCHHHHHhHHH
Q psy6273           6 CHACDVETKTRQALDNHIL   24 (82)
Q Consensus         6 c~~c~~~~~~~~~l~~h~~   24 (82)
                      |..|...|.....|..|++
T Consensus       185 C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             chhhhhhhccHHHHHHhhc
Confidence            5566666666666666654


No 237
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=38.42  E-value=15  Score=15.18  Aligned_cols=14  Identities=14%  Similarity=0.536  Sum_probs=9.0

Q ss_pred             CeeecCcccccccC
Q psy6273          61 NLFSCPLCGEVFRS   74 (82)
Q Consensus        61 ~~~~C~~C~~~f~~   74 (82)
                      ..+.|.+|++.+..
T Consensus        34 ~~~rC~YCe~~~~~   47 (52)
T PF02748_consen   34 IKLRCHYCERIITE   47 (52)
T ss_dssp             CEEEETTT--EEEH
T ss_pred             CEEEeeCCCCEecc
Confidence            57888888887654


No 238
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=37.92  E-value=11  Score=15.57  Aligned_cols=22  Identities=23%  Similarity=0.354  Sum_probs=11.5

Q ss_pred             CcccCcCCccccCHHHHHhHHH
Q psy6273           3 RYKCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~~h~~   24 (82)
                      .|.|+.|.+.|-..=++-.|..
T Consensus        21 ~y~C~~C~~~FC~dCD~fiHE~   42 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIHET   42 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTTTT
T ss_pred             eEECCCCCCccccCcChhhhcc
Confidence            3778888888887766655543


No 239
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=37.86  E-value=6.3  Score=22.21  Aligned_cols=11  Identities=36%  Similarity=0.921  Sum_probs=6.5

Q ss_pred             CeeecCccccc
Q psy6273          61 NLFSCPLCGEV   71 (82)
Q Consensus        61 ~~~~C~~C~~~   71 (82)
                      +++.|+.||..
T Consensus       208 k~~PCPKCg~e  218 (314)
T PF06524_consen  208 KPIPCPKCGYE  218 (314)
T ss_pred             CCCCCCCCCCc
Confidence            56666666543


No 240
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=37.64  E-value=33  Score=14.03  Aligned_cols=30  Identities=27%  Similarity=0.574  Sum_probs=18.6

Q ss_pred             cc--cchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccccC
Q psy6273          35 CD--QCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVFRS   74 (82)
Q Consensus        35 c~--~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f~~   74 (82)
                      |+  .|+.......        ..+.  ....|+.|+..|-.
T Consensus        21 CP~~~C~~~~~~~~--------~~~~--~~v~C~~C~~~fC~   52 (64)
T smart00647       21 CPAPDCSAAIIVTE--------EEGC--NRVTCPKCGFSFCF   52 (64)
T ss_pred             CCCCCCcceEEecC--------CCCC--CeeECCCCCCeECC
Confidence            55  7766554432        2233  67889888887754


No 241
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=37.58  E-value=17  Score=15.40  Aligned_cols=12  Identities=33%  Similarity=1.021  Sum_probs=5.5

Q ss_pred             eecCcccccccC
Q psy6273          63 FSCPLCGEVFRS   74 (82)
Q Consensus        63 ~~C~~C~~~f~~   74 (82)
                      ..|+.|++.+..
T Consensus         3 v~CP~C~k~~~~   14 (57)
T PF03884_consen    3 VKCPICGKPVEW   14 (57)
T ss_dssp             EE-TTT--EEE-
T ss_pred             ccCCCCCCeecc
Confidence            468888876654


No 242
>PF12773 DZR:  Double zinc ribbon
Probab=37.28  E-value=22  Score=14.02  Aligned_cols=12  Identities=33%  Similarity=0.636  Sum_probs=7.5

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      ....|+.|+...
T Consensus        28 ~~~~C~~Cg~~~   39 (50)
T PF12773_consen   28 SKKICPNCGAEN   39 (50)
T ss_pred             CCCCCcCCcCCC
Confidence            356777777653


No 243
>PTZ00064 histone acetyltransferase; Provisional
Probab=37.16  E-value=7.9  Score=24.00  Aligned_cols=22  Identities=23%  Similarity=0.374  Sum_probs=18.6

Q ss_pred             CeeecCcccccccCcccccccC
Q psy6273          61 NLFSCPLCGEVFRSHQGYKIHH   82 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~l~~H~   82 (82)
                      .-|.|..|.+-|.....|.+|+
T Consensus       279 ~LYICEfCLkY~~s~~~l~rH~  300 (552)
T PTZ00064        279 TLHFCEYCLDFFCFEDELIRHL  300 (552)
T ss_pred             eEEEccchhhhhCCHHHHHHHH
Confidence            5699999999999888888774


No 244
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=36.90  E-value=21  Score=14.57  Aligned_cols=15  Identities=27%  Similarity=0.924  Sum_probs=10.2

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      .-+.|+.||..|...
T Consensus        27 v~W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   27 VWWKCPKCGHEWKAS   41 (55)
T ss_pred             EEEECCCCCCeeEcc
Confidence            358888887766543


No 245
>PRK06260 threonine synthase; Validated
Probab=36.31  E-value=16  Score=21.71  Aligned_cols=26  Identities=23%  Similarity=0.669  Sum_probs=14.7

Q ss_pred             cccCcCCccccCHHHHHhHHHhhCCCCCccccccchhhh
Q psy6273           4 YKCHACDVETKTRQALDNHILCVHTETKSFACDQCVSYF   42 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~~   42 (82)
                      +.|..|++.+..             ....+.|+.|+..+
T Consensus         4 ~~C~~cg~~~~~-------------~~~~~~Cp~cg~~l   29 (397)
T PRK06260          4 LKCIECGKEYDP-------------DEIIYTCPECGGLL   29 (397)
T ss_pred             EEECCCCCCCCC-------------CCccccCCCCCCeE
Confidence            567777765431             12246787776543


No 246
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=36.21  E-value=38  Score=13.88  Aligned_cols=32  Identities=22%  Similarity=0.614  Sum_probs=18.1

Q ss_pred             ccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccccc
Q psy6273          34 ACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEV   71 (82)
Q Consensus        34 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~   71 (82)
                      .|..|.-..  +.....  ....++  ....|+.||+.
T Consensus        24 ~C~gC~~~l--~~~~~~--~i~~~~--~i~~Cp~CgRi   55 (56)
T PF02591_consen   24 TCSGCHMEL--PPQELN--EIRKGD--EIVFCPNCGRI   55 (56)
T ss_pred             ccCCCCEEc--CHHHHH--HHHcCC--CeEECcCCCcc
Confidence            677775433  222222  233445  68899999874


No 247
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=36.15  E-value=16  Score=16.60  Aligned_cols=9  Identities=44%  Similarity=1.593  Sum_probs=3.3

Q ss_pred             CeeecCccc
Q psy6273          61 NLFSCPLCG   69 (82)
Q Consensus        61 ~~~~C~~C~   69 (82)
                      +.|.|+.|+
T Consensus        21 ~~F~CPfC~   29 (81)
T PF05129_consen   21 KVFDCPFCN   29 (81)
T ss_dssp             S----TTT-
T ss_pred             ceEcCCcCC
Confidence            678999887


No 248
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=35.80  E-value=23  Score=13.71  Aligned_cols=12  Identities=25%  Similarity=0.681  Sum_probs=5.0

Q ss_pred             ecCcccccccCc
Q psy6273          64 SCPLCGEVFRSH   75 (82)
Q Consensus        64 ~C~~C~~~f~~~   75 (82)
                      .|..||+.-...
T Consensus         3 ~CSFCgr~~~~v   14 (41)
T PF06689_consen    3 RCSFCGRPESEV   14 (41)
T ss_dssp             B-TTT--BTTTS
T ss_pred             CccCCCCCHHHH
Confidence            467777655443


No 249
>PTZ00448 hypothetical protein; Provisional
Probab=35.52  E-value=30  Score=20.72  Aligned_cols=23  Identities=26%  Similarity=0.498  Sum_probs=18.8

Q ss_pred             ccccccchhhhcCcHHHHHHHHH
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRK   54 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~   54 (82)
                      .+.|..|+-.|.+......|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999887777777765


No 250
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=34.88  E-value=50  Score=15.84  Aligned_cols=19  Identities=21%  Similarity=0.447  Sum_probs=14.3

Q ss_pred             cccCcCCccccCHHHHHhH
Q psy6273           4 YKCHACDVETKTRQALDNH   22 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h   22 (82)
                      +.|+.||..+.+.......
T Consensus        32 ~~C~~CGe~~~~~e~~~~~   50 (127)
T TIGR03830        32 WYCPACGEELLDPEESKRN   50 (127)
T ss_pred             eECCCCCCEEEcHHHHHHH
Confidence            5699999988877665544


No 251
>KOG4727|consensus
Probab=34.80  E-value=27  Score=18.54  Aligned_cols=21  Identities=33%  Similarity=0.635  Sum_probs=18.1

Q ss_pred             cccCcCCccccCHHHHHhHHH
Q psy6273           4 YKCHACDVETKTRQALDNHIL   24 (82)
Q Consensus         4 ~~c~~c~~~~~~~~~l~~h~~   24 (82)
                      |-|.+|+-++...-++..|+.
T Consensus        76 yyCdVCdcvvKDSinflDHiN   96 (193)
T KOG4727|consen   76 YYCDVCDCVVKDSINFLDHIN   96 (193)
T ss_pred             eeeeecceeehhhHHHHHHhc
Confidence            569999999999988888875


No 252
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=34.40  E-value=42  Score=18.80  Aligned_cols=34  Identities=29%  Similarity=0.718  Sum_probs=18.4

Q ss_pred             cccccchhhhcCcHHHHHHHHHhcCCCCCeeecCcccccc
Q psy6273          33 FACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCGEVF   72 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~~~f   72 (82)
                      ..|..|.-..  +.....-++.  ++  ....|+.||+..
T Consensus       198 ~~C~GC~m~l--~~~~~~~V~~--~d--~iv~CP~CgRIL  231 (239)
T COG1579         198 RVCGGCHMKL--PSQTLSKVRK--KD--EIVFCPYCGRIL  231 (239)
T ss_pred             CcccCCeeee--cHHHHHHHhc--CC--CCccCCccchHH
Confidence            3566664332  3333333333  44  678899999753


No 253
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=34.39  E-value=32  Score=12.83  Aligned_cols=11  Identities=36%  Similarity=1.056  Sum_probs=6.6

Q ss_pred             CeeecCccccc
Q psy6273          61 NLFSCPLCGEV   71 (82)
Q Consensus        61 ~~~~C~~C~~~   71 (82)
                      ..+.|+.||..
T Consensus        21 ~R~vC~~Cg~I   31 (34)
T PF14803_consen   21 ERLVCPACGFI   31 (34)
T ss_dssp             -EEEETTTTEE
T ss_pred             cceECCCCCCE
Confidence            46777777653


No 254
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=33.89  E-value=24  Score=20.21  Aligned_cols=10  Identities=20%  Similarity=0.763  Sum_probs=4.7

Q ss_pred             ccccchhhhc
Q psy6273          34 ACDQCVSYFK   43 (82)
Q Consensus        34 ~c~~c~~~~~   43 (82)
                      .|+.|+..|.
T Consensus        47 vc~~c~~h~r   56 (285)
T TIGR00515        47 VCPKCDHHMR   56 (285)
T ss_pred             CCCCCCCcCc
Confidence            4555554443


No 255
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=33.51  E-value=24  Score=14.68  Aligned_cols=10  Identities=40%  Similarity=1.255  Sum_probs=8.1

Q ss_pred             CeeecCcccc
Q psy6273          61 NLFSCPLCGE   70 (82)
Q Consensus        61 ~~~~C~~C~~   70 (82)
                      -.|.|+.|+.
T Consensus        43 i~y~C~~Cg~   52 (54)
T PF10058_consen   43 IQYRCPYCGA   52 (54)
T ss_pred             eEEEcCCCCC
Confidence            4799999974


No 256
>PRK12496 hypothetical protein; Provisional
Probab=33.48  E-value=24  Score=18.34  Aligned_cols=12  Identities=17%  Similarity=0.459  Sum_probs=9.9

Q ss_pred             eecCcccccccC
Q psy6273          63 FSCPLCGEVFRS   74 (82)
Q Consensus        63 ~~C~~C~~~f~~   74 (82)
                      +.|..|++.|..
T Consensus       128 ~~C~gC~~~~~~  139 (164)
T PRK12496        128 KVCKGCKKKYPE  139 (164)
T ss_pred             EECCCCCccccC
Confidence            779999998854


No 257
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=33.40  E-value=7.9  Score=22.88  Aligned_cols=21  Identities=24%  Similarity=0.566  Sum_probs=16.5

Q ss_pred             CeeecCcccccccCccccccc
Q psy6273          61 NLFSCPLCGEVFRSHQGYKIH   81 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~~l~~H   81 (82)
                      +.+-|+.|++.|...+.+..|
T Consensus       237 ~~~YC~~C~r~f~~~~VFe~H  257 (470)
T COG5188         237 PKVYCVKCGREFSRSKVFEYH  257 (470)
T ss_pred             cceeeHhhhhHhhhhHHHHHH
Confidence            567899999999887766555


No 258
>PHA02942 putative transposase; Provisional
Probab=33.17  E-value=22  Score=21.16  Aligned_cols=12  Identities=42%  Similarity=0.958  Sum_probs=9.6

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      +.|.|+.||...
T Consensus       341 r~f~C~~CG~~~  352 (383)
T PHA02942        341 RYFHCPSCGYEN  352 (383)
T ss_pred             CEEECCCCCCEe
Confidence            679999998654


No 259
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]
Probab=32.99  E-value=27  Score=20.27  Aligned_cols=26  Identities=27%  Similarity=0.434  Sum_probs=16.4

Q ss_pred             CCccccCHHHHHhHHHhhCCCCCccccccchhh
Q psy6273           9 CDVETKTRQALDNHILCVHTETKSFACDQCVSY   41 (82)
Q Consensus         9 c~~~~~~~~~l~~h~~~~~~~~~~~~c~~c~~~   41 (82)
                      ||.+|.+.     -++ .|.+++|+ |+.|...
T Consensus        43 CgHtFCsl-----CIR-~hL~~qp~-CP~Cr~~   68 (391)
T COG5432          43 CGHTFCSL-----CIR-RHLGTQPF-CPVCRED   68 (391)
T ss_pred             cccchhHH-----HHH-HHhcCCCC-Ccccccc
Confidence            77776653     234 56777775 8888753


No 260
>COG2879 Uncharacterized small protein [Function unknown]
Probab=32.29  E-value=53  Score=14.32  Aligned_cols=16  Identities=25%  Similarity=0.434  Sum_probs=11.9

Q ss_pred             cCcHHHHHHHHHhcCC
Q psy6273          43 KTNSALLQHKRKMHDE   58 (82)
Q Consensus        43 ~~~~~l~~h~~~~~~~   58 (82)
                      .+-+++..||+.++.+
T Consensus        23 pdYdnYVehmr~~hPd   38 (65)
T COG2879          23 PDYDNYVEHMRKKHPD   38 (65)
T ss_pred             CcHHHHHHHHHHhCcC
Confidence            3457788899987766


No 261
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=32.21  E-value=18  Score=15.21  Aligned_cols=11  Identities=36%  Similarity=1.280  Sum_probs=3.8

Q ss_pred             CeeecCccccc
Q psy6273          61 NLFSCPLCGEV   71 (82)
Q Consensus        61 ~~~~C~~C~~~   71 (82)
                      +.|.|+.||-.
T Consensus        32 r~y~Cp~CgAt   42 (55)
T PF05741_consen   32 RKYVCPICGAT   42 (55)
T ss_dssp             GG---TTT---
T ss_pred             hcCcCCCCcCc
Confidence            56888888753


No 262
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=32.17  E-value=27  Score=20.18  Aligned_cols=10  Identities=40%  Similarity=0.846  Sum_probs=4.7

Q ss_pred             ccccchhhhc
Q psy6273          34 ACDQCVSYFK   43 (82)
Q Consensus        34 ~c~~c~~~~~   43 (82)
                      .|+.|+..|.
T Consensus        59 vcp~c~~h~r   68 (296)
T CHL00174         59 ICEQCGYHLK   68 (296)
T ss_pred             CCCCCCCCcC
Confidence            4555554443


No 263
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional
Probab=31.49  E-value=41  Score=17.60  Aligned_cols=18  Identities=17%  Similarity=0.506  Sum_probs=10.5

Q ss_pred             CcccCcCCccccCHHHHH
Q psy6273           3 RYKCHACDVETKTRQALD   20 (82)
Q Consensus         3 ~~~c~~c~~~~~~~~~l~   20 (82)
                      ++.|..||+.|.....+.
T Consensus       114 ~~~C~~CG~~f~~~~~i~  131 (180)
T PRK12387        114 LCNCRVCGRPFAVQKEID  131 (180)
T ss_pred             cccchhhCCccccHHHHH
Confidence            345667777666554433


No 264
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=31.43  E-value=26  Score=11.90  Aligned_cols=7  Identities=29%  Similarity=0.880  Sum_probs=3.2

Q ss_pred             ccccchh
Q psy6273          34 ACDQCVS   40 (82)
Q Consensus        34 ~c~~c~~   40 (82)
                      .|+.|+.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            3444544


No 265
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=31.40  E-value=26  Score=24.58  Aligned_cols=7  Identities=43%  Similarity=1.274  Sum_probs=3.9

Q ss_pred             ecCcccc
Q psy6273          64 SCPLCGE   70 (82)
Q Consensus        64 ~C~~C~~   70 (82)
                      .|+.|+.
T Consensus       711 ~CP~CGt  717 (1337)
T PRK14714        711 ECPRCDV  717 (1337)
T ss_pred             cCCCCCC
Confidence            4666653


No 266
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=31.24  E-value=15  Score=15.38  Aligned_cols=16  Identities=19%  Similarity=0.499  Sum_probs=7.5

Q ss_pred             eeecCcccccccCccc
Q psy6273          62 LFSCPLCGEVFRSHQG   77 (82)
Q Consensus        62 ~~~C~~C~~~f~~~~~   77 (82)
                      -+-|-+||..|.....
T Consensus        27 ~~YC~~Cg~~Y~d~~d   42 (55)
T PF13821_consen   27 HNYCFWCGTKYDDEED   42 (55)
T ss_pred             CceeeeeCCccCCHHH
Confidence            3445555555544433


No 267
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=31.15  E-value=35  Score=13.00  Aligned_cols=12  Identities=25%  Similarity=0.753  Sum_probs=7.5

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      +.|.|..|+...
T Consensus        23 ~~w~C~~C~~~N   34 (40)
T PF04810_consen   23 KTWICNFCGTKN   34 (40)
T ss_dssp             TEEEETTT--EE
T ss_pred             CEEECcCCCCcC
Confidence            678888887643


No 268
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=30.94  E-value=15  Score=19.06  Aligned_cols=15  Identities=20%  Similarity=0.405  Sum_probs=12.7

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      .|.-|..||+.|.|-
T Consensus        67 ~PsYC~~CGkpyPWt   81 (158)
T PF10083_consen   67 APSYCHNCGKPYPWT   81 (158)
T ss_pred             CChhHHhCCCCCchH
Confidence            688899999999764


No 269
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=30.92  E-value=24  Score=16.26  Aligned_cols=11  Identities=36%  Similarity=0.923  Sum_probs=6.6

Q ss_pred             eecCccccccc
Q psy6273          63 FSCPLCGEVFR   73 (82)
Q Consensus        63 ~~C~~C~~~f~   73 (82)
                      -.|+.||..|.
T Consensus         9 ~~C~~CG~d~~   19 (86)
T PF06170_consen    9 PRCPHCGLDYS   19 (86)
T ss_pred             CcccccCCccc
Confidence            35667766554


No 270
>KOG3183|consensus
Probab=30.76  E-value=22  Score=19.87  Aligned_cols=14  Identities=29%  Similarity=0.598  Sum_probs=11.2

Q ss_pred             CeeecCcccccccC
Q psy6273          61 NLFSCPLCGEVFRS   74 (82)
Q Consensus        61 ~~~~C~~C~~~f~~   74 (82)
                      -||.|..|+..|..
T Consensus        22 LPf~Cd~C~~~FC~   35 (250)
T KOG3183|consen   22 LPFKCDGCSGIFCL   35 (250)
T ss_pred             cceeeCCccchhhh
Confidence            58999999888753


No 271
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=30.54  E-value=23  Score=14.86  Aligned_cols=11  Identities=45%  Similarity=1.437  Sum_probs=6.4

Q ss_pred             eecCccccccc
Q psy6273          63 FSCPLCGEVFR   73 (82)
Q Consensus        63 ~~C~~C~~~f~   73 (82)
                      -.|..||+.|.
T Consensus         6 ~~C~~Cg~~~~   16 (54)
T PF14446_consen    6 CKCPVCGKKFK   16 (54)
T ss_pred             ccChhhCCccc
Confidence            35666666664


No 272
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=29.80  E-value=28  Score=14.60  Aligned_cols=7  Identities=14%  Similarity=0.387  Sum_probs=2.1

Q ss_pred             cCCcccc
Q psy6273           8 ACDVETK   14 (82)
Q Consensus         8 ~c~~~~~   14 (82)
                      .|+..|.
T Consensus        29 ~C~H~fe   35 (57)
T PF11789_consen   29 KCGHTFE   35 (57)
T ss_dssp             SS--EEE
T ss_pred             CCCCeec
Confidence            3444444


No 273
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=29.75  E-value=37  Score=11.96  Aligned_cols=6  Identities=33%  Similarity=1.636  Sum_probs=2.5

Q ss_pred             cccccc
Q psy6273          33 FACDQC   38 (82)
Q Consensus        33 ~~c~~c   38 (82)
                      |.|..|
T Consensus        16 Y~C~~c   21 (30)
T PF03107_consen   16 YHCSEC   21 (30)
T ss_pred             EEeCCC
Confidence            444443


No 274
>COG1631 RPL42A Ribosomal protein L44E [Translation, ribosomal structure and biogenesis]
Probab=29.26  E-value=24  Score=16.62  Aligned_cols=13  Identities=23%  Similarity=0.743  Sum_probs=10.0

Q ss_pred             eeecCcccccccC
Q psy6273          62 LFSCPLCGEVFRS   74 (82)
Q Consensus        62 ~~~C~~C~~~f~~   74 (82)
                      .|.|.+|+++-..
T Consensus        68 r~~Ct~Cgkah~~   80 (94)
T COG1631          68 RLRCTECGKAHQR   80 (94)
T ss_pred             EEEehhhcccccc
Confidence            4899999986544


No 275
>KOG0227|consensus
Probab=29.05  E-value=21  Score=19.27  Aligned_cols=20  Identities=20%  Similarity=0.730  Sum_probs=12.4

Q ss_pred             cccccchhhhcCcHHHHHHH
Q psy6273          33 FACDQCVSYFKTNSALLQHK   52 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~   52 (82)
                      |.|..|...-.+..++..|.
T Consensus        54 yeCkLClT~H~ne~Syl~Ht   73 (222)
T KOG0227|consen   54 YECKLCLTLHNNEGSYLAHT   73 (222)
T ss_pred             eeehhhhhhhcchhhhhhhh
Confidence            66777766666666655554


No 276
>KOG2857|consensus
Probab=28.75  E-value=29  Score=17.79  Aligned_cols=18  Identities=28%  Similarity=0.696  Sum_probs=8.4

Q ss_pred             eeecCcccccccCccccc
Q psy6273          62 LFSCPLCGEVFRSHQGYK   79 (82)
Q Consensus        62 ~~~C~~C~~~f~~~~~l~   79 (82)
                      -|+|+.|..-+.+..=++
T Consensus        17 KYKCpkC~vPYCSl~CfK   34 (157)
T KOG2857|consen   17 KYKCPKCSVPYCSLPCFK   34 (157)
T ss_pred             hccCCCCCCccccchhhh
Confidence            355655554444433333


No 277
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=28.68  E-value=14  Score=23.07  Aligned_cols=38  Identities=18%  Similarity=0.322  Sum_probs=20.9

Q ss_pred             ccccccchhhhcCc-HHHHHHHHHhcC--CCCCeeecCccccccc
Q psy6273          32 SFACDQCVSYFKTN-SALLQHKRKMHD--EFVNLFSCPLCGEVFR   73 (82)
Q Consensus        32 ~~~c~~c~~~~~~~-~~l~~h~~~~~~--~~~~~~~C~~C~~~f~   73 (82)
                      -.+|+.|+..+... ..|.    ...+  ...-.|.|+.||....
T Consensus       200 ~vpCPhCg~~~~l~~~~l~----w~~~~~~~~a~y~C~~Cg~~i~  240 (557)
T PF05876_consen  200 YVPCPHCGEEQVLEWENLK----WDKGEAPETARYVCPHCGCEIE  240 (557)
T ss_pred             EccCCCCCCCcccccccee----ecCCCCccceEEECCCCcCCCC
Confidence            45788888765544 2221    1111  1114688888886654


No 278
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=28.29  E-value=33  Score=19.74  Aligned_cols=10  Identities=20%  Similarity=0.750  Sum_probs=5.2

Q ss_pred             ccccchhhhc
Q psy6273          34 ACDQCVSYFK   43 (82)
Q Consensus        34 ~c~~c~~~~~   43 (82)
                      .|+.|+..|.
T Consensus        48 vc~~c~~h~r   57 (292)
T PRK05654         48 VCPKCGHHMR   57 (292)
T ss_pred             CCCCCCCCee
Confidence            4555555543


No 279
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=28.20  E-value=30  Score=17.55  Aligned_cols=16  Identities=31%  Similarity=0.785  Sum_probs=12.1

Q ss_pred             eeecCcccccccCccc
Q psy6273          62 LFSCPLCGEVFRSHQG   77 (82)
Q Consensus        62 ~~~C~~C~~~f~~~~~   77 (82)
                      --+|+.|.-+|.+.+.
T Consensus       121 ypvCPvCkTSFKss~~  136 (140)
T PF05290_consen  121 YPVCPVCKTSFKSSSS  136 (140)
T ss_pred             CCCCCccccccccccc
Confidence            3478999999987654


No 280
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=27.88  E-value=27  Score=13.97  Aligned_cols=10  Identities=40%  Similarity=0.923  Sum_probs=6.4

Q ss_pred             eecCcccccc
Q psy6273          63 FSCPLCGEVF   72 (82)
Q Consensus        63 ~~C~~C~~~f   72 (82)
                      -+|+.||-.-
T Consensus        12 rkCp~CGt~N   21 (44)
T PF14952_consen   12 RKCPKCGTYN   21 (44)
T ss_pred             ccCCcCcCcc
Confidence            4788887443


No 281
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators. Ferric uptake regulator (Fur) and related metalloregulatory proteins are iron-dependent, DNA-binding repressors and activators mainly involved in iron metabolism.  A general model for Fur repression under iron-rich conditions is that activated Fur (a dimer having one Fe2+ coordinated per monomer) binds to specific DNA sequences (Fur boxes) in the promoter region of iron-responsive genes, hindering access of RNA polymerase, and repressing transcription. Positive regulation by Fur can be direct or indirect, as in the Fur repression of an anti-sense regulatory small RNA. Some members sense metal ions other than Fe2+.  For example, the zinc uptake regulator (Zur) responds to Zn2+, the manganese uptake regulator (Mur) responds to Mn2+, and the nickel uptake regulator (Nur) responds to Ni2+. Other members sense signals other than metal ions.  
Probab=27.63  E-value=30  Score=16.31  Aligned_cols=13  Identities=31%  Similarity=0.728  Sum_probs=10.4

Q ss_pred             eeecCcccccccC
Q psy6273          62 LFSCPLCGEVFRS   74 (82)
Q Consensus        62 ~~~C~~C~~~f~~   74 (82)
                      .+.|..||+.+.-
T Consensus        73 H~~C~~Cg~i~~~   85 (116)
T cd07153          73 HLICTKCGKVIDF   85 (116)
T ss_pred             ceEeCCCCCEEEe
Confidence            5899999987753


No 282
>PF10609 ParA:  ParA/MinD ATPase like;  InterPro: IPR019591  This entry represents ATPases involved in plasmid partitioning []. It also contains cytosolic Fe-S cluster assembling factors, NBP35 and CFD1 which are required for biogenesis and export of both ribosomal subunits probably through assembling the ISCs in RLI1, a protein which performs rRNA processing and ribosome export [, , ].; PDB: 2PH1_A 3KB1_B.
Probab=27.61  E-value=32  Score=15.73  Aligned_cols=11  Identities=55%  Similarity=1.325  Sum_probs=5.5

Q ss_pred             CeeecCccccc
Q psy6273          61 NLFSCPLCGEV   71 (82)
Q Consensus        61 ~~~~C~~C~~~   71 (82)
                      .-|.|+.|++.
T Consensus        64 s~~~Cp~Cg~~   74 (81)
T PF10609_consen   64 SYFVCPHCGER   74 (81)
T ss_dssp             -EEE-TTT--E
T ss_pred             CccCCCCCCCe
Confidence            45899998864


No 283
>PRK04351 hypothetical protein; Provisional
Probab=27.57  E-value=28  Score=17.84  Aligned_cols=13  Identities=15%  Similarity=0.616  Sum_probs=8.1

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      ..|.|..|+..+.
T Consensus       131 ~~yrCg~C~g~L~  143 (149)
T PRK04351        131 KRYRCGKCRGKLK  143 (149)
T ss_pred             CcEEeCCCCcEee
Confidence            4577777765443


No 284
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=27.55  E-value=26  Score=20.77  Aligned_cols=11  Identities=36%  Similarity=1.053  Sum_probs=7.3

Q ss_pred             eeecCcccccc
Q psy6273          62 LFSCPLCGEVF   72 (82)
Q Consensus        62 ~~~C~~C~~~f   72 (82)
                      .+.|+.||..+
T Consensus       265 ~wrCpkCGg~i  275 (403)
T COG1379         265 RWRCPKCGGKI  275 (403)
T ss_pred             cccCcccccch
Confidence            47777777654


No 285
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=27.55  E-value=45  Score=11.95  Aligned_cols=11  Identities=27%  Similarity=0.839  Sum_probs=3.8

Q ss_pred             cccCcCCcccc
Q psy6273           4 YKCHACDVETK   14 (82)
Q Consensus         4 ~~c~~c~~~~~   14 (82)
                      |.|+.|+..+-
T Consensus        14 Y~Cp~C~~~~C   24 (30)
T PF04438_consen   14 YRCPRCGARYC   24 (30)
T ss_dssp             EE-TTT--EES
T ss_pred             EECCCcCCcee
Confidence            44555554443


No 286
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=27.53  E-value=31  Score=13.83  Aligned_cols=14  Identities=29%  Similarity=0.816  Sum_probs=8.5

Q ss_pred             eeecCcccccccCc
Q psy6273          62 LFSCPLCGEVFRSH   75 (82)
Q Consensus        62 ~~~C~~C~~~f~~~   75 (82)
                      -|.|..|++.+...
T Consensus        26 Cf~C~~C~~~l~~~   39 (58)
T PF00412_consen   26 CFKCSKCGKPLNDG   39 (58)
T ss_dssp             TSBETTTTCBTTTS
T ss_pred             ccccCCCCCccCCC
Confidence            46777776655443


No 287
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=26.65  E-value=28  Score=18.98  Aligned_cols=15  Identities=27%  Similarity=0.618  Sum_probs=11.4

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      -||.|..|.+.|...
T Consensus       195 IPF~C~iCKkdy~sp  209 (259)
T COG5152         195 IPFLCGICKKDYESP  209 (259)
T ss_pred             Cceeehhchhhccch
Confidence            589999888776543


No 288
>KOG1994|consensus
Probab=26.55  E-value=32  Score=19.16  Aligned_cols=21  Identities=24%  Similarity=0.531  Sum_probs=17.6

Q ss_pred             CccccccchhhhcCcHHHHHH
Q psy6273          31 KSFACDQCVSYFKTNSALLQH   51 (82)
Q Consensus        31 ~~~~c~~c~~~~~~~~~l~~h   51 (82)
                      ..|-|-.||..|.+...|..|
T Consensus       238 eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  238 EHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             cceEEEEeccccCCHHHHHHh
Confidence            457899999999999988764


No 289
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=26.48  E-value=31  Score=17.39  Aligned_cols=12  Identities=33%  Similarity=0.725  Sum_probs=8.6

Q ss_pred             eeecCccccccc
Q psy6273          62 LFSCPLCGEVFR   73 (82)
Q Consensus        62 ~~~C~~C~~~f~   73 (82)
                      --+|..||+.|-
T Consensus        29 g~kC~~CG~v~~   40 (140)
T COG1545          29 GTKCKKCGRVYF   40 (140)
T ss_pred             EEEcCCCCeEEc
Confidence            457888887653


No 290
>COG4640 Predicted membrane protein [Function unknown]
Probab=26.40  E-value=55  Score=20.01  Aligned_cols=19  Identities=21%  Similarity=0.503  Sum_probs=11.5

Q ss_pred             ccccccchhhhcCcHHHHH
Q psy6273          32 SFACDQCVSYFKTNSALLQ   50 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~   50 (82)
                      ...|..||..|........
T Consensus        15 ~~qC~qCG~~~t~~~sqan   33 (465)
T COG4640          15 DVQCTQCGHKFTSRQSQAN   33 (465)
T ss_pred             cccccccCCcCCchhhhhh
Confidence            3447777777666655433


No 291
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=26.33  E-value=37  Score=19.42  Aligned_cols=14  Identities=29%  Similarity=0.553  Sum_probs=9.0

Q ss_pred             CeeecCcccccccC
Q psy6273          61 NLFSCPLCGEVFRS   74 (82)
Q Consensus        61 ~~~~C~~C~~~f~~   74 (82)
                      ..|.|+.|...|..
T Consensus       254 ~GyvCs~Clsi~C~  267 (279)
T TIGR00627       254 IGFVCSVCLSVLCQ  267 (279)
T ss_pred             ceEECCCccCCcCC
Confidence            34777777666654


No 292
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=26.32  E-value=31  Score=16.68  Aligned_cols=11  Identities=64%  Similarity=1.340  Sum_probs=7.6

Q ss_pred             eecCccccccc
Q psy6273          63 FSCPLCGEVFR   73 (82)
Q Consensus        63 ~~C~~C~~~f~   73 (82)
                      ..|+.||.-|.
T Consensus        50 t~CP~Cg~~~e   60 (115)
T COG1885          50 TSCPKCGEPFE   60 (115)
T ss_pred             ccCCCCCCccc
Confidence            57888876553


No 293
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=26.25  E-value=42  Score=11.70  Aligned_cols=11  Identities=18%  Similarity=0.522  Sum_probs=4.1

Q ss_pred             CeeecCccccc
Q psy6273          61 NLFSCPLCGEV   71 (82)
Q Consensus        61 ~~~~C~~C~~~   71 (82)
                      ..|.|..|...
T Consensus        14 ~~Y~C~~Cdf~   24 (30)
T PF07649_consen   14 WFYRCSECDFD   24 (30)
T ss_dssp             -EEE-TTT---
T ss_pred             ceEECccCCCc
Confidence            46677766543


No 294
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=26.18  E-value=54  Score=12.45  Aligned_cols=12  Identities=33%  Similarity=0.736  Sum_probs=3.4

Q ss_pred             CCcccCcCCccc
Q psy6273           2 TRYKCHACDVET   13 (82)
Q Consensus         2 k~~~c~~c~~~~   13 (82)
                      +.|-|..|+.-+
T Consensus         2 ~ryyCdyC~~~~   13 (38)
T PF06220_consen    2 PRYYCDYCKKYL   13 (38)
T ss_dssp             -S-B-TTT--B-
T ss_pred             cCeeccccccee
Confidence            445566666555


No 295
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=25.99  E-value=34  Score=16.62  Aligned_cols=12  Identities=33%  Similarity=1.063  Sum_probs=9.6

Q ss_pred             eeecCccccccc
Q psy6273          62 LFSCPLCGEVFR   73 (82)
Q Consensus        62 ~~~C~~C~~~f~   73 (82)
                      -|.|..||..+.
T Consensus       100 Fy~C~~Cg~~wr  111 (113)
T COG1594         100 FYKCTRCGYRWR  111 (113)
T ss_pred             EEEecccCCEee
Confidence            489999997765


No 296
>PF01475 FUR:  Ferric uptake regulator family;  InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins. These are responsible for controlling the intracellular concentration of iron in many bacteria. Although iron is essential for most organisms, high concentrations can be toxic because of the formation of hydroxyl radicals []. FURs can also control zinc homeostasis [] and is the subject of research on the pathogenesis of mycobacteria.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent; PDB: 1MZB_A 2RGV_B 2FE3_B 3F8N_B 3EYY_B 2W57_A 2FU4_A 2O03_A 3MWM_B 2XIG_B ....
Probab=25.76  E-value=33  Score=16.41  Aligned_cols=13  Identities=38%  Similarity=0.971  Sum_probs=9.1

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      -.+.|..||+.+.
T Consensus        79 ~h~iC~~Cg~v~~   91 (120)
T PF01475_consen   79 HHFICTQCGKVID   91 (120)
T ss_dssp             EEEEETTTS-EEE
T ss_pred             eEEEECCCCCEEE
Confidence            3588999998764


No 297
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=24.63  E-value=36  Score=15.67  Aligned_cols=12  Identities=25%  Similarity=0.861  Sum_probs=9.3

Q ss_pred             eecCcccccccC
Q psy6273          63 FSCPLCGEVFRS   74 (82)
Q Consensus        63 ~~C~~C~~~f~~   74 (82)
                      -.|..|++.+..
T Consensus        79 ~~C~vC~k~l~~   90 (109)
T PF10367_consen   79 TKCSVCGKPLGN   90 (109)
T ss_pred             CCccCcCCcCCC
Confidence            469999987765


No 298
>PF00935 Ribosomal_L44:  Ribosomal protein L44;  InterPro: IPR000552 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of mammalian [], Trypanosoma brucei, Caenorhabditis elegans and fungal L44, and Haloarcula marismortui LA [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZS_r 1S1I_Z 3O5H_f 3O58_f 3IZR_r 1M1K_4 3CCQ_3 3CCL_3 3CME_3 1K73_4 ....
Probab=24.59  E-value=37  Score=15.41  Aligned_cols=13  Identities=23%  Similarity=0.600  Sum_probs=8.8

Q ss_pred             CeeecCccccccc
Q psy6273          61 NLFSCPLCGEVFR   73 (82)
Q Consensus        61 ~~~~C~~C~~~f~   73 (82)
                      -.+.|..|++...
T Consensus        52 Lrl~C~~C~~~~~   64 (77)
T PF00935_consen   52 LRLECTECGKAHM   64 (77)
T ss_dssp             EEEEETTTS-EEE
T ss_pred             EEEEeCCCCcccc
Confidence            3589999987643


No 299
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.33  E-value=21  Score=17.83  Aligned_cols=14  Identities=29%  Similarity=0.422  Sum_probs=8.0

Q ss_pred             CeeecCcccccccC
Q psy6273          61 NLFSCPLCGEVFRS   74 (82)
Q Consensus        61 ~~~~C~~C~~~f~~   74 (82)
                      .|--|-.||+.|.+
T Consensus        67 ~psfchncgs~fpw   80 (160)
T COG4306          67 PPSFCHNCGSRFPW   80 (160)
T ss_pred             CcchhhcCCCCCCc
Confidence            45556666666554


No 300
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=23.96  E-value=1.2e+02  Score=15.78  Aligned_cols=10  Identities=20%  Similarity=0.803  Sum_probs=4.8

Q ss_pred             ccccchhhhc
Q psy6273          34 ACDQCVSYFK   43 (82)
Q Consensus        34 ~c~~c~~~~~   43 (82)
                      .|..|++.+.
T Consensus       107 ~C~~C~~~~~  116 (178)
T PF02146_consen  107 RCSKCGKEYD  116 (178)
T ss_dssp             EETTTSBEEE
T ss_pred             eecCCCcccc
Confidence            4555555443


No 301
>KOG3277|consensus
Probab=23.78  E-value=26  Score=18.26  Aligned_cols=9  Identities=33%  Similarity=1.265  Sum_probs=4.7

Q ss_pred             cccCcCCcc
Q psy6273           4 YKCHACDVE   12 (82)
Q Consensus         4 ~~c~~c~~~   12 (82)
                      |.|..|+..
T Consensus        80 yTCkvCntR   88 (165)
T KOG3277|consen   80 YTCKVCNTR   88 (165)
T ss_pred             EEeeccCCc
Confidence            455555543


No 302
>PF14149 YhfH:  YhfH-like protein
Probab=23.67  E-value=18  Score=13.87  Aligned_cols=12  Identities=25%  Similarity=0.614  Sum_probs=7.3

Q ss_pred             eeecCccccccc
Q psy6273          62 LFSCPLCGEVFR   73 (82)
Q Consensus        62 ~~~C~~C~~~f~   73 (82)
                      +=.|+.||+...
T Consensus        13 ~K~C~~CG~~i~   24 (37)
T PF14149_consen   13 PKKCTECGKEIE   24 (37)
T ss_pred             CcccHHHHHHHH
Confidence            346777876543


No 303
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=23.57  E-value=40  Score=16.08  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=8.6

Q ss_pred             CeeecCcccccc
Q psy6273          61 NLFSCPLCGEVF   72 (82)
Q Consensus        61 ~~~~C~~C~~~f   72 (82)
                      +..+|..||-.|
T Consensus        87 r~~rC~nCG~~f   98 (98)
T PF10164_consen   87 RERRCSNCGATF   98 (98)
T ss_pred             CccccCCCCccC
Confidence            567888887665


No 304
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=23.23  E-value=30  Score=19.61  Aligned_cols=29  Identities=24%  Similarity=0.510  Sum_probs=17.2

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCCCCCeeecCccc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDEFVNLFSCPLCG   69 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~~~C~~C~   69 (82)
                      .-.|+.|+........|      | +-  =.|+|..|.
T Consensus       220 ~r~CP~Cg~~W~L~~pl------h-~i--FdFKCD~CR  248 (258)
T PF10071_consen  220 ARKCPSCGGDWRLKEPL------H-DI--FDFKCDPCR  248 (258)
T ss_pred             CCCCCCCCCccccCCch------h-hc--eeccCCcce
Confidence            34678887766555544      1 11  357777774


No 305
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=23.06  E-value=48  Score=17.26  Aligned_cols=12  Identities=33%  Similarity=0.689  Sum_probs=8.7

Q ss_pred             eeecCccccccc
Q psy6273          62 LFSCPLCGEVFR   73 (82)
Q Consensus        62 ~~~C~~C~~~f~   73 (82)
                      .|.|+.||....
T Consensus        29 sf~C~~CGyk~~   40 (160)
T smart00709       29 SFECEHCGYRNN   40 (160)
T ss_pred             EEECCCCCCccc
Confidence            578888886554


No 306
>KOG2747|consensus
Probab=23.00  E-value=57  Score=19.83  Aligned_cols=26  Identities=31%  Similarity=0.779  Sum_probs=21.9

Q ss_pred             CccccccchhhhcCcHHHHHHHHHhc
Q psy6273          31 KSFACDQCVSYFKTNSALLQHKRKMH   56 (82)
Q Consensus        31 ~~~~c~~c~~~~~~~~~l~~h~~~~~   56 (82)
                      .-|.|..|-+.+.+...|++|+....
T Consensus       157 ~lYiCEfCLkY~~s~~~l~rH~~kC~  182 (396)
T KOG2747|consen  157 KLYICEFCLKYMKSRTSLQRHLKKCK  182 (396)
T ss_pred             eEEEehHHHhHhchHHHHHHHHHhcC
Confidence            35789999999999999999997643


No 307
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=22.92  E-value=46  Score=17.40  Aligned_cols=12  Identities=25%  Similarity=0.592  Sum_probs=8.5

Q ss_pred             eeecCccccccc
Q psy6273          62 LFSCPLCGEVFR   73 (82)
Q Consensus        62 ~~~C~~C~~~f~   73 (82)
                      .|.|+.||....
T Consensus        28 sf~C~~CGyr~~   39 (163)
T TIGR00340        28 TYICEKCGYRST   39 (163)
T ss_pred             EEECCCCCCchh
Confidence            578888886554


No 308
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=22.59  E-value=85  Score=13.54  Aligned_cols=15  Identities=13%  Similarity=0.481  Sum_probs=9.5

Q ss_pred             CCcccCcCCccccCH
Q psy6273           2 TRYKCHACDVETKTR   16 (82)
Q Consensus         2 k~~~c~~c~~~~~~~   16 (82)
                      -|..|-.||+....+
T Consensus         3 iPVRCFTCGkvi~~~   17 (60)
T PF01194_consen    3 IPVRCFTCGKVIGNK   17 (60)
T ss_dssp             -SSS-STTTSBTCGH
T ss_pred             CceecCCCCCChhHh
Confidence            366788888877655


No 309
>smart00507 HNHc HNH nucleases.
Probab=22.58  E-value=40  Score=12.71  Aligned_cols=10  Identities=30%  Similarity=0.693  Sum_probs=4.6

Q ss_pred             eecCcccccc
Q psy6273          63 FSCPLCGEVF   72 (82)
Q Consensus        63 ~~C~~C~~~f   72 (82)
                      +.|..|+..+
T Consensus        11 ~~C~~C~~~~   20 (52)
T smart00507       11 GVCAYCGKPA   20 (52)
T ss_pred             CCCcCCcCCC
Confidence            3455555433


No 310
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=22.55  E-value=42  Score=17.44  Aligned_cols=12  Identities=33%  Similarity=0.697  Sum_probs=6.0

Q ss_pred             eeecCccccccc
Q psy6273          62 LFSCPLCGEVFR   73 (82)
Q Consensus        62 ~~~C~~C~~~f~   73 (82)
                      .|.|+.||..+.
T Consensus        30 sf~C~~CGyk~~   41 (161)
T PF03367_consen   30 SFECEHCGYKNN   41 (161)
T ss_dssp             EEE-TTT--EEE
T ss_pred             EeECCCCCCEee
Confidence            578888886543


No 311
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=22.41  E-value=39  Score=13.77  Aligned_cols=13  Identities=38%  Similarity=0.956  Sum_probs=9.5

Q ss_pred             eecCcccccccCc
Q psy6273          63 FSCPLCGEVFRSH   75 (82)
Q Consensus        63 ~~C~~C~~~f~~~   75 (82)
                      ..|+.|+..|-..
T Consensus        41 ~~C~~C~~~fC~~   53 (64)
T PF01485_consen   41 VTCPSCGTEFCFK   53 (64)
T ss_dssp             CCTTSCCSEECSS
T ss_pred             eECCCCCCcCccc
Confidence            7888888777543


No 312
>PF12230 PRP21_like_P:  Pre-mRNA splicing factor PRP21 like protein;  InterPro: IPR022030  This domain family is found in eukaryotes, and is typically between 212 and 238 amino acids in length. The family is found in association with PF01805 from PFAM. There are two completely conserved residues (W and H) that may be functionally important. PRP21 is required for assembly of the prespliceosome and it interacts with U2 snRNP and/or pre-mRNA in the prespliceosome. This family also contains proteins similar to PRP21, such as the mammalian SF3a. SF3a also interacts with U2 snRNP from the prespliceosome, converting it to its active form. ; PDB: 4DGW_B.
Probab=22.38  E-value=29  Score=18.92  Aligned_cols=27  Identities=15%  Similarity=0.139  Sum_probs=0.0

Q ss_pred             CccccccchhhhcCcHHHHHHHHHhcCC
Q psy6273          31 KSFACDQCVSYFKTNSALLQHKRKMHDE   58 (82)
Q Consensus        31 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~   58 (82)
                      .-..|+.||..... +-+..||+....+
T Consensus       167 ~~~~cPitGe~IP~-~e~~eHmRi~LlD  193 (229)
T PF12230_consen  167 KMIICPITGEMIPA-DEMDEHMRIELLD  193 (229)
T ss_dssp             ----------------------------
T ss_pred             cccccccccccccc-ccccccccccccc
Confidence            44678888876543 4567888877655


No 313
>PF06353 DUF1062:  Protein of unknown function (DUF1062);  InterPro: IPR009412 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=22.37  E-value=39  Score=17.26  Aligned_cols=11  Identities=36%  Similarity=1.038  Sum_probs=7.9

Q ss_pred             cccCcCCcccc
Q psy6273           4 YKCHACDVETK   14 (82)
Q Consensus         4 ~~c~~c~~~~~   14 (82)
                      |.|..|+.++.
T Consensus        14 YrC~~C~~TwN   24 (142)
T PF06353_consen   14 YRCEKCDYTWN   24 (142)
T ss_pred             EEcccCcCccc
Confidence            67888887654


No 314
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=22.25  E-value=33  Score=16.46  Aligned_cols=13  Identities=23%  Similarity=0.644  Sum_probs=8.6

Q ss_pred             CcccCcCCccccC
Q psy6273           3 RYKCHACDVETKT   15 (82)
Q Consensus         3 ~~~c~~c~~~~~~   15 (82)
                      .|+|..||+.+..
T Consensus         2 kWkC~iCg~~I~~   14 (101)
T PF09943_consen    2 KWKCYICGKPIYE   14 (101)
T ss_pred             ceEEEecCCeeee
Confidence            4678888875443


No 315
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=21.85  E-value=67  Score=13.51  Aligned_cols=15  Identities=40%  Similarity=0.658  Sum_probs=11.0

Q ss_pred             CeeecCcccccccCc
Q psy6273          61 NLFSCPLCGEVFRSH   75 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~   75 (82)
                      ..|.|..|+..+-..
T Consensus        10 ~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen   10 NLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SEEEETTTS-EEETT
T ss_pred             ceEEeCCCCcccccC
Confidence            689999998877654


No 316
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=21.77  E-value=46  Score=13.31  Aligned_cols=12  Identities=25%  Similarity=0.767  Sum_probs=8.1

Q ss_pred             eecCcccccccC
Q psy6273          63 FSCPLCGEVFRS   74 (82)
Q Consensus        63 ~~C~~C~~~f~~   74 (82)
                      ..|..||..+..
T Consensus         6 l~C~~CG~~m~~   17 (58)
T PF13408_consen    6 LRCGHCGSKMTR   17 (58)
T ss_pred             EEcccCCcEeEE
Confidence            568888876543


No 317
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=21.70  E-value=52  Score=17.75  Aligned_cols=14  Identities=29%  Similarity=0.477  Sum_probs=9.6

Q ss_pred             CCcccCcCCccccC
Q psy6273           2 TRYKCHACDVETKT   15 (82)
Q Consensus         2 k~~~c~~c~~~~~~   15 (82)
                      ++-+|.+|+..|..
T Consensus         5 k~rKCKvCg~~F~P   18 (189)
T PF05766_consen    5 KRRKCKVCGEWFVP   18 (189)
T ss_pred             CCCcCcccCCcccc
Confidence            34568888877764


No 318
>PHA02998 RNA polymerase subunit; Provisional
Probab=21.70  E-value=54  Score=17.62  Aligned_cols=38  Identities=18%  Similarity=0.367  Sum_probs=20.4

Q ss_pred             ccccccchhhhcCcHHHHHHHHHhcCC-C-CCeeecCccccccc
Q psy6273          32 SFACDQCVSYFKTNSALLQHKRKMHDE-F-VNLFSCPLCGEVFR   73 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h~~~~~~~-~-~~~~~C~~C~~~f~   73 (82)
                      ...|+.|+..-.....+    ++..++ . ..-|.|..||..|.
T Consensus       143 ~v~CPkCg~~~A~f~ql----QTRSADEPmT~FYkC~~CG~~wk  182 (195)
T PHA02998        143 NTPCPNCKSKNTTPMMI----QTRAADEPPLVRHACRDCKKHFK  182 (195)
T ss_pred             CCCCCCCCCCceEEEEE----eeccCCCCceEEEEcCCCCCccC
Confidence            35788887532222211    233332 0 13489999998764


No 319
>KOG3456|consensus
Probab=21.64  E-value=42  Score=16.33  Aligned_cols=14  Identities=29%  Similarity=0.586  Sum_probs=10.9

Q ss_pred             CeeecCcccccccC
Q psy6273          61 NLFSCPLCGEVFRS   74 (82)
Q Consensus        61 ~~~~C~~C~~~f~~   74 (82)
                      .+..|.+||-.|.+
T Consensus       103 ~~~~CgYCGlrf~~  116 (120)
T KOG3456|consen  103 GPHICGYCGLRFVQ  116 (120)
T ss_pred             CCcccccchhhhhh
Confidence            45788899988875


No 320
>COG5246 PRP11 Splicing factor 3a, subunit 2 [RNA processing and modification]
Probab=21.51  E-value=33  Score=18.44  Aligned_cols=21  Identities=19%  Similarity=0.534  Sum_probs=13.5

Q ss_pred             cccccchhhhcCcHHHHHHHH
Q psy6273          33 FACDQCVSYFKTNSALLQHKR   53 (82)
Q Consensus        33 ~~c~~c~~~~~~~~~l~~h~~   53 (82)
                      +.|..|...-.+..++..|..
T Consensus        54 ~vC~LC~T~H~~e~Sy~~H~~   74 (222)
T COG5246          54 YVCLLCKTKHLTEMSYVKHRE   74 (222)
T ss_pred             EEeeeeccccccHHHHHHhhc
Confidence            677777766666666665553


No 321
>PF12591 DUF3762:  Protein of unknown function (DUF3762);  InterPro: IPR022239  This domain family is found in viruses, and is approximately 80 amino acids in length. The family is found in association with PF05533 from PFAM. 
Probab=21.43  E-value=43  Score=14.82  Aligned_cols=10  Identities=50%  Similarity=0.860  Sum_probs=6.8

Q ss_pred             CcccccccCc
Q psy6273          66 PLCGEVFRSH   75 (82)
Q Consensus        66 ~~C~~~f~~~   75 (82)
                      ..||+.|.+.
T Consensus        70 rkcgrvfps~   79 (80)
T PF12591_consen   70 RKCGRVFPSG   79 (80)
T ss_pred             ccccccCCCC
Confidence            3578888764


No 322
>PRK05580 primosome assembly protein PriA; Validated
Probab=21.40  E-value=21  Score=22.96  Aligned_cols=11  Identities=36%  Similarity=0.619  Sum_probs=5.7

Q ss_pred             CCccccccchh
Q psy6273          30 TKSFACDQCVS   40 (82)
Q Consensus        30 ~~~~~c~~c~~   40 (82)
                      ..+..|+.|+.
T Consensus       419 ~~~~~Cp~Cg~  429 (679)
T PRK05580        419 PIPKACPECGS  429 (679)
T ss_pred             CCCCCCCCCcC
Confidence            33455666644


No 323
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=21.02  E-value=51  Score=12.37  Aligned_cols=16  Identities=13%  Similarity=0.534  Sum_probs=8.3

Q ss_pred             CeeecCcccccccCcc
Q psy6273          61 NLFSCPLCGEVFRSHQ   76 (82)
Q Consensus        61 ~~~~C~~C~~~f~~~~   76 (82)
                      ..-.|..|++.+....
T Consensus         5 ~~~~C~~C~~~~~~~~   20 (43)
T PF06467_consen    5 KMKTCSYCKKYIPNKP   20 (43)
T ss_dssp             SCEE-TTT--EEECCC
T ss_pred             cCCcCcccCCcccCCC
Confidence            3467888887776544


No 324
>PRK00019 rpmE 50S ribosomal protein L31; Reviewed
Probab=20.92  E-value=46  Score=14.85  Aligned_cols=15  Identities=33%  Similarity=0.959  Sum_probs=9.3

Q ss_pred             eeecCcccccccCccc
Q psy6273          62 LFSCPLCGEVFRSHQG   77 (82)
Q Consensus        62 ~~~C~~C~~~f~~~~~   77 (82)
                      .+.|. ||..|...+.
T Consensus        13 ~~~c~-~g~~f~~~ST   27 (72)
T PRK00019         13 TVTCS-CGNVFETRST   27 (72)
T ss_pred             EEEEC-CCCEEEEeec
Confidence            45666 7777765554


No 325
>PRK11639 zinc uptake transcriptional repressor; Provisional
Probab=20.58  E-value=51  Score=17.12  Aligned_cols=13  Identities=38%  Similarity=0.907  Sum_probs=10.4

Q ss_pred             eeecCcccccccC
Q psy6273          62 LFSCPLCGEVFRS   74 (82)
Q Consensus        62 ~~~C~~C~~~f~~   74 (82)
                      .+.|..||+.+.-
T Consensus       100 H~iC~~CGki~~i  112 (169)
T PRK11639        100 MFICDRCGAVKEE  112 (169)
T ss_pred             eEEeCCCCCEEEe
Confidence            4899999998753


No 326
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=20.27  E-value=34  Score=17.52  Aligned_cols=10  Identities=20%  Similarity=0.793  Sum_probs=6.6

Q ss_pred             ccccccchhh
Q psy6273          32 SFACDQCVSY   41 (82)
Q Consensus        32 ~~~c~~c~~~   41 (82)
                      .+.|..|+..
T Consensus       112 ~l~C~~Cg~~  121 (146)
T PF07295_consen  112 TLVCENCGHE  121 (146)
T ss_pred             eEecccCCCE
Confidence            4677777754


No 327
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=20.17  E-value=59  Score=17.53  Aligned_cols=12  Identities=25%  Similarity=0.387  Sum_probs=8.6

Q ss_pred             eeecCccccccc
Q psy6273          62 LFSCPLCGEVFR   73 (82)
Q Consensus        62 ~~~C~~C~~~f~   73 (82)
                      .|.|+.||....
T Consensus        30 sf~C~~CGyr~~   41 (192)
T TIGR00310        30 STICEHCGYRSN   41 (192)
T ss_pred             EEECCCCCCccc
Confidence            578888886544


No 328
>TIGR00240 ATCase_reg aspartate carbamoyltransferase, regulatory subunit. The presence of this regulatory subunit allows feedback inhibition by CTP on aspartate carbamoyltransferase, the first step in the synthesis of CTP from aspartate. In many species, this regulatory subunit is not present. In Thermotoga maritima, the catalytic and regulatory subunits are encoded by a fused gene and the regulatory region has enough sequence differences to score below the trusted cutoff.
Probab=20.12  E-value=44  Score=17.31  Aligned_cols=14  Identities=14%  Similarity=0.510  Sum_probs=11.3

Q ss_pred             eeecCcccccccCc
Q psy6273          62 LFSCPLCGEVFRSH   75 (82)
Q Consensus        62 ~~~C~~C~~~f~~~   75 (82)
                      .+.|.+|++.|...
T Consensus       132 ~lrC~YCe~~~~~~  145 (150)
T TIGR00240       132 ALRCYYCEKEIEHN  145 (150)
T ss_pred             EEEEECCCCEEecc
Confidence            59999999988643


No 329
>KOG2807|consensus
Probab=20.06  E-value=96  Score=18.53  Aligned_cols=20  Identities=15%  Similarity=0.388  Sum_probs=11.1

Q ss_pred             ccccccchhhhcCcHHHHHH
Q psy6273          32 SFACDQCVSYFKTNSALLQH   51 (82)
Q Consensus        32 ~~~c~~c~~~~~~~~~l~~h   51 (82)
                      |.+|+.|+-......+|.+.
T Consensus       290 P~eCpiC~ltLVss~hLARS  309 (378)
T KOG2807|consen  290 PIECPICSLTLVSSPHLARS  309 (378)
T ss_pred             CccCCccceeEecchHHHHH
Confidence            45666666555555555543


Done!