Query         psy6282
Match_columns 251
No_of_seqs    193 out of 1665
Neff          8.4 
Searched_HMMs 46136
Date          Fri Aug 16 22:27:25 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy6282.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/6282hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1315|consensus              100.0 3.9E-54 8.4E-59  370.5  13.0  213    1-225    68-283 (307)
  2 KOG1311|consensus              100.0 6.8E-45 1.5E-49  318.7  11.1  179   42-222   103-292 (299)
  3 KOG1314|consensus              100.0 1.1E-44 2.3E-49  308.4   6.7  207    1-245    70-308 (414)
  4 PF01529 zf-DHHC:  DHHC palmito 100.0 6.7E-41 1.5E-45  271.4   8.5  128   46-173    42-173 (174)
  5 KOG1313|consensus              100.0 7.2E-41 1.6E-45  276.9   6.8  175   48-222    98-304 (309)
  6 COG5273 Uncharacterized protei 100.0 6.2E-38 1.3E-42  273.5   9.3  180   45-224   102-304 (309)
  7 KOG0509|consensus              100.0   2E-29 4.2E-34  230.2   5.2  140   53-200   421-585 (600)
  8 KOG1312|consensus              100.0 1.8E-29 3.9E-34  210.3   2.3   62   53-114   149-210 (341)
  9 PF01529 zf-DHHC:  DHHC palmito  95.1    0.14   3E-06   40.9   7.9   52   49-111    59-110 (174)
 10 KOG1311|consensus               94.1     0.1 2.2E-06   45.7   5.4   50   65-114   112-172 (299)
 11 PF13240 zinc_ribbon_2:  zinc-r  90.6    0.15 3.3E-06   26.8   1.2   21   54-74      1-21  (23)
 12 COG5273 Uncharacterized protei  89.1     1.5 3.3E-05   38.7   6.9   46   51-107   122-167 (309)
 13 PRK04136 rpl40e 50S ribosomal   86.3    0.46 9.9E-06   29.6   1.4   27   52-78     14-40  (48)
 14 PF13248 zf-ribbon_3:  zinc-rib  85.4     0.5 1.1E-05   25.5   1.2   22   53-74      3-24  (26)
 15 KOG1315|consensus               83.2       4 8.6E-05   36.0   6.4   45   51-106   122-166 (307)
 16 PF06906 DUF1272:  Protein of u  77.3     1.1 2.3E-05   28.9   0.7   36   54-92      7-50  (57)
 17 PTZ00303 phosphatidylinositol   76.4     1.8 3.9E-05   42.5   2.2   22   53-74    461-489 (1374)
 18 PF12773 DZR:  Double zinc ribb  74.5     3.7 8.1E-05   25.5   2.7   34   52-85     12-48  (50)
 19 KOG0509|consensus               71.6     1.1 2.4E-05   42.6  -0.4   55   52-107   325-379 (600)
 20 PF10571 UPF0547:  Uncharacteri  69.8     3.1 6.7E-05   22.5   1.3   22   53-74      1-22  (26)
 21 PF12773 DZR:  Double zinc ribb  68.8     4.1 8.8E-05   25.3   1.9   24   50-73     27-50  (50)
 22 PF01363 FYVE:  FYVE zinc finge  66.8       2 4.4E-05   28.7   0.2   26   52-77      9-36  (69)
 23 PF01020 Ribosomal_L40e:  Ribos  64.2       4 8.6E-05   25.9   1.1   25   51-75     16-42  (52)
 24 smart00064 FYVE Protein presen  58.1     8.3 0.00018   25.5   2.0   26   52-77     10-37  (68)
 25 PF00641 zf-RanBP:  Zn-finger i  57.1     4.2 9.1E-05   22.4   0.3   21   54-74      6-26  (30)
 26 PF07649 C1_3:  C1-like domain;  54.3     3.8 8.3E-05   22.6  -0.2   21   54-74      2-23  (30)
 27 COG1552 RPL40A Ribosomal prote  53.9     3.5 7.5E-05   25.8  -0.4   27   52-78     14-40  (50)
 28 KOG1842|consensus               53.5     5.1 0.00011   36.8   0.4   27   51-77    179-207 (505)
 29 KOG1314|consensus               49.4     6.5 0.00014   35.1   0.4   46   51-107   104-149 (414)
 30 PF07282 OrfB_Zn_ribbon:  Putat  49.0     9.5 0.00021   25.3   1.1   35   41-75     17-55  (69)
 31 PF03107 C1_2:  C1 domain;  Int  49.0      11 0.00024   20.8   1.2   20   54-73      2-22  (30)
 32 PHA02680 ORF090 IMV phosphoryl  41.9 1.2E+02  0.0027   21.4   6.2   25  149-173    59-83  (91)
 33 PRK03681 hypA hydrogenase nick  41.5      14 0.00031   27.5   1.2   24   51-74     69-95  (114)
 34 COG4640 Predicted membrane pro  40.6      15 0.00032   33.4   1.3   26   52-77      1-26  (465)
 35 smart00661 RPOL9 RNA polymeras  40.4      14 0.00031   22.8   0.9   21   53-73      1-27  (52)
 36 COG2093 DNA-directed RNA polym  40.3      16 0.00035   24.1   1.1   24   52-75      4-27  (64)
 37 cd00065 FYVE FYVE domain; Zinc  40.2      20 0.00043   22.6   1.5   23   54-76      4-28  (57)
 38 PF09788 Tmemb_55A:  Transmembr  39.2 1.4E+02  0.0031   25.6   6.8   23   90-112   189-212 (256)
 39 KOG3183|consensus               38.7      15 0.00033   31.0   1.0   12   76-87     38-49  (250)
 40 PF02150 RNA_POL_M_15KD:  RNA p  36.6      11 0.00024   21.8  -0.1    7   53-59      2-8   (35)
 41 PF03842 Silic_transp:  Silicon  36.5 1.4E+02  0.0031   27.6   6.7   26   96-121   171-196 (512)
 42 PF00751 DM:  DM DNA binding do  36.3      13 0.00028   23.2   0.1   22   66-87      2-28  (47)
 43 PRK13130 H/ACA RNA-protein com  35.7      24 0.00052   22.9   1.3   22   51-74      4-25  (56)
 44 PRK14559 putative protein seri  34.9      27 0.00059   34.2   2.2   39   52-92     15-53  (645)
 45 PF07754 DUF1610:  Domain of un  34.1      28  0.0006   18.4   1.2   19   55-73      1-23  (24)
 46 PF09889 DUF2116:  Uncharacteri  33.9      27 0.00059   22.9   1.4   23   52-74      3-26  (59)
 47 KOG4017|consensus               33.8      19  0.0004   30.6   0.8   35   50-84    101-139 (274)
 48 KOG2927|consensus               33.1      62  0.0013   29.1   3.9   32   61-92    156-188 (372)
 49 PF08600 Rsm1:  Rsm1-like;  Int  31.3      27 0.00058   24.9   1.2   10   81-90     56-65  (91)
 50 PRK15103 paraquat-inducible me  30.7   4E+02  0.0088   24.6   9.0   33   51-83    220-252 (419)
 51 PRK14559 putative protein seri  30.0      30 0.00066   33.8   1.6   24   53-76      2-25  (645)
 52 cd00350 rubredoxin_like Rubred  29.9      38 0.00082   19.1   1.4   21   54-74      3-25  (33)
 53 PF00130 C1_1:  Phorbol esters/  29.3      22 0.00048   22.0   0.4   28   50-77      9-39  (53)
 54 smart00423 PSI domain found in  29.0      22 0.00049   21.5   0.4   14   72-85      7-20  (46)
 55 PLN00186 ribosomal protein S26  29.0      23  0.0005   26.1   0.5   14   66-79     20-33  (109)
 56 PRK00432 30S ribosomal protein  28.9      32 0.00069   21.6   1.1   23   52-74     20-45  (50)
 57 KOG3611|consensus               28.8      20 0.00044   35.6   0.3   27   66-92    491-523 (737)
 58 PHA02942 putative transposase;  28.2      33 0.00071   31.3   1.5   34   41-74    314-350 (383)
 59 PF14015 DUF4231:  Protein of u  27.9      73  0.0016   23.0   3.1   25  162-186    79-103 (112)
 60 smart00547 ZnF_RBZ Zinc finger  27.7      33 0.00071   17.9   0.9   21   54-74      4-24  (26)
 61 COG0603 Predicted PP-loop supe  26.7      22 0.00048   29.8   0.1   19   61-79    187-205 (222)
 62 PRK09335 30S ribosomal protein  26.6      27 0.00058   25.2   0.5   19   66-84     20-38  (95)
 63 TIGR00155 pqiA_fam integral me  25.7 5.3E+02   0.011   23.7   9.5   32   52-83    215-247 (403)
 64 PTZ00172 40S ribosomal protein  25.4      28 0.00061   25.6   0.4   14   66-79     20-33  (108)
 65 PRK12380 hydrogenase nickel in  25.1      39 0.00086   25.1   1.2   24   51-74     69-94  (113)
 66 smart00301 DM Doublesex DNA-bi  24.8      44 0.00095   21.5   1.2    6   82-87     23-28  (54)
 67 PF01437 PSI:  Plexin repeat;    24.5      13 0.00028   23.2  -1.4   17   70-86      6-22  (51)
 68 PF00539 Tat:  Transactivating   24.1      45 0.00098   22.5   1.2   13   53-72     30-42  (68)
 69 KOG1819|consensus               23.8      39 0.00084   31.8   1.1   22   53-74    902-925 (990)
 70 PF03461 TRCF:  TRCF domain;  I  23.4      98  0.0021   22.3   3.0   34    4-37      5-42  (101)
 71 PRK12286 rpmF 50S ribosomal pr  22.7      49  0.0011   21.4   1.1   20   52-73     27-47  (57)
 72 KOG1729|consensus               22.5      27 0.00058   30.6  -0.2   25   52-76    168-195 (288)
 73 cd01995 ExsB ExsB is a transcr  22.5      27 0.00058   27.4  -0.2   23   54-79    142-164 (169)
 74 PRK00564 hypA hydrogenase nick  22.3      50  0.0011   24.7   1.3   25   50-74     69-96  (117)
 75 TIGR02487 NrdD anaerobic ribon  22.3 1.4E+02   0.003   28.9   4.6   59   26-92    499-558 (579)
 76 TIGR00100 hypA hydrogenase nic  22.2      49  0.0011   24.6   1.2   24   51-74     69-94  (115)
 77 COG5270 PUA domain (predicted   21.7      46   0.001   27.1   1.0   22   51-74     13-34  (202)
 78 TIGR00364 exsB protein. This p  21.6      46   0.001   27.0   1.1   13   66-78    189-201 (201)
 79 PF09297 zf-NADH-PPase:  NADH p  21.5      39 0.00085   18.8   0.4   22   52-73      3-28  (32)
 80 TIGR00811 sit silicon transpor  20.3 4.7E+02    0.01   24.7   7.2   13  156-168   239-251 (545)
 81 COG2248 Predicted hydrolase (m  20.2      91   0.002   27.0   2.5   17    2-18     29-47  (304)
 82 smart00109 C1 Protein kinase C  20.1      66  0.0014   19.0   1.3   26   51-76     10-37  (49)

No 1  
>KOG1315|consensus
Probab=100.00  E-value=3.9e-54  Score=370.46  Aligned_cols=213  Identities=47%  Similarity=0.920  Sum_probs=183.0

Q ss_pred             CCCCCCCCCCCCCChhhhhhhccCCChHHHHHHHHHhhccCCcccccCCCCcccCcccccccCCCCCCCCccCccccCCc
Q psy6282           1 MTPLGTAPKHFKLSPSLQHALFTTDNDVERKQILEQFSASLPVLNKSIDGGTRFCDKCYQVKADRSHHCSVCGKCVLKMD   80 (251)
Q Consensus         1 ~~dPG~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~D   80 (251)
                      |||||.+|..|.|+.++.+...+....+          +.+++...++++..|||.+|+.+||+||||||+|++||+|||
T Consensus        68 f~~pg~vp~~~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~g~~R~C~kC~~iKPdRaHHCsvC~rCvLKmD  137 (307)
T KOG1315|consen   68 FTDPGRVPDSYRPSVEDEDSLENGSDNE----------RDLPGYTRTSDGAVRYCDKCKCIKPDRAHHCSVCNRCVLKMD  137 (307)
T ss_pred             EecCCCCccccCCCcCccccccccCccc----------ccceeeEecCCCCceeecccccccCCccccchhhhhhhhccc
Confidence            6899999999999999876554443333          466777888999999999999999999999999999999999


Q ss_pred             ccCcccccccchhhHHHHHHHHhHHHHHHHHhcccchhhhhhhhccccc--cCCchhhHHHHHHHHHHHHHHHHHHHHHH
Q psy6282          81 HHCPWVNNCVSFTNYKYFLLFLGYALLYCIYGSLSTLPYFIQFWEGSFV--HSGKFHILFLCFVAAMFSLSLVALFGYHL  158 (251)
Q Consensus        81 HHC~wl~nCIG~~N~r~Filfl~~~~i~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~l~~~h~  158 (251)
                      |||||+|||||.+|||+|++||+|+.+++++.+++.+..+...+.....  ....+.++++.++++.+++.++.|+++|+
T Consensus       138 HHCpWi~nCVgf~NyKfF~lfl~y~~l~~~~~lv~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~i~l~~~l~~h~  217 (307)
T KOG1315|consen  138 HHCPWINNCVGFRNYKFFLLFLFYTNLYSIYVLVTTLIGFTKYFQGGAGPSSLLLFFIVFLFLVAIAFSISLSGLLCFHT  217 (307)
T ss_pred             cCCcceeceecccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999888888777766632111  11345566777788888888888999999


Q ss_pred             HHhccCceeeccccCCCcccC-CCCCCCChHHHHHHHHhcCCCCCceeeccccCCCCCceecCcCCCc
Q psy6282         159 YLVAQNKTTLEAIRPPVFSYG-PDKQGYNLGCKRNFIEIFGENKLLWFFPVHTHLGDGIRFPVRGSNV  225 (251)
Q Consensus       159 ~li~~n~TtiE~~~~~~~~~~-~~~npyd~G~~~Nl~~vfG~~~~~Wl~P~~~~~~dG~~~~~~~~~~  225 (251)
                      +||.+|+||+|..+.+.++.+ ..++.+++  ..|++++||.++..|++|..++.+||.+++.+.+..
T Consensus       218 ~Li~~N~TTiE~~~~~~~~~~~~~~~~~~~--~~n~~~vfg~~~~~wl~P~~~s~~~~~~~~~~~~~~  283 (307)
T KOG1315|consen  218 YLILKNKTTIEAYKSPVFRSGLHNKNGFNL--YVNFREVFGSNLLYWLLPIDSSWGDGVSFPLRGDGL  283 (307)
T ss_pred             HHHHcCchhHhhhccccccccccccCCcce--eecHHHHhCCCceEEeccccCccccCccccccccCC
Confidence            999999999999998766643 67788887  899999999999999999999999999999988843


No 2  
>KOG1311|consensus
Probab=100.00  E-value=6.8e-45  Score=318.66  Aligned_cols=179  Identities=34%  Similarity=0.638  Sum_probs=137.9

Q ss_pred             CcccccCCCCcccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHHHHHHhcccchhhhh
Q psy6282          42 PVLNKSIDGGTRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALLYCIYGSLSTLPYFI  121 (251)
Q Consensus        42 ~~~~~~~~~~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i~~~~~~~~~~~~~~  121 (251)
                      ...+.+...+++||.+|+.+||+|||||++||+||+||||||+|+|||||++|||+|+.|++++.+++++.++..+..+.
T Consensus       103 ~~~~~~~~~~~~~C~~C~~~rPpRs~HCsvC~~CV~rfDHHC~WvnnCVG~rNyr~F~~f~~~~~l~~i~~~~~~~~~~~  182 (299)
T KOG1311|consen  103 NVDVNGIQVEWKYCDTCQLYRPPRSSHCSVCNNCVLRFDHHCPWLNNCIGERNYRYFVLFLFYLALGVLLALAFLFYELL  182 (299)
T ss_pred             CcccCCcccceEEcCcCcccCCCCcccchhhcccccccCCCCCCccceECCCchHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34456777889999999999999999999999999999999999999999999999999999999999888776665544


Q ss_pred             hhhcccc---c----cCCchhhHHHHHHHHHHHHHHHHHHHHHHHHhccCceeeccccCCCcccCCCCCCCChHHHHHHH
Q psy6282         122 QFWEGSF---V----HSGKFHILFLCFVAAMFSLSLVALFGYHLYLVAQNKTTLEAIRPPVFSYGPDKQGYNLGCKRNFI  194 (251)
Q Consensus       122 ~~~~~~~---~----~~~~~~~~~~~~~~~~~~~~~~~l~~~h~~li~~n~TtiE~~~~~~~~~~~~~npyd~G~~~Nl~  194 (251)
                      .......   .    .......+++.++++++.+.++.|+.+|++++.+|+||+|.++.  .+.....++||.|.++|++
T Consensus       183 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~fh~~li~~~~Tt~e~~~~--~~~~~~~~~~~~g~~~n~~  260 (299)
T KOG1311|consen  183 QRADNLKVNLTPVLIPAGTFLSALLGLLSALFLAFTSALLCFHIYLIKSGSTTYESIKS--LDFVSRSNPYDLGLLKNLQ  260 (299)
T ss_pred             HhcccccccccccccchhHHHHHHHHHHHHHHHHHHHHHHHhheeeEecCcchhhhhhc--cccccccCCCchhHHHHHH
Confidence            3222111   1    11122233445566666777778999999999999999999886  2222335899999999999


Q ss_pred             HhcCCCCCc-eeeccccC---CCCCceecCcC
Q psy6282         195 EIFGENKLL-WFFPVHTH---LGDGIRFPVRG  222 (251)
Q Consensus       195 ~vfG~~~~~-Wl~P~~~~---~~dG~~~~~~~  222 (251)
                      ++||.+... |+.|...+   +.||..++...
T Consensus       261 ~~~~~~~~~~~~~p~~~~~~~p~~~~~~~~~~  292 (299)
T KOG1311|consen  261 EVFGGPLPLSWLSPFARSGPLPHDGEGGPPTP  292 (299)
T ss_pred             HHhCCCCCcccccccccCCCCCCCCCCCCccc
Confidence            999987655 99887743   46666555443


No 3  
>KOG1314|consensus
Probab=100.00  E-value=1.1e-44  Score=308.38  Aligned_cols=207  Identities=33%  Similarity=0.545  Sum_probs=150.5

Q ss_pred             CCCCCCCCCCCCCChhhhhhhccCCChHHHHHHHHHhhccCCcccccCCCCcccCcccccccCCCCCCCCccCccccCCc
Q psy6282           1 MTPLGTAPKHFKLSPSLQHALFTTDNDVERKQILEQFSASLPVLNKSIDGGTRFCDKCYQVKADRSHHCSVCGKCVLKMD   80 (251)
Q Consensus         1 ~~dPG~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~D   80 (251)
                      |+.||++|++|+|+.+.-++                              -..||.+|+.||+||||||+.|||||.+||
T Consensus        70 ~~gPG~vp~~wkPe~~~D~~------------------------------~lqfCk~CqgYKapRSHHCrkCnrCvmkMD  119 (414)
T KOG1314|consen   70 FTGPGFVPLGWKPENPKDEM------------------------------FLQFCKKCQGYKAPRSHHCRKCNRCVMKMD  119 (414)
T ss_pred             hcCCCCCCCCCCCCCChhHH------------------------------HHHHHhhccCcCCCccccchHHHHHHHhhc
Confidence            68899999999996543111                              147999999999999999999999999999


Q ss_pred             ccCcccccccchhhHHHHHHHHhHHHHHHHHhcccchhhh----hhhhc--cccccC--------CchhhHHHHHHHHHH
Q psy6282          81 HHCPWVNNCVSFTNYKYFLLFLGYALLYCIYGSLSTLPYF----IQFWE--GSFVHS--------GKFHILFLCFVAAMF  146 (251)
Q Consensus        81 HHC~wl~nCIG~~N~r~Filfl~~~~i~~~~~~~~~~~~~----~~~~~--~~~~~~--------~~~~~~~~~~~~~~~  146 (251)
                      |||||+|||||..||.+|+.||++..++|+-..+..+..+    +..|.  ......        .....+|.+.+++..
T Consensus       120 HHCPWinnCVG~aNh~~F~~FLlf~ivG~ih~tiI~~~~~~~~Iy~~W~~~~g~~hlp~v~ft~~~li~~vfslgla~gv  199 (414)
T KOG1314|consen  120 HHCPWINNCVGWANHAYFLRFLLFSIVGCIHGTIILVCAQYRGIYFRWYIKYGLRHLPIVFFTLSSLIALVFSLGLAIGV  199 (414)
T ss_pred             cCCcchhhcccccccHHHHHHHHHHHHhcccceeeehhHHHHHHHHHHHhhcccccCceeeccHHHHHHHHHHhHHHHHH
Confidence            9999999999999999999999999998766544333322    22331  111110        111122333445555


Q ss_pred             HHHHHHHHHHHHHHhccCceeeccccCC--C------ccc--CCCCCCCChHHHHHHHHhcCCCCCceeeccccCCCCCc
Q psy6282         147 SLSLVALFGYHLYLVAQNKTTLEAIRPP--V------FSY--GPDKQGYNLGCKRNFIEIFGENKLLWFFPVHTHLGDGI  216 (251)
Q Consensus       147 ~~~~~~l~~~h~~li~~n~TtiE~~~~~--~------~~~--~~~~npyd~G~~~Nl~~vfG~~~~~Wl~P~~~~~~dG~  216 (251)
                      .+++++|++.|+..|.+|+|.||.+--.  .      ...  +....|||+|++.|+++||-...        .+.|||+
T Consensus       200 ~la~t~Lf~~qlk~Il~nrt~IE~wi~~Ka~~rr~~~~~d~~~~f~ypydlgWr~n~r~vf~~~~--------~~~gdg~  271 (414)
T KOG1314|consen  200 VLALTMLFFIQLKQILNNRTGIESWIVEKAMDRREYYFNDDEGEFTYPYDLGWRINLREVFFQNK--------KEEGDGI  271 (414)
T ss_pred             HHHHHHHHHHHHHHHHcCCcchHHHHHHHHHHHHHhhccCCCCceeeeccccccccHHHHhhhcc--------ccCCCCc
Confidence            6677788999999999999999976411  1      112  45678999999899999997652        3679999


Q ss_pred             eecCcCCCcc--------cccccCCCccceeeecccc
Q psy6282         217 RFPVRGSNVN--------QYNSMGNTQGTDLTVNCHI  245 (251)
Q Consensus       217 ~~~~~~~~~~--------~~~~~~~~~~~~~~~~~~~  245 (251)
                      +||+.+...+        ..+...+.|++.+.....+
T Consensus       272 ~wPv~~gc~qytlt~eql~qk~~kr~rsr~~~~~~~~  308 (414)
T KOG1314|consen  272 EWPVVEGCVQYTLTIEQLTQKLDKRGRSRLFKCIEDV  308 (414)
T ss_pred             cccccCcccccceeHHHHHHHHHhhcCeEEEEeccCC
Confidence            9999998654        3445556666666655544


No 4  
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=100.00  E-value=6.7e-41  Score=271.40  Aligned_cols=128  Identities=39%  Similarity=0.834  Sum_probs=103.8

Q ss_pred             ccCCCCcccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHHHHHHhcccchhhhhhhhc
Q psy6282          46 KSIDGGTRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALLYCIYGSLSTLPYFIQFWE  125 (251)
Q Consensus        46 ~~~~~~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i~~~~~~~~~~~~~~~~~~  125 (251)
                      .+.....++|.+|+..||+|||||+.||+||+|+||||+|+|||||++|||+|++|++++.+++++.++..+.++.....
T Consensus        42 ~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~DHHC~w~~~cIG~~N~~~F~~fl~~~~~~~~~~~~~~~~~~~~~~~  121 (174)
T PF01529_consen   42 DDENGELKYCSTCKIIKPPRSHHCRVCNRCVLRFDHHCPWLGNCIGRRNHRYFLLFLLYLCLYCLYFFILSLYYLVRYIP  121 (174)
T ss_pred             cccCCCCEECcccCCcCCCcceeccccccccccccccchhhccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            34566789999999999999999999999999999999999999999999999999999999998887766665554433


Q ss_pred             cccccC-Cchh---hHHHHHHHHHHHHHHHHHHHHHHHHhccCceeeccccC
Q psy6282         126 GSFVHS-GKFH---ILFLCFVAAMFSLSLVALFGYHLYLVAQNKTTLEAIRP  173 (251)
Q Consensus       126 ~~~~~~-~~~~---~~~~~~~~~~~~~~~~~l~~~h~~li~~n~TtiE~~~~  173 (251)
                      ...... ....   .+++++++++++++++.++++|++++++|+||+|.+++
T Consensus       122 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~n~Tt~E~~~~  173 (174)
T PF01529_consen  122 SISFSSFWIFSNFSSIFLLIISIFFFIFVGFLLIFQLYLILRNITTYERIKR  173 (174)
T ss_pred             cccccccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCcHHHHHHc
Confidence            221111 1111   14555666777778888999999999999999999874


No 5  
>KOG1313|consensus
Probab=100.00  E-value=7.2e-41  Score=276.86  Aligned_cols=175  Identities=31%  Similarity=0.557  Sum_probs=131.7

Q ss_pred             CCCCcccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHHHHHHhcccchhhhhhhhcc-
Q psy6282          48 IDGGTRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALLYCIYGSLSTLPYFIQFWEG-  126 (251)
Q Consensus        48 ~~~~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i~~~~~~~~~~~~~~~~~~~-  126 (251)
                      ....-.+|.+|+.+||||+||||+||+||++|||||||+|||||.+|||||++|++|+.+++.|+.+...+.++..... 
T Consensus        98 ~~~~~SfC~KC~~pK~prTHHCsiC~kCVL~MDHHCPwinnCVG~~NHryFFlFl~~ltlat~~~~i~~~~~w~~~le~~  177 (309)
T KOG1313|consen   98 GLENDSFCNKCNYPKSPRTHHCSICNKCVLKMDHHCPWINNCVGAHNHRYFFLFLFYLTLATSYAAIMCVYTWIDHLEPI  177 (309)
T ss_pred             CCccccHHhhcCCCCCCCcchhhHHhhHhhccccCCchhhcccccccchhHHHHHHHHHHHHHHHHHHHHHHHHHhcchH
Confidence            3445689999999999999999999999999999999999999999999999999999999999776644433321110 


Q ss_pred             -cc-----c-----c----------CCchhhHHHHHHHHHHHHHHHHHHHHHHHHhccCceeeccccCCC----cccCCC
Q psy6282         127 -SF-----V-----H----------SGKFHILFLCFVAAMFSLSLVALFGYHLYLVAQNKTTLEAIRPPV----FSYGPD  181 (251)
Q Consensus       127 -~~-----~-----~----------~~~~~~~~~~~~~~~~~~~~~~l~~~h~~li~~n~TtiE~~~~~~----~~~~~~  181 (251)
                       +.     +     .          .....+..+.++++.+.++++.+..+|.++|.+|.|++|...+..    +.....
T Consensus       178 ~~~tay~~d~~h~~Pp~~i~r~~~~i~~t~~~~~~fls~~~lv~vg~l~~W~~vlI~~G~tsi~~~~~~~e~k~~~a~~R  257 (309)
T KOG1313|consen  178 EEITAYASDVAHVAPPPSILRVYKNITRTSIANLWFLSVRVLVAVGLLTAWHAVLISRGETSIEQLINIKERKRYLAHLR  257 (309)
T ss_pred             hhcccccCcccccCCChhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhheeeehhhhhHHHHHHHHHhHhHHHhcc
Confidence             00     0     0          011123346666777777888899999999999999999875332    222344


Q ss_pred             CCCCChHHHHHHHHhcCCC--CCce---eeccccCC-CCCceecCcC
Q psy6282         182 KQGYNLGCKRNFIEIFGEN--KLLW---FFPVHTHL-GDGIRFPVRG  222 (251)
Q Consensus       182 ~npyd~G~~~Nl~~vfG~~--~~~W---l~P~~~~~-~dG~~~~~~~  222 (251)
                      +||++.|.++||+.++|-.  +..|   ++|....+ +.|.++++++
T Consensus       258 ~~~~n~g~k~nWr~fLg~~~~r~~wk~v~lPt~~~p~~~~~~~~~~d  304 (309)
T KOG1313|consen  258 SNPTNFGGKANWRNFLGLFRGRHFWKTVLLPTIRKPVKYGDSKEKSD  304 (309)
T ss_pred             CCCcccchHHHHHHhhccccCCceeEEEeccccccccccCCcccccc
Confidence            8999999999999999942  2245   67876544 8888887443


No 6  
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only]
Probab=100.00  E-value=6.2e-38  Score=273.49  Aligned_cols=180  Identities=34%  Similarity=0.655  Sum_probs=128.0

Q ss_pred             cccCCCCcccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHHHHHHhcccchhhhhhhh
Q psy6282          45 NKSIDGGTRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALLYCIYGSLSTLPYFIQFW  124 (251)
Q Consensus        45 ~~~~~~~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i~~~~~~~~~~~~~~~~~  124 (251)
                      ..+..+..++|.+|+.+||+|||||+.||+||+||||||+|+|||||.+|||+|++||+++...++++++....++...+
T Consensus       102 ~~~~~~~~~~C~~C~~~KP~RS~HC~~Cn~CV~k~DHHC~Wi~nCVG~~N~r~F~~Fl~~~~~~~~~~~~~~~~~~~~~~  181 (309)
T COG5273         102 DDGKFGTENFCSTCNIYKPPRSHHCSICNRCVLKFDHHCPWINNCVGFRNYRFFYQFLLYTILVALVVLLSTAYYIAGIF  181 (309)
T ss_pred             hcCccccceeccccccccCCCCccchhhcchhhccCccCcccccccCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            34667788999999999999999999999999999999999999999999999999999998888887776665554444


Q ss_pred             ccccc-cCCchhhHHH-HHHHHHHHHHHHHHHHHHHHHhccCceeeccccCCCccc---------------------CCC
Q psy6282         125 EGSFV-HSGKFHILFL-CFVAAMFSLSLVALFGYHLYLVAQNKTTLEAIRPPVFSY---------------------GPD  181 (251)
Q Consensus       125 ~~~~~-~~~~~~~~~~-~~~~~~~~~~~~~l~~~h~~li~~n~TtiE~~~~~~~~~---------------------~~~  181 (251)
                      ...-. ......+++. ...+..+++.+..++.++.+++..|+|++|.....+...                     ...
T Consensus       182 ~~~~~~~~~~~~li~~~~~~~~~~f~~~~~~~~~~~~~~~~~~t~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~  261 (309)
T COG5273         182 SIRHDTSLAICFLIFGCSLLGVVFFIITTLLLLFLIYLILNNLTTIEFIQISRGGSTLEFFPLCRESNLPFTNIFDSSEG  261 (309)
T ss_pred             cccCChHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHhccceecccccchhccCCcCceeccCCCcc
Confidence            32111 1111112221 223333455566778899999999999999775433221                     012


Q ss_pred             CCCCChHHHHHHHHhcCCCCCceeeccccCCCCCceecCcCCC
Q psy6282         182 KQGYNLGCKRNFIEIFGENKLLWFFPVHTHLGDGIRFPVRGSN  224 (251)
Q Consensus       182 ~npyd~G~~~Nl~~vfG~~~~~Wl~P~~~~~~dG~~~~~~~~~  224 (251)
                      ..|++.|.-+|+..++|.+...|+.|......++..++.+++.
T Consensus       262 ~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~  304 (309)
T COG5273         262 ALPLDLGIGQNLSTIKGSNALYWLTPLHTNYCNSYDFSLRSDT  304 (309)
T ss_pred             ccccccCccccceeecCCCceeeccccccCCCCccCcccchhh
Confidence            3466777777888888877777877754433556666655543


No 7  
>KOG0509|consensus
Probab=99.95  E-value=2e-29  Score=230.16  Aligned_cols=140  Identities=31%  Similarity=0.597  Sum_probs=100.1

Q ss_pred             ccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHHHHHHhcccchhhhhhhhccccccCC
Q psy6282          53 RFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALLYCIYGSLSTLPYFIQFWEGSFVHSG  132 (251)
Q Consensus        53 ~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~  132 (251)
                      +||.+|...||.||+||++||+||.||||||||++||||.+|||+|+.|++.+...+.+.++....++...-.   ..  
T Consensus       421 ~FC~~clirKp~rSkhc~vcnrcVarfDHhCPwi~ncVG~kNh~~F~~Fl~~l~~~~~~~l~~~~~y~~~~~~---~~--  495 (600)
T KOG0509|consen  421 RFCLTCLIRKPLRSKHCSVCNRCVARFDHHCPWIGNCVGLKNHRLFVFFLLTLLTVIVFYLYLCLYYIMNLEN---AS--  495 (600)
T ss_pred             cceeeeeeecCCccchhhhhHHHHhccccCCCccccccCccchHHHHHHHHHHHHHHHHHHHHHHHHHhhcch---hH--
Confidence            7999999999999999999999999999999999999999999999999999988887766655544321100   00  


Q ss_pred             chhhHHHHHHHHHHHHH-------------------H-HHHHHHHHHHhccCceeeccccCCCcc-----cCCCCCCCCh
Q psy6282         133 KFHILFLCFVAAMFSLS-------------------L-VALFGYHLYLVAQNKTTLEAIRPPVFS-----YGPDKQGYNL  187 (251)
Q Consensus       133 ~~~~~~~~~~~~~~~~~-------------------~-~~l~~~h~~li~~n~TtiE~~~~~~~~-----~~~~~npyd~  187 (251)
                         .+...++..+..+.                   . ...-..|...++.++||+|.++.++++     .++.++|++.
T Consensus       496 ---~~~~~~l~~~~~~~~~~~~~~~~~~n~~~~~t~~~~~~~~~~~~~~c~~~tt~e~~n~~r~~~~~~~~~~~~~~~s~  572 (600)
T KOG0509|consen  496 ---TIYVGFLIAVQAFRIPKPVTGNLLGNEDLNPTWGSTSTKCQHYNCACLHLTTNEQINVKRYEHLGIKRGPTRSPFSP  572 (600)
T ss_pred             ---HHHHHHHHHHHHHhCCccceeeeeeccccccccccccccccccceeeecccHHHHHHHHHhhccccccCcCCCCCCc
Confidence               11111111111110                   0 011112333578899999999876554     3456789999


Q ss_pred             HHHHHHHHhcCCC
Q psy6282         188 GCKRNFIEIFGEN  200 (251)
Q Consensus       188 G~~~Nl~~vfG~~  200 (251)
                      |+.+|+.+++=.+
T Consensus       573 g~~~Nl~df~~~~  585 (600)
T KOG0509|consen  573 GPIRNLVDFFLCS  585 (600)
T ss_pred             hhhhcchheeecc
Confidence            9999999998543


No 8  
>KOG1312|consensus
Probab=99.95  E-value=1.8e-29  Score=210.30  Aligned_cols=62  Identities=44%  Similarity=0.958  Sum_probs=58.4

Q ss_pred             ccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHHHHHHhcc
Q psy6282          53 RFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALLYCIYGSL  114 (251)
Q Consensus        53 ~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i~~~~~~~  114 (251)
                      ..|+||+..||.||+|||+||+||.|+||||.|+|||||.+|.|||++||++.+.++.++.+
T Consensus       149 ~kCSTCki~KPARSKHCsiCNrCV~rfDHHCiWiNNCIG~~N~ryF~lFLL~~i~l~~yaiv  210 (341)
T KOG1312|consen  149 VKCSTCKIRKPARSKHCSICNRCVHRFDHHCIWINNCIGAWNIRYFLLFLLTLISLATYAIV  210 (341)
T ss_pred             CccccccCCCccccccchHHHHHHHHhccceEeeecccccchHHHHHHHHHHHHHHHHHHHH
Confidence            67999999999999999999999999999999999999999999999999999887777654


No 9  
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=95.07  E-value=0.14  Score=40.91  Aligned_cols=52  Identities=27%  Similarity=0.588  Sum_probs=39.7

Q ss_pred             CCCcccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHHHHHH
Q psy6282          49 DGGTRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALLYCIY  111 (251)
Q Consensus        49 ~~~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i~~~~  111 (251)
                      ..+.++|..|+.--..+-|||..-|.||-+.-|           +.+=.|++++.-..+..++
T Consensus        59 p~Rs~HC~~C~~CV~~~DHHC~w~~~cIG~~N~-----------~~F~~fl~~~~~~~~~~~~  110 (174)
T PF01529_consen   59 PPRSHHCRVCNRCVLRFDHHCPWLGNCIGRRNH-----------RYFLLFLLYLCLYCLYFFI  110 (174)
T ss_pred             CCcceeccccccccccccccchhhccccccccH-----------HHHHHHHHHHHHHHHHHHH
Confidence            345799999999999999999999999998776           5555676666554444443


No 10 
>KOG1311|consensus
Probab=94.08  E-value=0.1  Score=45.75  Aligned_cols=50  Identities=20%  Similarity=0.347  Sum_probs=40.2

Q ss_pred             CCCCCCccCccccCCcccCcccccccchhhH-----------HHHHHHHhHHHHHHHHhcc
Q psy6282          65 RSHHCSVCGKCVLKMDHHCPWVNNCVSFTNY-----------KYFLLFLGYALLYCIYGSL  114 (251)
Q Consensus        65 Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~-----------r~Filfl~~~~i~~~~~~~  114 (251)
                      +.++|..|+.-+..+-|||..-|+||-..-|           |.+-.|+.+++...+..++
T Consensus       112 ~~~~C~~C~~~rPpRs~HCsvC~~CV~rfDHHC~WvnnCVG~rNyr~F~~f~~~~~l~~i~  172 (299)
T KOG1311|consen  112 EWKYCDTCQLYRPPRSSHCSVCNNCVLRFDHHCPWLNNCIGERNYRYFVLFLFYLALGVLL  172 (299)
T ss_pred             ceEEcCcCcccCCCCcccchhhcccccccCCCCCCccceECCCchHHHHHHHHHHHHHHHH
Confidence            4799999999999999999999999998876           6688888666644443333


No 11 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=90.59  E-value=0.15  Score=26.76  Aligned_cols=21  Identities=29%  Similarity=0.855  Sum_probs=18.6

Q ss_pred             cCcccccccCCCCCCCCccCc
Q psy6282          54 FCDKCYQVKADRSHHCSVCGK   74 (251)
Q Consensus        54 ~C~~C~~~kP~Rs~HC~~C~~   74 (251)
                      ||..|+..-++.+..|+.||.
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~   21 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGT   21 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCC
Confidence            689999999999999999985


No 12 
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only]
Probab=89.07  E-value=1.5  Score=38.75  Aligned_cols=46  Identities=24%  Similarity=0.432  Sum_probs=28.6

Q ss_pred             CcccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHH
Q psy6282          51 GTRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALL  107 (251)
Q Consensus        51 ~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i  107 (251)
                      +.+.|..|+.=-...-|||..=|+||-+..|           +=.=.|++++...++
T Consensus       122 RS~HC~~Cn~CV~k~DHHC~Wi~nCVG~~N~-----------r~F~~Fl~~~~~~~~  167 (309)
T COG5273         122 RSHHCSICNRCVLKFDHHCPWINNCVGFRNY-----------RFFYQFLLYTILVAL  167 (309)
T ss_pred             CCccchhhcchhhccCccCcccccccCcchH-----------HHHHHHHHHHHHHHH
Confidence            4566777776666667777777777766544           555566666544333


No 13 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=86.30  E-value=0.46  Score=29.55  Aligned_cols=27  Identities=26%  Similarity=0.645  Sum_probs=23.1

Q ss_pred             cccCcccccccCCCCCCCCccCccccC
Q psy6282          52 TRFCDKCYQVKADRSHHCSVCGKCVLK   78 (251)
Q Consensus        52 ~~~C~~C~~~kP~Rs~HC~~C~~CV~~   78 (251)
                      ...|..|...-|+|+..|+.||.=-+|
T Consensus        14 k~ICrkC~ARnp~~A~~CRKCg~~~LR   40 (48)
T PRK04136         14 KKICMRCNARNPWRATKCRKCGYKNLR   40 (48)
T ss_pred             ccchhcccCCCCccccccccCCCCCcC
Confidence            589999999999999999999864333


No 14 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=85.42  E-value=0.5  Score=25.47  Aligned_cols=22  Identities=27%  Similarity=0.726  Sum_probs=19.1

Q ss_pred             ccCcccccccCCCCCCCCccCc
Q psy6282          53 RFCDKCYQVKADRSHHCSVCGK   74 (251)
Q Consensus        53 ~~C~~C~~~kP~Rs~HC~~C~~   74 (251)
                      ++|..|+..-++-+..|+.||.
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCcccccChhhCC
Confidence            6799999988899999999875


No 15 
>KOG1315|consensus
Probab=83.20  E-value=4  Score=36.02  Aligned_cols=45  Identities=20%  Similarity=0.432  Sum_probs=33.2

Q ss_pred             CcccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHH
Q psy6282          51 GTRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYAL  106 (251)
Q Consensus        51 ~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~  106 (251)
                      +...|+.|+.=--..-|||..-|+||--.++           +=.-.|+.+....+
T Consensus       122 RaHHCsvC~rCvLKmDHHCpWi~nCVgf~Ny-----------KfF~lfl~y~~l~~  166 (307)
T KOG1315|consen  122 RAHHCSVCNRCVLKMDHHCPWINNCVGFRNY-----------KFFLLFLFYTNLYS  166 (307)
T ss_pred             ccccchhhhhhhhccccCCcceeceecccch-----------HHHHHHHHHHHHHH
Confidence            4578888887667778999999999997665           55566666655444


No 16 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=77.31  E-value=1.1  Score=28.89  Aligned_cols=36  Identities=31%  Similarity=0.745  Sum_probs=29.2

Q ss_pred             cCcccccccCCCC-------CCCCccCccccCC-cccCcccccccch
Q psy6282          54 FCDKCYQVKADRS-------HHCSVCGKCVLKM-DHHCPWVNNCVSF   92 (251)
Q Consensus        54 ~C~~C~~~kP~Rs-------~HC~~C~~CV~~~-DHHC~wl~nCIG~   92 (251)
                      -|..|..--|+-+       +-|..|..|+..+ +++||   ||=|.
T Consensus         7 nCE~C~~dLp~~s~~A~ICSfECTFC~~C~e~~l~~~CP---NCgGe   50 (57)
T PF06906_consen    7 NCECCDKDLPPDSPEAYICSFECTFCADCAETMLNGVCP---NCGGE   50 (57)
T ss_pred             CccccCCCCCCCCCcceEEeEeCcccHHHHHHHhcCcCc---CCCCc
Confidence            4778887777766       6799999999999 99999   66664


No 17 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=76.36  E-value=1.8  Score=42.45  Aligned_cols=22  Identities=36%  Similarity=0.862  Sum_probs=18.4

Q ss_pred             ccCcccccccC-------CCCCCCCccCc
Q psy6282          53 RFCDKCYQVKA-------DRSHHCSVCGK   74 (251)
Q Consensus        53 ~~C~~C~~~kP-------~Rs~HC~~C~~   74 (251)
                      ..|..|+..-.       .|-|||+.||+
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGr  489 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGI  489 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCcc
Confidence            67999997764       39999999876


No 18 
>PF12773 DZR:  Double zinc ribbon
Probab=74.49  E-value=3.7  Score=25.47  Aligned_cols=34  Identities=24%  Similarity=0.565  Sum_probs=25.0

Q ss_pred             cccCcccccccC---CCCCCCCccCccccCCcccCcc
Q psy6282          52 TRFCDKCYQVKA---DRSHHCSVCGKCVLKMDHHCPW   85 (251)
Q Consensus        52 ~~~C~~C~~~kP---~Rs~HC~~C~~CV~~~DHHC~w   85 (251)
                      .+||..|...-+   .....|..|+.=+...+.+|+.
T Consensus        12 ~~fC~~CG~~l~~~~~~~~~C~~Cg~~~~~~~~fC~~   48 (50)
T PF12773_consen   12 AKFCPHCGTPLPPPDQSKKICPNCGAENPPNAKFCPN   48 (50)
T ss_pred             ccCChhhcCChhhccCCCCCCcCCcCCCcCCcCccCc
Confidence            578888886666   4466788888877777777764


No 19 
>KOG0509|consensus
Probab=71.58  E-value=1.1  Score=42.58  Aligned_cols=55  Identities=11%  Similarity=-0.111  Sum_probs=47.2

Q ss_pred             cccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHH
Q psy6282          52 TRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALL  107 (251)
Q Consensus        52 ~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i  107 (251)
                      ...|.+|....+-+..++..+-.++..+++||+|+. +|+..|...|.+..+...+
T Consensus       325 ~~~~~~~~~~~~~~~~~~~~~~~~~~~fw~~~~w~~-~i~~~~~~~~~~~~i~~~l  379 (600)
T KOG0509|consen  325 TCLCATRKIVGFLLRPPLLSGFFLSTLFWFYYFWFS-KITPYTLFDFHYCFIISVL  379 (600)
T ss_pred             heeccchhhccccccchhHHHHHHHHHHHHHHhhhe-eccchhhhhhHHHHHHHHH
Confidence            567999999999999999999999999999999999 9999998776554443333


No 20 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=69.80  E-value=3.1  Score=22.45  Aligned_cols=22  Identities=23%  Similarity=0.705  Sum_probs=18.3

Q ss_pred             ccCcccccccCCCCCCCCccCc
Q psy6282          53 RFCDKCYQVKADRSHHCSVCGK   74 (251)
Q Consensus        53 ~~C~~C~~~kP~Rs~HC~~C~~   74 (251)
                      |.|..|...-|.-+.-|..||.
T Consensus         1 K~CP~C~~~V~~~~~~Cp~CG~   22 (26)
T PF10571_consen    1 KTCPECGAEVPESAKFCPHCGY   22 (26)
T ss_pred             CcCCCCcCCchhhcCcCCCCCC
Confidence            4688899888998888888874


No 21 
>PF12773 DZR:  Double zinc ribbon
Probab=68.82  E-value=4.1  Score=25.29  Aligned_cols=24  Identities=21%  Similarity=0.699  Sum_probs=21.3

Q ss_pred             CCcccCcccccccCCCCCCCCccC
Q psy6282          50 GGTRFCDKCYQVKADRSHHCSVCG   73 (251)
Q Consensus        50 ~~~~~C~~C~~~kP~Rs~HC~~C~   73 (251)
                      ....+|..|+...++.+..|..||
T Consensus        27 ~~~~~C~~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen   27 QSKKICPNCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CCCCCCcCCcCCCcCCcCccCccc
Confidence            346899999999999999999986


No 22 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=66.77  E-value=2  Score=28.67  Aligned_cols=26  Identities=35%  Similarity=0.709  Sum_probs=13.2

Q ss_pred             cccCccccc--ccCCCCCCCCccCcccc
Q psy6282          52 TRFCDKCYQ--VKADRSHHCSVCGKCVL   77 (251)
Q Consensus        52 ~~~C~~C~~--~kP~Rs~HC~~C~~CV~   77 (251)
                      ...|..|+.  ---.|-|||+.||+-|=
T Consensus         9 ~~~C~~C~~~F~~~~rrhhCr~CG~~vC   36 (69)
T PF01363_consen    9 ASNCMICGKKFSLFRRRHHCRNCGRVVC   36 (69)
T ss_dssp             -SB-TTT--B-BSSS-EEE-TTT--EEE
T ss_pred             CCcCcCcCCcCCCceeeEccCCCCCEEC
Confidence            467888873  33478999999988553


No 23 
>PF01020 Ribosomal_L40e:  Ribosomal L40e family;  InterPro: IPR001975 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the L40 ribosomal protein from both archaea and eukaryotes. Bovine ribosomal protein L40 has been identified as a secondary RNA binding protein []. L40 is fused to a ubiquitin protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 3IZS_p 3IZR_p 2AYJ_A 4A1B_K 4A19_K 4A18_K 4A1D_K.
Probab=64.18  E-value=4  Score=25.87  Aligned_cols=25  Identities=32%  Similarity=0.848  Sum_probs=17.1

Q ss_pred             CcccCcccccccCCCCCCCCc--cCcc
Q psy6282          51 GTRFCDKCYQVKADRSHHCSV--CGKC   75 (251)
Q Consensus        51 ~~~~C~~C~~~kP~Rs~HC~~--C~~C   75 (251)
                      ....|.+|...-|+|+-.|+.  ||.+
T Consensus        16 ~k~ICrkCyarl~~~A~nCRKkkCGhs   42 (52)
T PF01020_consen   16 DKMICRKCYARLPPRATNCRKKKCGHS   42 (52)
T ss_dssp             S-EEETTT--EE-TTSSS-TSSSCTS-
T ss_pred             cceecccccCcCCCCccceecccCCCC
Confidence            358999999999999999998  8754


No 24 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=57.15  E-value=4.2  Score=22.43  Aligned_cols=21  Identities=24%  Similarity=0.719  Sum_probs=14.8

Q ss_pred             cCcccccccCCCCCCCCccCc
Q psy6282          54 FCDKCYQVKADRSHHCSVCGK   74 (251)
Q Consensus        54 ~C~~C~~~kP~Rs~HC~~C~~   74 (251)
                      .|..|...-+++..+|..|+.
T Consensus         6 ~C~~C~~~N~~~~~~C~~C~~   26 (30)
T PF00641_consen    6 KCPSCTFMNPASRSKCVACGA   26 (30)
T ss_dssp             EETTTTEEEESSSSB-TTT--
T ss_pred             cCCCCcCCchHHhhhhhCcCC
Confidence            478888888888888888863


No 26 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=54.34  E-value=3.8  Score=22.64  Aligned_cols=21  Identities=29%  Similarity=0.502  Sum_probs=9.1

Q ss_pred             cCcccccccCC-CCCCCCccCc
Q psy6282          54 FCDKCYQVKAD-RSHHCSVCGK   74 (251)
Q Consensus        54 ~C~~C~~~kP~-Rs~HC~~C~~   74 (251)
                      .|..|+..... ..++|..|+-
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~Cdf   23 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYRCSECDF   23 (30)
T ss_dssp             --TTTS----S--EEE-TTT--
T ss_pred             cCCcCCCcCCCCceEECccCCC
Confidence            57788776666 7888988874


No 27 
>COG1552 RPL40A Ribosomal protein L40E [Translation, ribosomal structure and biogenesis]
Probab=53.88  E-value=3.5  Score=25.77  Aligned_cols=27  Identities=30%  Similarity=0.846  Sum_probs=23.1

Q ss_pred             cccCcccccccCCCCCCCCccCccccC
Q psy6282          52 TRFCDKCYQVKADRSHHCSVCGKCVLK   78 (251)
Q Consensus        52 ~~~C~~C~~~kP~Rs~HC~~C~~CV~~   78 (251)
                      .+.|..|...-|+|+--|+.|+.=-+|
T Consensus        14 kkIC~rC~Arnp~~A~kCRkC~~k~LR   40 (50)
T COG1552          14 KKICRRCYARNPPRATKCRKCGYKNLR   40 (50)
T ss_pred             HHHHHHhcCCCCcchhHHhhccCCCcc
Confidence            488999999999999999999765444


No 28 
>KOG1842|consensus
Probab=53.45  E-value=5.1  Score=36.79  Aligned_cols=27  Identities=33%  Similarity=0.941  Sum_probs=20.5

Q ss_pred             CcccCccccc--ccCCCCCCCCccCcccc
Q psy6282          51 GTRFCDKCYQ--VKADRSHHCSVCGKCVL   77 (251)
Q Consensus        51 ~~~~C~~C~~--~kP~Rs~HC~~C~~CV~   77 (251)
                      ...+|..|..  ----|-|||+.||+-+=
T Consensus       179 ~V~~CP~Ca~~F~l~rRrHHCRLCG~VmC  207 (505)
T KOG1842|consen  179 SVQFCPECANSFGLTRRRHHCRLCGRVMC  207 (505)
T ss_pred             cccccccccchhhhHHHhhhhhhcchHHH
Confidence            3589999974  44568999999997443


No 29 
>KOG1314|consensus
Probab=49.36  E-value=6.5  Score=35.13  Aligned_cols=46  Identities=28%  Similarity=0.554  Sum_probs=36.0

Q ss_pred             CcccCcccccccCCCCCCCCccCccccCCcccCcccccccchhhHHHHHHHHhHHHH
Q psy6282          51 GTRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSFTNYKYFLLFLGYALL  107 (251)
Q Consensus        51 ~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~~N~r~Filfl~~~~i  107 (251)
                      +...|.+|+.=-..--|||..-|.||--..|           .-.-+|++|...+.+
T Consensus       104 RSHHCrkCnrCvmkMDHHCPWinnCVG~aNh-----------~~F~~FLlf~ivG~i  149 (414)
T KOG1314|consen  104 RSHHCRKCNRCVMKMDHHCPWINNCVGWANH-----------AYFLRFLLFSIVGCI  149 (414)
T ss_pred             ccccchHHHHHHHhhccCCcchhhccccccc-----------HHHHHHHHHHHHhcc
Confidence            3578999987666678999999999987666           456788888887544


No 30 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=49.04  E-value=9.5  Score=25.33  Aligned_cols=35  Identities=20%  Similarity=0.450  Sum_probs=24.6

Q ss_pred             CCcccccCCCCcccCccccccc----CCCCCCCCccCcc
Q psy6282          41 LPVLNKSIDGGTRFCDKCYQVK----ADRSHHCSVCGKC   75 (251)
Q Consensus        41 ~~~~~~~~~~~~~~C~~C~~~k----P~Rs~HC~~C~~C   75 (251)
                      .++..-++....+.|..|+...    ..|.++|..||.-
T Consensus        17 ~~v~~v~~~~TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   17 IQVVEVDEAYTSQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             CEEEEECCCCCccCccCcccccccccccceEEcCCCCCE
Confidence            4444445556789999998654    4578889998865


No 31 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=48.99  E-value=11  Score=20.82  Aligned_cols=20  Identities=35%  Similarity=0.740  Sum_probs=14.6

Q ss_pred             cCcccccccCCC-CCCCCccC
Q psy6282          54 FCDKCYQVKADR-SHHCSVCG   73 (251)
Q Consensus        54 ~C~~C~~~kP~R-s~HC~~C~   73 (251)
                      .|..|+..--.. .+||+.|+
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGFYFYHCSECC   22 (30)
T ss_pred             CCCCCCCCcCCCEeEEeCCCC
Confidence            477777666666 88888777


No 32 
>PHA02680 ORF090 IMV phosphorylated membrane protein; Provisional
Probab=41.94  E-value=1.2e+02  Score=21.41  Aligned_cols=25  Identities=20%  Similarity=0.393  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHhccCceeeccccC
Q psy6282         149 SLVALFGYHLYLVAQNKTTLEAIRP  173 (251)
Q Consensus       149 ~~~~l~~~h~~li~~n~TtiE~~~~  173 (251)
                      .+++++++..|--+++.++.|+++.
T Consensus        59 l~lGilifs~y~~C~~~~~~~r~n~   83 (91)
T PHA02680         59 LLLGLFVFSMYRKCSGSMPYERLNN   83 (91)
T ss_pred             HHHHHHHHHHhcccCCCceeecccC
Confidence            3445677777777788888887764


No 33 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=41.51  E-value=14  Score=27.50  Aligned_cols=24  Identities=21%  Similarity=0.596  Sum_probs=18.6

Q ss_pred             CcccCcccccccCCCCCC---CCccCc
Q psy6282          51 GTRFCDKCYQVKADRSHH---CSVCGK   74 (251)
Q Consensus        51 ~~~~C~~C~~~kP~Rs~H---C~~C~~   74 (251)
                      ..-+|..|+..-|...++   |+.|+.
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~~CP~Cgs   95 (114)
T PRK03681         69 AECWCETCQQYVTLLTQRVRRCPQCHG   95 (114)
T ss_pred             cEEEcccCCCeeecCCccCCcCcCcCC
Confidence            468999999888776555   999884


No 34 
>COG4640 Predicted membrane protein [Function unknown]
Probab=40.63  E-value=15  Score=33.44  Aligned_cols=26  Identities=35%  Similarity=0.810  Sum_probs=22.2

Q ss_pred             cccCcccccccCCCCCCCCccCcccc
Q psy6282          52 TRFCDKCYQVKADRSHHCSVCGKCVL   77 (251)
Q Consensus        52 ~~~C~~C~~~kP~Rs~HC~~C~~CV~   77 (251)
                      +++|..|+..+-.-+..|..||.=+-
T Consensus         1 M~fC~kcG~qk~Ed~~qC~qCG~~~t   26 (465)
T COG4640           1 MKFCPKCGSQKAEDDVQCTQCGHKFT   26 (465)
T ss_pred             CCcccccccccccccccccccCCcCC
Confidence            47999999999999999999986544


No 35 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=40.36  E-value=14  Score=22.84  Aligned_cols=21  Identities=33%  Similarity=0.920  Sum_probs=11.3

Q ss_pred             ccCcccccccCCC------CCCCCccC
Q psy6282          53 RFCDKCYQVKADR------SHHCSVCG   73 (251)
Q Consensus        53 ~~C~~C~~~kP~R------s~HC~~C~   73 (251)
                      +||..|+....++      -+-|+.|+
T Consensus         1 ~FCp~Cg~~l~~~~~~~~~~~vC~~Cg   27 (52)
T smart00661        1 KFCPKCGNMLIPKEGKEKRRFVCRKCG   27 (52)
T ss_pred             CCCCCCCCccccccCCCCCEEECCcCC
Confidence            3677776444332      23466666


No 36 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=40.28  E-value=16  Score=24.15  Aligned_cols=24  Identities=25%  Similarity=0.851  Sum_probs=21.1

Q ss_pred             cccCcccccccCCCCCCCCccCcc
Q psy6282          52 TRFCDKCYQVKADRSHHCSVCGKC   75 (251)
Q Consensus        52 ~~~C~~C~~~kP~Rs~HC~~C~~C   75 (251)
                      .+-|..|+..-|+-+.-|.+|+.=
T Consensus         4 ~kAC~~Ck~l~~~d~e~CP~Cgs~   27 (64)
T COG2093           4 EKACKNCKRLTPEDTEICPVCGST   27 (64)
T ss_pred             hHHHhhccccCCCCCccCCCCCCc
Confidence            367999999999999999999863


No 37 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=40.21  E-value=20  Score=22.63  Aligned_cols=23  Identities=35%  Similarity=0.829  Sum_probs=14.9

Q ss_pred             cCccccc--ccCCCCCCCCccCccc
Q psy6282          54 FCDKCYQ--VKADRSHHCSVCGKCV   76 (251)
Q Consensus        54 ~C~~C~~--~kP~Rs~HC~~C~~CV   76 (251)
                      -|..|+.  -.-.|.|||+.|++-+
T Consensus         4 ~C~~C~~~F~~~~rk~~Cr~Cg~~~   28 (57)
T cd00065           4 SCMGCGKPFTLTRRRHHCRNCGRIF   28 (57)
T ss_pred             cCcccCccccCCccccccCcCcCCc
Confidence            4566642  3356789999887643


No 38 
>PF09788 Tmemb_55A:  Transmembrane protein 55A;  InterPro: IPR019178  Members of this family catalyse the hydrolysis of the 4-position phosphate of phosphatidylinositol 4,5-bisphosphate, in the reaction:  1-phosphatidyl-myo-inositol 4,5-bisphosphate + H(2)O = 1-phosphatidyl-1D-myo-inositol 5-phosphate + phosphate.  
Probab=39.20  E-value=1.4e+02  Score=25.56  Aligned_cols=23  Identities=26%  Similarity=0.304  Sum_probs=12.1

Q ss_pred             cch-hhHHHHHHHHhHHHHHHHHh
Q psy6282          90 VSF-TNYKYFLLFLGYALLYCIYG  112 (251)
Q Consensus        90 IG~-~N~r~Filfl~~~~i~~~~~  112 (251)
                      ||. ...|-.++|++.+.+..+..
T Consensus       189 VG~~faRkR~i~f~llgllfliia  212 (256)
T PF09788_consen  189 VGPRFARKRAIIFFLLGLLFLIIA  212 (256)
T ss_pred             ccchHhhhHHHHHHHHHHHHHHHH
Confidence            674 45555555555555544433


No 39 
>KOG3183|consensus
Probab=38.73  E-value=15  Score=31.01  Aligned_cols=12  Identities=33%  Similarity=0.379  Sum_probs=9.4

Q ss_pred             ccCCcccCcccc
Q psy6282          76 VLKMDHHCPWVN   87 (251)
Q Consensus        76 V~~~DHHC~wl~   87 (251)
                      ..+.+|||||..
T Consensus        38 rsye~H~Cp~~~   49 (250)
T KOG3183|consen   38 RSYESHHCPKGL   49 (250)
T ss_pred             chHhhcCCCccc
Confidence            456799999974


No 40 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=36.61  E-value=11  Score=21.76  Aligned_cols=7  Identities=57%  Similarity=1.483  Sum_probs=4.2

Q ss_pred             ccCcccc
Q psy6282          53 RFCDKCY   59 (251)
Q Consensus        53 ~~C~~C~   59 (251)
                      ++|.+|+
T Consensus         2 ~FCp~C~    8 (35)
T PF02150_consen    2 RFCPECG    8 (35)
T ss_dssp             -BETTTT
T ss_pred             eeCCCCC
Confidence            5677776


No 41 
>PF03842 Silic_transp:  Silicon transporter;  InterPro: IPR004693 Marine diatoms such as Cylindrotheca fusiformis encode at least six silicon transport protein homologues which exhibit similar size and topology. One characterised member of the family (Sit1) functions in the energy-dependent uptake of either silicic acid [Si(OH)4] or silicate [Si(OH)3O-] by a Na+ symport mechanism. The system is found in marine diatoms, which make their "glass houses" out of silicon.
Probab=36.50  E-value=1.4e+02  Score=27.57  Aligned_cols=26  Identities=27%  Similarity=0.530  Sum_probs=16.9

Q ss_pred             HHHHHHHhHHHHHHHHhcccchhhhh
Q psy6282          96 KYFLLFLGYALLYCIYGSLSTLPYFI  121 (251)
Q Consensus        96 r~Filfl~~~~i~~~~~~~~~~~~~~  121 (251)
                      -||.+|.+|..+..=+.-+.-..|++
T Consensus       171 nyFalFTlyvam~IEfsGvmHssYLI  196 (512)
T PF03842_consen  171 NYFALFTLYVAMAIEFSGVMHSSYLI  196 (512)
T ss_pred             HHHHHHHHHHHHHHHHhhhhHHHHHH
Confidence            58999999988765444444334444


No 42 
>PF00751 DM:  DM DNA binding domain;  InterPro: IPR001275 This domain was first discovered in the doublesex proteins of Drosophila melanogaster and is also seen in proteins from Caenorhabditis elegans []. In D. melanogaster the doublesex gene controls somatic sexual differentiation by producing alternatively spliced mRNAs encoding related sex-specific polypeptides []. These proteins are believed to function as transcription factors on downstream sex-determination genes, especially on neuroblast differentiation and yolk protein genes transcription [, ]. The DM domain binds DNA as a dimer, allowing the recognition of pseudopalindromic sequences [, , ]. The NMR analysis of the DSX DM domain [] revealed a novel zinc module containing 'intertwined' CCHC and HCCC zinc-binding sites. The recognition of the DNA requires the carboxy-terminal basic tail which contacts the minor groove of the target sequence.; GO: 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0007548 sex differentiation, 0005634 nucleus; PDB: 1LPV_A.
Probab=36.28  E-value=13  Score=23.18  Aligned_cols=22  Identities=36%  Similarity=0.774  Sum_probs=8.9

Q ss_pred             CCCCCcc---CccccCCcc--cCcccc
Q psy6282          66 SHHCSVC---GKCVLKMDH--HCPWVN   87 (251)
Q Consensus        66 s~HC~~C---~~CV~~~DH--HC~wl~   87 (251)
                      ..+|..|   |.-+...+|  .|+|-+
T Consensus         2 ~p~C~RCrnHG~~~~lKgHk~~C~~~~   28 (47)
T PF00751_consen    2 SPTCARCRNHGVIVPLKGHKRYCPFRD   28 (47)
T ss_dssp             -SS-HHHHTTT---TTTT-GGG-TTTT
T ss_pred             CCcCcchhcCCcccchhhhccccCcCC
Confidence            4445555   445566666  688864


No 43 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=35.73  E-value=24  Score=22.85  Aligned_cols=22  Identities=36%  Similarity=0.729  Sum_probs=18.1

Q ss_pred             CcccCcccccccCCCCCCCCccCc
Q psy6282          51 GTRFCDKCYQVKADRSHHCSVCGK   74 (251)
Q Consensus        51 ~~~~C~~C~~~kP~Rs~HC~~C~~   74 (251)
                      .++.|..|+.+--  ...|..||.
T Consensus         4 ~mr~C~~CgvYTL--k~~CP~CG~   25 (56)
T PRK13130          4 KIRKCPKCGVYTL--KEICPVCGG   25 (56)
T ss_pred             cceECCCCCCEEc--cccCcCCCC
Confidence            4688999998888  778888875


No 44 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=34.88  E-value=27  Score=34.16  Aligned_cols=39  Identities=31%  Similarity=0.623  Sum_probs=21.3

Q ss_pred             cccCcccccccCCCCCCCCccCccccCCcccCcccccccch
Q psy6282          52 TRFCDKCYQVKADRSHHCSVCGKCVLKMDHHCPWVNNCVSF   92 (251)
Q Consensus        52 ~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC~wl~nCIG~   92 (251)
                      .|||..|+..-+  ...|..||.=+..-..+|+=-|.=.|.
T Consensus        15 akFC~~CG~~l~--~~~Cp~CG~~~~~~~~fC~~CG~~~~~   53 (645)
T PRK14559         15 NRFCQKCGTSLT--HKPCPQCGTEVPVDEAHCPNCGAETGT   53 (645)
T ss_pred             CccccccCCCCC--CCcCCCCCCCCCcccccccccCCcccc
Confidence            466666655432  235666666666666666644444443


No 45 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=34.11  E-value=28  Score=18.41  Aligned_cols=19  Identities=37%  Similarity=0.875  Sum_probs=10.3

Q ss_pred             CcccccccCCCC----CCCCccC
Q psy6282          55 CDKCYQVKADRS----HHCSVCG   73 (251)
Q Consensus        55 C~~C~~~kP~Rs----~HC~~C~   73 (251)
                      |.+|+..-.+|-    +.|..||
T Consensus         1 C~sC~~~i~~r~~~v~f~CPnCG   23 (24)
T PF07754_consen    1 CTSCGRPIAPREQAVPFPCPNCG   23 (24)
T ss_pred             CccCCCcccCcccCceEeCCCCC
Confidence            555655544553    4566665


No 46 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=33.94  E-value=27  Score=22.85  Aligned_cols=23  Identities=22%  Similarity=0.571  Sum_probs=16.0

Q ss_pred             cccCcccccccCCCCCCCC-ccCc
Q psy6282          52 TRFCDKCYQVKADRSHHCS-VCGK   74 (251)
Q Consensus        52 ~~~C~~C~~~kP~Rs~HC~-~C~~   74 (251)
                      .+-|..|+..-|+--..|| .|+.
T Consensus         3 HkHC~~CG~~Ip~~~~fCS~~C~~   26 (59)
T PF09889_consen    3 HKHCPVCGKPIPPDESFCSPKCRE   26 (59)
T ss_pred             CCcCCcCCCcCCcchhhhCHHHHH
Confidence            3668888877777777775 6654


No 47 
>KOG4017|consensus
Probab=33.76  E-value=19  Score=30.64  Aligned_cols=35  Identities=26%  Similarity=0.540  Sum_probs=25.9

Q ss_pred             CCcccCcccccccCC----CCCCCCccCccccCCcccCc
Q psy6282          50 GGTRFCDKCYQVKAD----RSHHCSVCGKCVLKMDHHCP   84 (251)
Q Consensus        50 ~~~~~C~~C~~~kP~----Rs~HC~~C~~CV~~~DHHC~   84 (251)
                      ....-|..|...-.+    -.++|++|+.|--.+|-|=.
T Consensus       101 ~~~~~C~eC~~i~mDs~L~~~F~~~VCd~CRd~~ekykL  139 (274)
T KOG4017|consen  101 ALAPKCEECDKIEMDSYLFDTFGCSVCDSCRDKDEKYKL  139 (274)
T ss_pred             hhchhHHHhcCccchHHHHHhcCChhhhHhhhhhhhhhe
Confidence            345679999854433    46899999999999877543


No 48 
>KOG2927|consensus
Probab=33.13  E-value=62  Score=29.09  Aligned_cols=32  Identities=13%  Similarity=0.269  Sum_probs=22.3

Q ss_pred             ccCCCCCCCCcc-CccccCCcccCcccccccch
Q psy6282          61 VKADRSHHCSVC-GKCVLKMDHHCPWVNNCVSF   92 (251)
Q Consensus        61 ~kP~Rs~HC~~C-~~CV~~~DHHC~wl~nCIG~   92 (251)
                      .++-+..||-+= ++--..-|-|=.|+-+-+-.
T Consensus       156 ~kkkk~~~l~i~~dQ~F~d~de~YVW~yep~~~  188 (372)
T KOG2927|consen  156 KKKKKKFELEIHDDQAFQDGDEHYVWIYEPRPL  188 (372)
T ss_pred             hcccCccceeeccchhhcccCceEEEeccCCch
Confidence            567777777766 45555558888999776644


No 49 
>PF08600 Rsm1:  Rsm1-like;  InterPro: IPR013909 This entry contains Nuclear-interacting partner of ALK (NIPA) and NIPA like proteins, as well as mRNA export factor Rsm1, all of which contain a C3HC-type zinc finger. The domain represented in this entry is found C-terminal to the zinc-finger like domain IPR012935 from INTERPRO. Rsm1 is involved in mRNA export from the nucleus []. NIPA is an essential component of an SCF-type E3 ligase complex, SCF(NIPA), a complex that controls mitotic entry by mediating ubiquitination and subsequent degradation of cyclin B1 (CCNB1). Its cell-cycle-dependent phosphorylation regulates the assembly of the SCF(NIPA) complex, restricting CCNB1 ubiquitination activity to interphase. Its inactivation results in nuclear accumulation of CCNB1 in interphase and premature mitotic entry [].
Probab=31.35  E-value=27  Score=24.88  Aligned_cols=10  Identities=50%  Similarity=1.261  Sum_probs=7.9

Q ss_pred             ccCccccccc
Q psy6282          81 HHCPWVNNCV   90 (251)
Q Consensus        81 HHC~wl~nCI   90 (251)
                      .||||++.-.
T Consensus        56 ~~CPwv~~~~   65 (91)
T PF08600_consen   56 EYCPWVNPST   65 (91)
T ss_pred             ccCCccCCcc
Confidence            6899998654


No 50 
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=30.71  E-value=4e+02  Score=24.62  Aligned_cols=33  Identities=18%  Similarity=0.363  Sum_probs=26.0

Q ss_pred             CcccCcccccccCCCCCCCCccCccccCCcccC
Q psy6282          51 GTRFCDKCYQVKADRSHHCSVCGKCVLKMDHHC   83 (251)
Q Consensus        51 ~~~~C~~C~~~kP~Rs~HC~~C~~CV~~~DHHC   83 (251)
                      ...-|..|...-|....||..|+.-..+..++.
T Consensus       220 ~l~~C~~Cd~l~~~~~a~CpRC~~~L~~~~~~s  252 (419)
T PRK15103        220 GLRSCSCCTAILPADQPVCPRCHTKGYVRRRNS  252 (419)
T ss_pred             CCCcCCCCCCCCCCCCCCCCCCCCcCcCCCCCC
Confidence            356799999888877779999998887766544


No 51 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=30.01  E-value=30  Score=33.84  Aligned_cols=24  Identities=21%  Similarity=0.715  Sum_probs=16.6

Q ss_pred             ccCcccccccCCCCCCCCccCccc
Q psy6282          53 RFCDKCYQVKADRSHHCSVCGKCV   76 (251)
Q Consensus        53 ~~C~~C~~~kP~Rs~HC~~C~~CV   76 (251)
                      ..|..|+..-|+.++.|..||.=.
T Consensus         2 ~~Cp~Cg~~n~~~akFC~~CG~~l   25 (645)
T PRK14559          2 LICPQCQFENPNNNRFCQKCGTSL   25 (645)
T ss_pred             CcCCCCCCcCCCCCccccccCCCC
Confidence            457777777777777777776543


No 52 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=29.85  E-value=38  Score=19.07  Aligned_cols=21  Identities=29%  Similarity=0.822  Sum_probs=13.1

Q ss_pred             cCcccccc-cCC-CCCCCCccCc
Q psy6282          54 FCDKCYQV-KAD-RSHHCSVCGK   74 (251)
Q Consensus        54 ~C~~C~~~-kP~-Rs~HC~~C~~   74 (251)
                      .|..|+-. .+. ....|.+|+.
T Consensus         3 ~C~~CGy~y~~~~~~~~CP~Cg~   25 (33)
T cd00350           3 VCPVCGYIYDGEEAPWVCPVCGA   25 (33)
T ss_pred             ECCCCCCEECCCcCCCcCcCCCC
Confidence            47777744 444 4667777764


No 53 
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=29.31  E-value=22  Score=22.04  Aligned_cols=28  Identities=25%  Similarity=0.623  Sum_probs=19.7

Q ss_pred             CCcccCccccccc---CCCCCCCCccCcccc
Q psy6282          50 GGTRFCDKCYQVK---ADRSHHCSVCGKCVL   77 (251)
Q Consensus        50 ~~~~~C~~C~~~k---P~Rs~HC~~C~~CV~   77 (251)
                      ..+.+|..|+..-   -..+.+|+.|+.-+-
T Consensus         9 ~~~~~C~~C~~~i~g~~~~g~~C~~C~~~~H   39 (53)
T PF00130_consen    9 SKPTYCDVCGKFIWGLGKQGYRCSWCGLVCH   39 (53)
T ss_dssp             SSTEB-TTSSSBECSSSSCEEEETTTT-EEE
T ss_pred             CCCCCCcccCcccCCCCCCeEEECCCCChHh
Confidence            3468999998766   677889999975443


No 54 
>smart00423 PSI domain found in Plexins, Semaphorins and Integrins.
Probab=28.98  E-value=22  Score=21.49  Aligned_cols=14  Identities=43%  Similarity=1.324  Sum_probs=6.4

Q ss_pred             cCccccCCcccCcc
Q psy6282          72 CGKCVLKMDHHCPW   85 (251)
Q Consensus        72 C~~CV~~~DHHC~w   85 (251)
                      |..|+...|-||.|
T Consensus         7 C~~C~~~~~~~C~W   20 (46)
T smart00423        7 CSECLLARDPYCAW   20 (46)
T ss_pred             HHHHHcCCCCCCCc
Confidence            44444444444444


No 55 
>PLN00186 ribosomal protein S26; Provisional
Probab=28.96  E-value=23  Score=26.09  Aligned_cols=14  Identities=57%  Similarity=1.042  Sum_probs=11.4

Q ss_pred             CCCCCccCccccCC
Q psy6282          66 SHHCSVCGKCVLKM   79 (251)
Q Consensus        66 s~HC~~C~~CV~~~   79 (251)
                      .=||..|++||.+=
T Consensus        20 ~V~C~nCgr~vPKD   33 (109)
T PLN00186         20 RIRCSNCGKCVPKD   33 (109)
T ss_pred             ceeeCCCccccccc
Confidence            34799999999973


No 56 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=28.94  E-value=32  Score=21.61  Aligned_cols=23  Identities=35%  Similarity=0.957  Sum_probs=14.3

Q ss_pred             cccCccccc-ccCC--CCCCCCccCc
Q psy6282          52 TRFCDKCYQ-VKAD--RSHHCSVCGK   74 (251)
Q Consensus        52 ~~~C~~C~~-~kP~--Rs~HC~~C~~   74 (251)
                      .++|+.|+. ..-+  ..++|..|+.
T Consensus        20 ~~fCP~Cg~~~m~~~~~r~~C~~Cgy   45 (50)
T PRK00432         20 NKFCPRCGSGFMAEHLDRWHCGKCGY   45 (50)
T ss_pred             cCcCcCCCcchheccCCcEECCCcCC
Confidence            469999987 2222  3456777763


No 57 
>KOG3611|consensus
Probab=28.85  E-value=20  Score=35.55  Aligned_cols=27  Identities=33%  Similarity=0.893  Sum_probs=21.9

Q ss_pred             CCCCC---ccCccccCCcccCcccc---cccch
Q psy6282          66 SHHCS---VCGKCVLKMDHHCPWVN---NCVSF   92 (251)
Q Consensus        66 s~HC~---~C~~CV~~~DHHC~wl~---nCIG~   92 (251)
                      -|+|+   .|-.|++..|-||.|-+   .|+-.
T Consensus       491 l~~C~~y~~C~dcclarDPYCAWd~~~~~C~~~  523 (737)
T KOG3611|consen  491 LARCSRYGSCADCCLARDPYCAWDGVNSKCSLL  523 (737)
T ss_pred             hhHhhcccchhhhhhccCCCccccCCCCcceEC
Confidence            46777   79888888999999998   78633


No 58 
>PHA02942 putative transposase; Provisional
Probab=28.19  E-value=33  Score=31.30  Aligned_cols=34  Identities=26%  Similarity=0.428  Sum_probs=23.2

Q ss_pred             CCcccccCCCCcccCcccccccC---CCCCCCCccCc
Q psy6282          41 LPVLNKSIDGGTRFCDKCYQVKA---DRSHHCSVCGK   74 (251)
Q Consensus        41 ~~~~~~~~~~~~~~C~~C~~~kP---~Rs~HC~~C~~   74 (251)
                      ..+..-++....+.|..|+...+   .|.+.|..||.
T Consensus       314 ~~Vv~V~p~yTSq~Cs~CG~~~~~l~~r~f~C~~CG~  350 (383)
T PHA02942        314 MIVEFVNPSYSSVSCPKCGHKMVEIAHRYFHCPSCGY  350 (383)
T ss_pred             CEEEEECCCCCCccCCCCCCccCcCCCCEEECCCCCC
Confidence            33333455556789999986654   37888888886


No 59 
>PF14015 DUF4231:  Protein of unknown function (DUF4231)
Probab=27.87  E-value=73  Score=22.98  Aligned_cols=25  Identities=16%  Similarity=0.294  Sum_probs=15.7

Q ss_pred             ccCceeeccccCCCcccCCCCCCCC
Q psy6282         162 AQNKTTLEAIRPPVFSYGPDKQGYN  186 (251)
Q Consensus       162 ~~n~TtiE~~~~~~~~~~~~~npyd  186 (251)
                      ..+++|-|.++...+++....-||+
T Consensus        79 ~~~r~tae~lk~e~~~~~~~~~~Y~  103 (112)
T PF14015_consen   79 IRYRATAESLKREKWLYLAGAGPYK  103 (112)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCCCC
Confidence            4678888888766555443444554


No 60 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=27.72  E-value=33  Score=17.87  Aligned_cols=21  Identities=24%  Similarity=0.635  Sum_probs=15.4

Q ss_pred             cCcccccccCCCCCCCCccCc
Q psy6282          54 FCDKCYQVKADRSHHCSVCGK   74 (251)
Q Consensus        54 ~C~~C~~~kP~Rs~HC~~C~~   74 (251)
                      .|..|...-.++...|..|+.
T Consensus         4 ~C~~C~~~N~~~~~~C~~C~~   24 (26)
T smart00547        4 ECPACTFLNFASRSKCFACGA   24 (26)
T ss_pred             cCCCCCCcChhhhccccccCC
Confidence            477787777777777877763


No 61 
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only]
Probab=26.69  E-value=22  Score=29.82  Aligned_cols=19  Identities=32%  Similarity=0.840  Sum_probs=16.0

Q ss_pred             ccCCCCCCCCccCccccCC
Q psy6282          61 VKADRSHHCSVCGKCVLKM   79 (251)
Q Consensus        61 ~kP~Rs~HC~~C~~CV~~~   79 (251)
                      |++.+..||..|..|++|.
T Consensus       187 Y~g~~~~~CG~C~sC~~R~  205 (222)
T COG0603         187 YNGGEGDHCGECESCVLRE  205 (222)
T ss_pred             eCCCCCCCCCCCHHHHHHH
Confidence            5677777999999999983


No 62 
>PRK09335 30S ribosomal protein S26e; Provisional
Probab=26.59  E-value=27  Score=25.17  Aligned_cols=19  Identities=26%  Similarity=0.595  Sum_probs=13.8

Q ss_pred             CCCCCccCccccCCcccCc
Q psy6282          66 SHHCSVCGKCVLKMDHHCP   84 (251)
Q Consensus        66 s~HC~~C~~CV~~~DHHC~   84 (251)
                      .=+|..|++||.+----+.
T Consensus        20 ~V~C~nCgr~vPKDKAIkr   38 (95)
T PRK09335         20 YVQCDNCGRRVPRDKAVCV   38 (95)
T ss_pred             cEEeCCCCCcCcCCceEEE
Confidence            3479999999998544443


No 63 
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=25.66  E-value=5.3e+02  Score=23.71  Aligned_cols=32  Identities=16%  Similarity=0.417  Sum_probs=24.2

Q ss_pred             cccCccccc-ccCCCCCCCCccCccccCCcccC
Q psy6282          52 TRFCDKCYQ-VKADRSHHCSVCGKCVLKMDHHC   83 (251)
Q Consensus        52 ~~~C~~C~~-~kP~Rs~HC~~C~~CV~~~DHHC   83 (251)
                      ..-|..|.. .+|....+|..|+.-..+..++.
T Consensus       215 ~~~C~~Cd~~~~~~~~a~CpRC~~~L~~~~~~s  247 (403)
T TIGR00155       215 LRSCSACHTTILPAQEPVCPRCSTPLYVRRRNS  247 (403)
T ss_pred             CCcCCCCCCccCCCCCcCCcCCCCcccCCCCCC
Confidence            456999997 56666778999998887766544


No 64 
>PTZ00172 40S ribosomal protein S26; Provisional
Probab=25.36  E-value=28  Score=25.65  Aligned_cols=14  Identities=50%  Similarity=1.049  Sum_probs=11.3

Q ss_pred             CCCCCccCccccCC
Q psy6282          66 SHHCSVCGKCVLKM   79 (251)
Q Consensus        66 s~HC~~C~~CV~~~   79 (251)
                      .=||..|++||.+=
T Consensus        20 ~V~C~nCgr~vPKD   33 (108)
T PTZ00172         20 PVRCSNCGRCVPKD   33 (108)
T ss_pred             cEEeCCcccccccc
Confidence            34799999999973


No 65 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=25.10  E-value=39  Score=25.06  Aligned_cols=24  Identities=29%  Similarity=0.648  Sum_probs=16.8

Q ss_pred             CcccCcccccccCCCCCC--CCccCc
Q psy6282          51 GTRFCDKCYQVKADRSHH--CSVCGK   74 (251)
Q Consensus        51 ~~~~C~~C~~~kP~Rs~H--C~~C~~   74 (251)
                      ..-+|..|+..-+....+  |..|+.
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQHDAQCPHCHG   94 (113)
T ss_pred             cEEEcccCCCEEecCCcCccCcCCCC
Confidence            457899998665554333  888874


No 66 
>smart00301 DM Doublesex DNA-binding motif.
Probab=24.77  E-value=44  Score=21.47  Aligned_cols=6  Identities=33%  Similarity=1.293  Sum_probs=3.8

Q ss_pred             cCcccc
Q psy6282          82 HCPWVN   87 (251)
Q Consensus        82 HC~wl~   87 (251)
                      +|+|-+
T Consensus        23 ~C~~r~   28 (54)
T smart00301       23 ECPFRD   28 (54)
T ss_pred             CCCCCC
Confidence            677654


No 67 
>PF01437 PSI:  Plexin repeat;  InterPro: IPR002165 This is a cysteine rich repeat found in several different extracellular receptors. The function of the repeat is unknown. Three copies of the repeat are found in plexin (P70206 from SWISSPROT) []. Two copies of the repeat are found in mahogany protein. A related Caenorhabditis elegans protein (Q19981 from SWISSPROT) contains four copies of the repeat, while the Met receptor contains a single copy of the repeat.; GO: 0016020 membrane; PDB: 3NVQ_B 3NVN_B 3OL2_B 3OKT_A 3AL8_A 3OKW_A 3OKY_B 3AFC_B 1OLZ_B 1SHY_B ....
Probab=24.51  E-value=13  Score=23.24  Aligned_cols=17  Identities=29%  Similarity=0.933  Sum_probs=10.5

Q ss_pred             CccCccccCCcccCccc
Q psy6282          70 SVCGKCVLKMDHHCPWV   86 (251)
Q Consensus        70 ~~C~~CV~~~DHHC~wl   86 (251)
                      ..|..|+.-.|-+|.|-
T Consensus         6 ~sC~~Cl~~~dp~CgWc   22 (51)
T PF01437_consen    6 TSCSSCLSSRDPYCGWC   22 (51)
T ss_dssp             SSHHHHHHSTCTTEEEE
T ss_pred             CcHHHHHcCCCcCcccc
Confidence            45666666666666664


No 68 
>PF00539 Tat:  Transactivating regulatory protein (Tat);  InterPro: IPR001831 Like other lentiviruses, Human immunodeficiency virus 1 (HIV-1) encodes a trans-activating regulatory protein (Tat), which is essential for efficient transcription of the viral genome [, ]. Tat acts by binding to an RNA stem-loop structure, the trans-activating response element (TAR), found at the 5' ends of nascent HIV-1 transcripts. In binding to TAR, Tat alters the properties of the transcription complex, recruits a positive transcription elongation complex (P-TEFb) and hence increases the production of full-length viral RNA []. Tat protein also associates with RNA polymerase II complexes during early transcription elongation after the promoter clearance and before the synthesis of full-length TAR RNA transcript. This interaction of Tat with RNA polymerase II elongation complexes is P-TEFb-independent. There are two Tat binding sites on each transcription elongation complex; one is located on TAR RNA and the other one on RNA polymerase II near the exit site for nascent mRNA transcripts which suggests that two Tat molecules are involved in performing various functions during a single round of HIV-1 mRNA synthesis [].  The minimum Tat sequence that can mediate specific TAR binding in vitro has been mapped to a basic domain of 10 amino acids, comprising mostly Arg and Lys residues. Regulatory activity, however, also requires the 47 N-terminal residues, which interact with components of the transcription complex and function as a transcriptional activation domain [, , ].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0042025 host cell nucleus; PDB: 2W2H_D 1ZBN_B 1TVS_A 1TVT_A 3O6L_C 3O6M_C 3MI9_C 3MIA_C 1JFW_A 1TBC_A ....
Probab=24.12  E-value=45  Score=22.45  Aligned_cols=13  Identities=46%  Similarity=1.497  Sum_probs=8.3

Q ss_pred             ccCcccccccCCCCCCCCcc
Q psy6282          53 RFCDKCYQVKADRSHHCSVC   72 (251)
Q Consensus        53 ~~C~~C~~~kP~Rs~HC~~C   72 (251)
                      -||.+|       ++||-+|
T Consensus        30 CyCK~C-------cyHCqlC   42 (68)
T PF00539_consen   30 CYCKKC-------CYHCQLC   42 (68)
T ss_dssp             SSSTTS-------TSSSSCC
T ss_pred             cccCcc-------eeeceee
Confidence            555555       6777766


No 69 
>KOG1819|consensus
Probab=23.80  E-value=39  Score=31.82  Aligned_cols=22  Identities=36%  Similarity=0.795  Sum_probs=13.7

Q ss_pred             ccCcccccc--cCCCCCCCCccCc
Q psy6282          53 RFCDKCYQV--KADRSHHCSVCGK   74 (251)
Q Consensus        53 ~~C~~C~~~--kP~Rs~HC~~C~~   74 (251)
                      --|-.|+..  .--|-|||+.||.
T Consensus       902 ~~cmacq~pf~afrrrhhcrncgg  925 (990)
T KOG1819|consen  902 EQCMACQMPFNAFRRRHHCRNCGG  925 (990)
T ss_pred             hhhhhccCcHHHHHHhhhhcccCc
Confidence            446666532  2247788988875


No 70 
>PF03461 TRCF:  TRCF domain;  InterPro: IPR005118  This domain is found in proteins necessary for strand-specific repair in DNA such as TRCF in Escherichia coli. A lesion in the template strand blocks the RNA polymerase complex (RNAP). The RNAP-DNA-RNA complex is specifically recognised by the transcription-repair-coupling factor (TRCF) which releases RNAP and the truncated transcript.; GO: 0003684 damaged DNA binding, 0004386 helicase activity, 0005524 ATP binding, 0006281 DNA repair; PDB: 2QSR_A 2EYQ_A.
Probab=23.40  E-value=98  Score=22.30  Aligned_cols=34  Identities=12%  Similarity=0.220  Sum_probs=15.7

Q ss_pred             CCCCCCCCCCChhhh----hhhccCCChHHHHHHHHHh
Q psy6282           4 LGTAPKHFKLSPSLQ----HALFTTDNDVERKQILEQF   37 (251)
Q Consensus         4 PG~~p~~~~~~~~~~----~~~~~~~~~~~~~~~~~~~   37 (251)
                      ++++|..|.++..+.    .++....+.++-.++.+++
T Consensus         5 ~a~IP~~YI~d~~~Rl~~Yrrl~~~~~~~el~~l~~El   42 (101)
T PF03461_consen    5 DAYIPEDYIPDDDERLELYRRLASAESEEELEDLREEL   42 (101)
T ss_dssp             --S--TTTS--HHHHHHHHHHHHC--SHHHHHHHHHHH
T ss_pred             cccCChHHcCChHHHHHHHHHHhhCCCHHHHHHHHHHH
Confidence            789999999987763    2455555555555544444


No 71 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=22.71  E-value=49  Score=21.44  Aligned_cols=20  Identities=35%  Similarity=0.811  Sum_probs=13.7

Q ss_pred             cccCcccccccCCCCCC-CCccC
Q psy6282          52 TRFCDKCYQVKADRSHH-CSVCG   73 (251)
Q Consensus        52 ~~~C~~C~~~kP~Rs~H-C~~C~   73 (251)
                      ...|..|+.++.+  || |..||
T Consensus        27 l~~C~~CG~~~~~--H~vC~~CG   47 (57)
T PRK12286         27 LVECPNCGEPKLP--HRVCPSCG   47 (57)
T ss_pred             ceECCCCCCccCC--eEECCCCC
Confidence            4679999877755  44 66665


No 72 
>KOG1729|consensus
Probab=22.52  E-value=27  Score=30.59  Aligned_cols=25  Identities=36%  Similarity=0.755  Sum_probs=13.4

Q ss_pred             cccCccccc---ccCCCCCCCCccCccc
Q psy6282          52 TRFCDKCYQ---VKADRSHHCSVCGKCV   76 (251)
Q Consensus        52 ~~~C~~C~~---~kP~Rs~HC~~C~~CV   76 (251)
                      ...|..|..   ---.|=|||+.||.-|
T Consensus       168 a~~C~~C~~~~Ftl~~RRHHCR~CG~iv  195 (288)
T KOG1729|consen  168 ATECMVCGCTEFTLSERRHHCRNCGDIV  195 (288)
T ss_pred             ceecccCCCccccHHHHHHHHHhcchHh
Confidence            345555544   2234667777666543


No 73 
>cd01995 ExsB ExsB is a transcription regulator related protein. It is a subfamily of a Adenosine nucleotide binding superfamily of proteins. This protein family is represented by a single member in nearly every completed large ( 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown
Probab=22.49  E-value=27  Score=27.42  Aligned_cols=23  Identities=30%  Similarity=0.858  Sum_probs=16.0

Q ss_pred             cCcccccccCCCCCCCCccCccccCC
Q psy6282          54 FCDKCYQVKADRSHHCSVCGKCVLKM   79 (251)
Q Consensus        54 ~C~~C~~~kP~Rs~HC~~C~~CV~~~   79 (251)
                      .-.+|...   ...||..|..|+.|.
T Consensus       142 ~s~sC~~~---~~~~CG~C~~C~~r~  164 (169)
T cd01995         142 LTWSCYNG---GEKHCGECDSCLLRK  164 (169)
T ss_pred             heeeccCC---CCCCCCCCHHHHHHH
Confidence            34555543   227999999999873


No 74 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.33  E-value=50  Score=24.69  Aligned_cols=25  Identities=20%  Similarity=0.389  Sum_probs=17.5

Q ss_pred             CCcccCcccccccCCCC--C-CCCccCc
Q psy6282          50 GGTRFCDKCYQVKADRS--H-HCSVCGK   74 (251)
Q Consensus        50 ~~~~~C~~C~~~kP~Rs--~-HC~~C~~   74 (251)
                      ...-+|..|+..-+...  + +|..|+.
T Consensus        69 p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs   96 (117)
T PRK00564         69 KVELECKDCSHVFKPNALDYGVCEKCHS   96 (117)
T ss_pred             CCEEEhhhCCCccccCCccCCcCcCCCC
Confidence            34688999986666543  2 4888875


No 75 
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=22.29  E-value=1.4e+02  Score=28.91  Aligned_cols=59  Identities=15%  Similarity=0.326  Sum_probs=34.8

Q ss_pred             ChHHHHHHHHHhhccCCcccccCCCCcccCcccccccCCCC-CCCCccCccccCCcccCcccccccch
Q psy6282          26 NDVERKQILEQFSASLPVLNKSIDGGTRFCDKCYQVKADRS-HHCSVCGKCVLKMDHHCPWVNNCVSF   92 (251)
Q Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~kP~Rs-~HC~~C~~CV~~~DHHC~wl~nCIG~   92 (251)
                      +++.-.++.+...+.- +.-...+....+|..|+. .-.+. ..|+.||.      |.|-++...+|+
T Consensus       499 n~eal~~lv~~a~~~~-i~Y~~~n~~~~~C~~CG~-~g~~~~~~CP~Cgs------~~~~~~~Rv~GY  558 (579)
T TIGR02487       499 DPEALKDITKKAMKNG-IGYFGINPPVDVCEDCGY-TGEGLNDKCPKCGS------HDIEVISRITGY  558 (579)
T ss_pred             CHHHHHHHHHHHHhcC-CceEEeccCCccCCCCCC-CCCCCCCcCcCCCC------ccceehhhhhhh
Confidence            3445555555544431 223345566789999985 55555 68999986      235555555554


No 76 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=22.21  E-value=49  Score=24.60  Aligned_cols=24  Identities=17%  Similarity=0.397  Sum_probs=17.3

Q ss_pred             CcccCcccccccCC--CCCCCCccCc
Q psy6282          51 GTRFCDKCYQVKAD--RSHHCSVCGK   74 (251)
Q Consensus        51 ~~~~C~~C~~~kP~--Rs~HC~~C~~   74 (251)
                      ..-+|..|+..-+.  +...|+.|+.
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (115)
T TIGR00100        69 VECECEDCSEEVSPEIDLYRCPKCHG   94 (115)
T ss_pred             cEEEcccCCCEEecCCcCccCcCCcC
Confidence            45889999866555  3566888874


No 77 
>COG5270 PUA domain (predicted RNA-binding domain) [Translation, ribosomal structure and biogenesis]
Probab=21.67  E-value=46  Score=27.09  Aligned_cols=22  Identities=41%  Similarity=0.913  Sum_probs=17.6

Q ss_pred             CcccCcccccccCCCCCCCCccCc
Q psy6282          51 GTRFCDKCYQVKADRSHHCSVCGK   74 (251)
Q Consensus        51 ~~~~C~~C~~~kP~Rs~HC~~C~~   74 (251)
                      ...||.+|+..-+-|.  |+.|+.
T Consensus        13 ~iyWCe~cNlPl~~~~--c~~cg~   34 (202)
T COG5270          13 PIYWCEKCNLPLLGRR--CSVCGS   34 (202)
T ss_pred             ceeehhhCCCcccccc--ccccCC
Confidence            3689999999888764  888884


No 78 
>TIGR00364 exsB protein. This protein family is represented by a single member in nearly every completed large ( 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown.
Probab=21.59  E-value=46  Score=27.01  Aligned_cols=13  Identities=31%  Similarity=1.009  Sum_probs=10.9

Q ss_pred             CCCCCccCccccC
Q psy6282          66 SHHCSVCGKCVLK   78 (251)
Q Consensus        66 s~HC~~C~~CV~~   78 (251)
                      ..||..|..|+.|
T Consensus       189 ~~~CG~C~~C~~r  201 (201)
T TIGR00364       189 GEGCGKCPSCMLR  201 (201)
T ss_pred             CCCCCCChhhhcc
Confidence            3599999999875


No 79 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=21.46  E-value=39  Score=18.78  Aligned_cols=22  Identities=36%  Similarity=1.004  Sum_probs=9.9

Q ss_pred             cccCccccc-ccC---CCCCCCCccC
Q psy6282          52 TRFCDKCYQ-VKA---DRSHHCSVCG   73 (251)
Q Consensus        52 ~~~C~~C~~-~kP---~Rs~HC~~C~   73 (251)
                      .+||..|.. -++   .++..|..|+
T Consensus         3 ~rfC~~CG~~t~~~~~g~~r~C~~Cg   28 (32)
T PF09297_consen    3 HRFCGRCGAPTKPAPGGWARRCPSCG   28 (32)
T ss_dssp             TSB-TTT--BEEE-SSSS-EEESSSS
T ss_pred             CcccCcCCccccCCCCcCEeECCCCc
Confidence            478888873 222   3445555554


No 80 
>TIGR00811 sit silicon transporter. Marine diatoms such as Cylindrotheca fusiformis encode at least six silicon transport protein homologues which exhibit similar size and topology. One characterized member of the family (Sit1) functions in the energy-dependent uptake of either Silicic acid [Si(OH)4] or Silicate [Si(OH)3O-] by a Na+ symport mechanism. The system is found in marine diatoms which make their "glass houses" out of silicon.
Probab=20.30  E-value=4.7e+02  Score=24.71  Aligned_cols=13  Identities=15%  Similarity=0.192  Sum_probs=9.1

Q ss_pred             HHHHHhccCceee
Q psy6282         156 YHLYLVAQNKTTL  168 (251)
Q Consensus       156 ~h~~li~~n~Tti  168 (251)
                      .-+..+..|.|+.
T Consensus       239 Vtl~ALFnG~T~m  251 (545)
T TIGR00811       239 VTIEALFNGQTTM  251 (545)
T ss_pred             HHHHHHHCCCcee
Confidence            4555677888886


No 81 
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only]
Probab=20.22  E-value=91  Score=26.95  Aligned_cols=17  Identities=35%  Similarity=0.638  Sum_probs=11.8

Q ss_pred             CCCCC--CCCCCCCChhhh
Q psy6282           2 TPLGT--APKHFKLSPSLQ   18 (251)
Q Consensus         2 ~dPG~--~p~~~~~~~~~~   18 (251)
                      -|||.  .|+.|.+++...
T Consensus        29 iDpGVsLaPkRy~LPPh~~   47 (304)
T COG2248          29 IDPGVSLAPKRYGLPPHQR   47 (304)
T ss_pred             ECCccccCccccCCCCCHH
Confidence            37774  689898776543


No 82 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=20.15  E-value=66  Score=19.04  Aligned_cols=26  Identities=19%  Similarity=0.313  Sum_probs=17.9

Q ss_pred             CcccCcccccccCC--CCCCCCccCccc
Q psy6282          51 GTRFCDKCYQVKAD--RSHHCSVCGKCV   76 (251)
Q Consensus        51 ~~~~C~~C~~~kP~--Rs~HC~~C~~CV   76 (251)
                      ...+|..|+..-+.  .+..|+.|+.-+
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~C~~C~~~~   37 (49)
T smart00109       10 KPTKCCVCRKSIWGSFQGLRCSWCKVKC   37 (49)
T ss_pred             CCCCccccccccCcCCCCcCCCCCCchH
Confidence            35789999765543  388899885433


Done!