Diaphorina citri psyllid: psy6286

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16

MSLLHMEELKCRKRVLRRLGYATEADVIEMKGRVACELSKSEETVILTINDKLELARHIARISIESKLDLDEDSYVNQFKPSLMDVVHAWCEGASFLKVCSITDIFEGSIIRCMRRLEEVLRQLVQASRNIGNTLLEEKFNEAIKTVKRDIFLEILENL

cccccHHHHHHHHHHHHHHcccccccccccccEEEEEEcccccHHHHHHccHHHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHHHccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccEEEEccccc

MSLLHMEELKCRKRVLRRLGYATEADVIEMKGRVACELSKSEETVILTINDKLELARHIARISIESKLDLDEDSYVNQFKPSLMDVVHAWCEGASFLKVCSITDIFEGSIIRCMRRLEEVLRQLVQASRNIGNTLLEEKFNEAIKTVKRDIFLEILEN*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSLLHMEELKCRKRVLRRLGYATEADVIEMKGRVACELSKSEETVILTINDKLELARHIARISIESKLDLDEDSYVNQFKPSLMDVVHAWCEGASFLKVCSITDIFEGSIIRCMRRLEEVLRQLVQASRNIGNTLLEEKFNEAIKTVKRDIFLEILENL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0022008 [BP]	neurogenesis	probable	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0000178 [CC]	exosome (RNase complex)	probable	GO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0000460 [BP]	maturation of 5.8S rRNA	probable	GO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:0071840, GO:0006139, GO:0044260, GO:1901360, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L9O, chain A
Confidence level:very confident
Coverage over the Query: 2-158
View the alignment between query and template
View the model in PyMOL